Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000476 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000476
Unique NameTCONS_00000476
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1949

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000476 ID=TCONS_00000476|Name=TCONS_00000476|organism=Clytia hemisphaerica|type=transcript|length=1949bp
ACCGGACCTAaggaacaccggacacgcgaaagtccggtgtaaaatgagaa
atttttttaccaccggacaatctctacaccggacttaaagAAGTCGGATG
Tcaggtgtcggagaaggatatttgtttccaccggacaatcaaaacaccag
tcctgtgcgtccggtgtttcttaattttttgtttcataaatgtccggcgt
ccaaaattacctgtatgcaacaccggactgacaccggacttattgcctcc
ggtgtagcgaaaggatactttttaccaccggacaaataccgagacagtcc
ggtgcgtcggcagggcgGGTCCTGAACCAATAGGATTTGAAAAACTGAGC
TTGGCAGCTAGCTTTGGCTAGCTAAATTCTTTAAATGTCTCAAGTTCAGT
TGTGACGGTTTTATATTTGTATTTGTAGTTCTCCTCTAAAGTTTCCGGTA
ATAAAANCAAGTTCAGTTGTGACGGTTTTATATTTGTATTTGTAGTTCTC
CTCTAAAGTTTCTGGTAATAAAAGAAAATCTCACCGAATGTGTCACACCC
CACATTAAAACAGCCATCTTTGGATCATGGACTCTAAAAACTTTAACCTT
TTGGTGAACGGCTTTcacctttttctttttggattttgtaaATGTATCTT
TAATAGCCTCCATCTTCTTATTGTGTAGTATTACTAATTATCGATAATTT
CAACAGAAATACAGCACCTcctaaagaaaaaaatgcatCTGGTTTTCACT
TGAAGATTTTCAACTTTCCAACCTCGCCAAATATCGGCTTATCTGCCTGT
TACGGTATAGTGAAGAAGCAGAACATGTATTTTGCAGAACGCTTTATTTC
ATTAGTATTTCTTATATTACTCTCTGTTCCGTAATTTTCAAGAAGAACTC
AATCGTATATGATCTAGTCAATAACAAACACGGCGGATAAAGTAGCGGAG
CGTGAGCAAGCAGTAAATCgcaaaaactttttgcaaatactAAATTTTTA
GAAGGAATTTGCTTCACTCCAAAACTGCAATCATGagtATTATGAGCTAC
AATGGTTCAGCCTTAGTGGCAATGAAAGGCAAAGACTGTGTCGCTATCGC
ATCTGATTTGAGATACGGTATTCAATTACAGACTGttgcttttgattttg
aaaagattttccaaatcaGTGATAAATTATATCTTGGTTTGTCTGGCTTG
GCAACGGATATCCAGACAGTATCAAACTTGGCAAAATTCCGAACGAATTT
ATACGAATTACGTGAAAACCGAAAAGTCTCACCAAAAGCATTCATGAACA
TCATGTCAAATATCTTATACGGAAGACGATTTGGGCCGTATTTTGTTGAA
CCCATCATTTGTGGGCTTCACCCGAAAACTAACGAACCGTATATCGCATC
CTGCGATCTGATTGGTTGTCCCATGGAACCGGAAGATTTCGTGGTTGGTG
GAACTTGTAGCGAACAGTTATATGGAATGTGTGAAGTAGTGTGGGAACCA
GACATGGGACCAGATGATTTATTCGAGAGCATCTCTCAAGCACTTTTAAA
CGCACAAGATCGGGATTGTATGGCCGGTTGGGGAGCTGTCGTTCATATCA
TCGAAAAAGACAAAGTGACTACACGAAAACTTAAAGGTAGAATGGATTAA
GCAGAAAGCAAAGCGAATACACTCTCAGTGGGTCACACCATTGAAGAATG
TTTTAATCACATAAATCAGTATAAGAACGTCACTATAAACTACCAATCAA
GCGAGTGCAATTATGGGTTACTTTCACCGTTACAAGAATTTTTTTAGGAA
GCtatttataattttcaaatatatttcctGCCCTGGATATTGAATATGTT
GTTTATCTTTTAACCGTGTTACCaatatcagtttgagttatatGAAAATC
ATTGTTGGCCTCGTCCTCAGTTTTGTTGTGCTAAATTTGTGCCAAATTG
Run BLAST on NCBI

protein sequence of TCONS_00000476-protein

>TCONS_00000476-protein ID=TCONS_00000476-protein|Name=TCONS_00000476-protein|organism=Clytia hemisphaerica|type=polypeptide|length=205bp
MSIMSYNGSALVAMKGKDCVAIASDLRYGIQLQTVAFDFEKIFQISDKLY
LGLSGLATDIQTVSNLAKFRTNLYELRENRKVSPKAFMNIMSNILYGRRF
GPYFVEPIICGLHPKTNEPYIASCDLIGCPMEPEDFVVGGTCSEQLYGMC
EVVWEPDMGPDDLFESISQALLNAQDRDCMAGWGAVVHIIEKDKVTTRKL
KGRMD
Run BLAST on NCBI

transcript from alignment at sc0000002:1335129..1343039+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000476 ID=TCONS_00000476|Name=TCONS_00000476|organism=Clytia hemisphaerica|type=transcript|length=7911bp|location=Sequence derived from alignment at sc0000002:1335129..1343039+ (Clytia hemisphaerica)
ACCGGACCTAaggaacaccggacacgcgaaagtccggtgtaaaatgagaa atttttttaccaccggacaatctctacaccggacttaaagAAGTCGGATG Tcaggtgtcggagaaggatatttgtttccaccggacaatcaaaacaccag tcctgtgcgtccggtgtttcttaattttttgtttcataaatgtccggcgt ccaaaattacctgtatgcaacaccggactgacaccggacttattgcctcc ggtgtagcgaaaggatactttttaccaccggacaaataccgagacagtcc ggtgcgtcggcagggcgGGTCCTGAACCAATAGGATTTGAAAAACTGAGC TTGGCAGCTAGCTTTGGCTAGCTAAATTCTTTAAATGTCTCAAGTTCAGT TGTGACGGTTTTATATTTGTATTTGTAGTTCTCCTCTAAAGTTTCCGGTA ATAAAANCAAGTTCAGTTGTGACGGTTTTATATTTGTATTTGTAGTTCTC CTCTAAAGTTTCTGGTAATAAAAGAAAATCTCACCGAATGTGTCACACCC CACATTAAAACAGCCATCTTTGGATCATGGACTCTAAAAACTTTAACCTT TTGGTGAACGGCTTTcacctttttctttttggattttgtaaATGTATCTT TAATAGCCTCCATCTTCTTATTGTGTAGTATTACTAATTATCGATAATTT CAACAGAAATACAGCACCTcctaaagaaaaaaatgcatCTGGTTTTCACT TGAAGATTTTCAACTTTCCAACCTCGCCAAATATCGGCTTATCTGCCTGT TACGGTATAGTGAAGAAGCAGAACATGTATTTTGCAGAACGCTTTATTTC ATTAGTATTTCTTATATTACTCTCTGTTCCGTAATTTTCAAGAAGAACTC AATCGTATATGATCTAGTCAATAACAAACACGGCGGATAAAGTAGCGGAG CGTGAGCAAGCAGTAAATCgcaaaaactttttgcaaatactAAATTTTTA GAAGGAATTTGCTTCACTCCAAAACTGCAATCATGGtatgtaaattttct tttaattaagAGTTAATTCCtgtgtctcaaatattttgcttATTAATATT TGATTAAATGTGGCTGTCCTTTGGATGACAGAATCGTACTGAATGCGGAC GCCTGCAATTTTGCCACAACCATTTCATCTCCCCAGAGATTCGAATTGAT CGAaagccgaatcaattgaacacaatcaaaaGCAATcaaactagtgtata tgtataagaattgccaAGCGATCCTGGCAAGTCATTCGATTCGAACCATA CCCAATTAGGAATATCGTCAGTGTAGACTTgaataggaccctgccgacgc accggacttaacgaacaccggacacgcgaaagtccggtgtaaaatgagaa ttttttttaccaccggacaatttctgcaccggacttaaggaagtcagatg tccggtgtcggagaaggatattttttcccaccggacaatcaaaacatatC GGACATGCATGActagtccggtgcgtccggtgtttcttaattttttgttt tataaacgTCCggtgtccaaaattccctgtatgcaacaccggactgacac cggactaattgcgtccggtgtagcgaaaggacactttttgccaccggacg aatacaccggacagtccggtgcgtcggcagggtcctacttgaatcttcat acaaaaattacgggaaacgcatatttggtgaaaaagggtgcgctatcagt gaaaattatcgtgacatgttatgacagaaagtatgattgataaacttggt ggagttatcaaaacaaatttgttgtcaaagagataacagtaagtgaaaat aaaggccagatatcaacagtcccatgttgtttggaccaatcgtcccaaga aGTTAGAACTGTTGacggtaaaaagtaaaaaatctgtgacttGTTTCTCG GCTGTATTAGGGTAGacactcaaaattttaaaatgatctaaagtaaaata aataattGTAGGCTCATTTGAAAGCCCTCACATTCAGAGAAATCCACCAA GGAAGGGGTCATTTGTCCAAAATGGTTgagtatttcaaaagttataacaa aaagaatttgttaATATCTTACCTTTCACTGTCCAATACAGCAAGTCAAG CTAAACCTAAAGCACACCATCGAAGcaaaaaatattatgaaaaagGTCAC ATGACTCGTATAGCTAAGGAGCTGGTTTTTGTCTATGTGGGTAAGAAAAG TTGTCAACCAGCTATAAAAAATGTCAGATTTCAAAGATTTCCCAAGGAGC AGTTGATGatatgaaaaaaatacttttttactGTATCAAGTAAGATTAGA AGGACTAGGACACAAAGAAAAACAGTGCAAACAGAAGCACAAAAGACTTA TTATTAGACGATGAAAGCAATTATGGACTTCTAGTTTTTTGCATTGTACA GGTGAATAGTTTTCTTCAtaggggccattcaaaaagtacgttcgtcgccg aggggggagggggtcagcaAAAAAGCGAATGAAAACGAACNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN GGGGGGGTAACAATGGGGTAAAAATTTTGAGATAAAAACAAACGTaccaa aggggggggggtacttcaAAACGAACGCTGACGAACAAGGGGGGGTctga aaatagggaaatttggacgaacgtactttttgaatggccccatatttaaa aaaattatagacTAGTATTTGTTTTCTTCATACATGTAATTGATTCCTTA AGTTCAAAAGTTATCTTTTTTTCACCTGCGTGGTGTTTGTTGCGTTCAAA TTCTCTGACTTCCTTCATCCCTAGCTGTATTGTAGacatttaaaacagtt aaaaaagtGTATCATAAAAATGATGTCAAGTTTGTTGATGTATTTTGACA TATTACCATTACCAACAGTAAAATCCTTTATAATACAAAcacatgtcaat gttctatttTTCTGACCACCAATCCGGGGTGGGGGGCACTCAGGCAAATT GACTGACAgttatgtgcggcggttaagggtgtgtttttcaaaatatcaga aatgcactgtaagggtggatttttgataaatgcactgtatgggtggaaat ttcagcaaatctaggaaaaattgcaaatttttggtcgaaaatcttgatta ttttgctctaaaagaatttaaaatttgagCAAATGCACTGTGAGGGTATg aatttctccaattttttttctgcactgtaagggtgcgatttttTAGGCAC ATTGGACGTGTCAAATTTCAGAGGGCACTTAAACACGCAAGCACTTCAGA TGAGGGCATTTAGGGCACGTCACTTAGTAGACTCATTTTTCGGGAGCCAT GCAGGAGCTTGAGCTGAGTCAAGGACCATAAGGCAATAACGAGTCATAAA TATTGGATCAGCATAGAGACTCTGATAACGGTCAGAttcggctgaaattt tgaacacttgttccttgggtgaaaaCCTGTGGATGAGCTTCTCGTTATTG ATATTATTTTAAGCattcaaataattttgattgatttctttttattttca gagtATTATGAGCTACAATGGTTCAGCCTTAGTGGCAATGAAAGGCAAAG ACTGTGTCGCTATCGCATCTGATTTGAGATACGGTATTCAATTACAGACT GttgcttttgattttgaaaagattttccaaatcaGTGATAAATTATATCT TGGTTTGTCTGGCTTGGCAACGGATATCCAGACAGTGTAAGTTAGGCAAC ActtgtttgcttatttttaaaCATACACTAGCTAGAAACTGAGAGAGAGT ATAGAAAGGTGTCTTTTCCCCTTCTTAGATGGGTCGCTTCTTGACATCCT GAAGCTTCCTGCATATTTAGAAAATTAAAACCTTGTTGATTTCAAATATC TGTGTTTAGATTTTTCATATCTTTCATAGATAAAGTGCTGTAGCACTGCT AAGTTGGTCAGTTTTGCtgtttttggtgatttttggccgtttttttcatc ttcatttttcttcttcatttttgaatttttcaaatatcttttaTCTTTTA GATTATActccttggaaatatctttccaacggtgtataactcTCTAACAT AGCATAAATGTATGCTgagaaaaagtccaaaactgaagtgtccacatact tttgagacagacttttaTATGTGTATTATCTTGAAAGATCGGGGAAGAAA TAATCTATTTTTATTATGTTGATcttgaattgggcttttccagaaaaaaa attgaatatggggggcggaggatataacaattttcagtgatttacccccc ggacaaagtgacttttggcccctcGGACAATgggttttaccccccggaca gagcaaattcaCCCCCTGgtcaaggcaaattttgatgatttttcgctacc ccggacaatatatcctccaccccccatgtacggacattttctggaagagc ccattgcaacatttgattttaaaatattttaatccaTCTAGATCAAACTT GGCAAAATTCCGAACGAATTTATACGAATTACGTGAAAACCGAAAAGTCT CACCAAAAGCATTCATGAACATCATGTCAAATATCTTATACGGAAGACGG TAAGCTCTTGACAAACTTTATTTCTCAACACATTATGAAACTTCAATCAG ATTAATTTATTATATCTCTTCCAGAATCCTAATATTTCAGTTTGGAATTC GCTCTCAGCATTCGAGAACCTTATATTGAAGTTtttgttcccgtttcata tcagacacatgttttatATTAGGCCGGTGTCTCCTATTGTTATGTATTGT GCTTGATTTCGTGCCAAataaacaatgtttttctttcttctttctaacaa atattgctccacatccgtgtcaattcaatgtgaaaaagcctgaaaaagct tgtaatttaaaatgatgaataagcaaacgatattaACTTAGTTTAAAATT AAGCCTTCTGGCAACTCGTTGTGAGCTAAACCTTTTCCAATATCactgct ttaaaaagcctttcCATTTGTAGATTTTACTTAAGGCACATTACAAAAAT AGTGCTATTTGCTTCTTGTTTGAGTGAGtaaatttcatactcaaagtttc atgcccGTAAAGGATGGGAACCTTCATAGTGAATTGAACGTGCTCTTAAA aaatttctgacgtcaatttcacaTTTTTCGAAAGACTCGGGAAGAATTTT CCGTCGCTTATTTTACTGAAATTgcctatatatatatatcatgaaacttt gagttaagaaatttatttaaatcgttttttcttttctttcagtttcTTTA GTCTAATATAAAGCACTGTTATCATCAACATTGAGCACTCTTATTGGTTT TCGCTAACAAAAATCATCTTCACTCCTAATGTTTTTCAAACCATTTTCTC TTCTACTTTAGATTTGGGCCGTATTTTGTTGAACCCATCATTTGTGGGCT TCACCCGAAAACTAACGAACCGTATATCGCATCCTGCGATCTGATTGGTT GTCCCATGGAACCGGAAGATTTCGTGGTTGGTGGAACTTGTAGCGAACAG TTATATGGTGAGTAGGAACCCCATTTTCATTGGAGGGCTATACAAAGAAA TCATTGAGGCTTTTCAGTTTAAACTTAGTTATTTAATTTTCACCATTACA CATGGAAATACTTCTGCAAGCAATTGGCACTTTTAAGTCGAATGTTTCAC CCAGGATGGATAATGAAATTATATACCTTGCCAAAACGTGATCTTATCAA TATAATTTCTCCTCTGATTATCACTaagaaaagaattgaaaaaatgatAA ATGCCACCTTCCTAGCCTAGATTGCAGTGCAACATTAcatatttcataag aacaaactataaaagaacataagtcttcgatggctgaaattttaacagcg agttttaattttaaggctttgtggactcttaAACGCCCGTTTTCTTagca aaatgaacaaaaatactcgcACAATGGTGGAAATAAGAACAAcgtagagg ccactatgtcttcccgtgtgcagcagcttgtgcaaagggattttatgatt gaatattgttccttgaatgtagaagatcaaaatttgagaggtggggccgg gtgtgactacccgttgccatggaaactgacattggttactatggcaacca atataaaaagtcatcaaaattgaaaaaagaccCTCCagggaacataaaat attattacgaaaacgtttgaaaattcgttaaaaaaagtctattggccaaa attgacaatttcattttttgcctgTCGAAGGTTGGAGCTTGCCCAAACAC ATTatacaggcaaaatttaaaaatattaattttggctcatagacttctta aaaaggattttcagactttttcgtaataataatttttgttcACTGGAAAG TActctttccaaaaaaccaaaagtttttgaattttggcaaatttttgttt ttcgatgacgtcatcgttttatgacgtcattttgccttatttccttaata tctcctgatatattcattttcagatataggttgtgacctttttctttatc agttNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaaaa attttcaattttgacgactttttattttggttgccatagtaaccaatgac gtcagtttccatggcaacgggtggtCACACCCGGCCTNNNNNNNNNNNNN NNNNNNNNNNNNNNctctcaaattttgatcttctacattcaaggaacaat attcaatcataaaatccctttgcacaagctgctgcacacgggaagctttt tcgcgacatagtggcccctaccatttttaggcttgaaactcaaaaagttg accaacggaaggcttcaaaaattttggatgttcttataaaaaaaagctgt TGTTTACTTTTCTTCTCCAGGAATGTGTGAAGTAGTGTGGGAACCAGACA TGGGACCAGATGATTTATTCGAGAGCATCTCTCAAGCACTTTTAAACGCA CAAGATCGGGATTGTATGGCCGGTTGGGGAGCTGTCGTTCATATCATGTA AGTCATCTACAACCTCTTGGCATATTAGATGGCAAACTGTATATTAACGT TTCATTGTTCAACTTTTAACTAGGCGGCTGGTATTGAAAAGTCTTTCAGG CGTTTTTAGATTGGTCGATTTTCGTTAAAATTACAATTTAGATTGCTAAA TGTCGCAATACTCTACCCTTCCACTCATATGGACCGATCTAATAAGGGAA AATTAGTGCGGTTCCCTACAGGCCAGCCCTTTAAAAGGTTCCTTTCATGG AAGAGCTTACCGAGAAAAAACTAAAAGTTGTCTCATAGCAAAATCGATGC AATGTTTTCGCAAGTTCTGCAAAAGATTTACtcaaaatgattgtttttcc tTTCTTTGTTTAGCGAAAAAGACAAAGTGACTACACGAAAACTTAAAGGT AGAATGGATTAAGCAGAAAGCAAAGCGAATACACTCTCAGTGGGTCACAC CATTGAAGAATGTTTTAATCACATAAATCAGTATAAGAACGTCACTATAA ACTACCAATCAAGCGAGTGCAATTATGGGTTACTTTCACCGTTACAAGAA TTTTTTTAGGAAGCtatttataattttcaaatatatttcctGCCCTGGAT ATTGAATATGTTGTTTATCTTTTAACCGTGTTACCaatatcagtttgagt tatatGAAAATCATTGTTGGCCTCGTCCTCAGTTTTGTTGTGCTAAATTT GTGCCAAATTG

Coding sequence (CDS) from alignment at sc0000002:1335129..1343039+

>TCONS_00000476 ID=TCONS_00000476|Name=TCONS_00000476|organism=Clytia hemisphaerica|type=CDS|length=3708bp|location=Sequence derived from alignment at sc0000002:1335129..1343039+ (Clytia hemisphaerica)
ATGagtATTATGAGCTACAATGGTTCAGCCTTAGTGGCAATGAAAGGCAA
AGACTGTGTCGCTATCGCATCTGATTTGAGATACGGTATTCAATTACAGA
CTGttgcttttgattttgaaaagattttccaaatcaGTGATAAATTATAT
CTTGGTTTGTCTGGCTTGGCAACGGATATCCAGACAGTATCAAACTTGGC
AAAATTCCGAACGAATTTATACGAATTACGTGAAAACCGAAAAGTCTCAC
CAAAAGCATTCATGAACATCATGTCAAATATCTTATACGGAAGACGATTT
GGGCCGTATTTTGTTGAACCCATCATTTGTGGGCTTCACCCGAAAACTAA
CGAACCGTATATCGCATCCTGCGATCTGATTGGTTGTCCCATGGAACCGG
AAGATTTCGTGGTTGGTGGAACTTGTAGCGAACAGTTATATGGAATGTGT
GAAGTAGTGTGGGAACCAGACATGGGACCAGATGATTTATTCGAGAGCAT
CTCTCAAGCACTTTTAAACGCACAAGATCGGGATTGTATGGCCGGTTGGG
GAGCTGTCGTTCATATCATCGAAAAAGACAAAGTGACTACACGAAAACTT
AAAGGTAGAATGGATTAAATGagtATTATGAGCTACAATGGTTCAGCCTT
AGTGGCAATGAAAGGCAAAGACTGTGTCGCTATCGCATCTGATTTGAGAT
ACGGTATTCAATTACAGACTGttgcttttgattttgaaaagattttccaa
atcaGTGATAAATTATATCTTGGTTTGTCTGGCTTGGCAACGGATATCCA
GACAGTATCAAACTTGGCAAAATTCCGAACGAATTTATACGAATTACGTG
AAAACCGAAAAGTCTCACCAAAAGCATTCATGAACATCATGTCAAATATC
TTATACGGAAGACGATTTGGGCCGTATTTTGTTGAACCCATCATTTGTGG
GCTTCACCCGAAAACTAACGAACCGTATATCGCATCCTGCGATCTGATTG
GTTGTCCCATGGAACCGGAAGATTTCGTGGTTGGTGGAACTTGTAGCGAA
CAGTTATATGGAATGTGTGAAGTAGTGTGGGAACCAGACATGGGACCAGA
TGATTTATTCGAGAGCATCTCTCAAGCACTTTTAAACGCACAAGATCGGG
ATTGTATGGCCGGTTGGGGAGCTGTCGTTCATATCATCGAAAAAGACAAA
GTGACTACACGAAAACTTAAAGGTAGAATGGATTAAATGagtATTATGAG
CTACAATGGTTCAGCCTTAGTGGCAATGAAAGGCAAAGACTGTGTCGCTA
TCGCATCTGATTTGAGATACGGTATTCAATTACAGACTGttgcttttgat
tttgaaaagattttccaaatcaGTGATAAATTATATCTTGGTTTGTCTGG
CTTGGCAACGGATATCCAGACAGTATCAAACTTGGCAAAATTCCGAACGA
ATTTATACGAATTACGTGAAAACCGAAAAGTCTCACCAAAAGCATTCATG
AACATCATGTCAAATATCTTATACGGAAGACGATTTGGGCCGTATTTTGT
TGAACCCATCATTTGTGGGCTTCACCCGAAAACTAACGAACCGTATATCG
CATCCTGCGATCTGATTGGTTGTCCCATGGAACCGGAAGATTTCGTGGTT
GGTGGAACTTGTAGCGAACAGTTATATGGAATGTGTGAAGTAGTGTGGGA
ACCAGACATGGGACCAGATGATTTATTCGAGAGCATCTCTCAAGCACTTT
TAAACGCACAAGATCGGGATTGTATGGCCGGTTGGGGAGCTGTCGTTCAT
ATCATCGAAAAAGACAAAGTGACTACACGAAAACTTAAAGGTAGAATGGA
TTAAATGagtATTATGAGCTACAATGGTTCAGCCTTAGTGGCAATGAAAG
GCAAAGACTGTGTCGCTATCGCATCTGATTTGAGATACGGTATTCAATTA
CAGACTGttgcttttgattttgaaaagattttccaaatcaGTGATAAATT
ATATCTTGGTTTGTCTGGCTTGGCAACGGATATCCAGACAGTATCAAACT
TGGCAAAATTCCGAACGAATTTATACGAATTACGTGAAAACCGAAAAGTC
TCACCAAAAGCATTCATGAACATCATGTCAAATATCTTATACGGAAGACG
ATTTGGGCCGTATTTTGTTGAACCCATCATTTGTGGGCTTCACCCGAAAA
CTAACGAACCGTATATCGCATCCTGCGATCTGATTGGTTGTCCCATGGAA
CCGGAAGATTTCGTGGTTGGTGGAACTTGTAGCGAACAGTTATATGGAAT
GTGTGAAGTAGTGTGGGAACCAGACATGGGACCAGATGATTTATTCGAGA
GCATCTCTCAAGCACTTTTAAACGCACAAGATCGGGATTGTATGGCCGGT
TGGGGAGCTGTCGTTCATATCATCGAAAAAGACAAAGTGACTACACGAAA
ACTTAAAGGTAGAATGGATTAAATGagtATTATGAGCTACAATGGTTCAG
CCTTAGTGGCAATGAAAGGCAAAGACTGTGTCGCTATCGCATCTGATTTG
AGATACGGTATTCAATTACAGACTGttgcttttgattttgaaaagatttt
ccaaatcaGTGATAAATTATATCTTGGTTTGTCTGGCTTGGCAACGGATA
TCCAGACAGTATCAAACTTGGCAAAATTCCGAACGAATTTATACGAATTA
CGTGAAAACCGAAAAGTCTCACCAAAAGCATTCATGAACATCATGTCAAA
TATCTTATACGGAAGACGATTTGGGCCGTATTTTGTTGAACCCATCATTT
GTGGGCTTCACCCGAAAACTAACGAACCGTATATCGCATCCTGCGATCTG
ATTGGTTGTCCCATGGAACCGGAAGATTTCGTGGTTGGTGGAACTTGTAG
CGAACAGTTATATGGAATGTGTGAAGTAGTGTGGGAACCAGACATGGGAC
CAGATGATTTATTCGAGAGCATCTCTCAAGCACTTTTAAACGCACAAGAT
CGGGATTGTATGGCCGGTTGGGGAGCTGTCGTTCATATCATCGAAAAAGA
CAAAGTGACTACACGAAAACTTAAAGGTAGAATGGATTAAATGagtATTA
TGAGCTACAATGGTTCAGCCTTAGTGGCAATGAAAGGCAAAGACTGTGTC
GCTATCGCATCTGATTTGAGATACGGTATTCAATTACAGACTGttgcttt
tgattttgaaaagattttccaaatcaGTGATAAATTATATCTTGGTTTGT
CTGGCTTGGCAACGGATATCCAGACAGTATCAAACTTGGCAAAATTCCGA
ACGAATTTATACGAATTACGTGAAAACCGAAAAGTCTCACCAAAAGCATT
CATGAACATCATGTCAAATATCTTATACGGAAGACGATTTGGGCCGTATT
TTGTTGAACCCATCATTTGTGGGCTTCACCCGAAAACTAACGAACCGTAT
ATCGCATCCTGCGATCTGATTGGTTGTCCCATGGAACCGGAAGATTTCGT
GGTTGGTGGAACTTGTAGCGAACAGTTATATGGAATGTGTGAAGTAGTGT
GGGAACCAGACATGGGACCAGATGATTTATTCGAGAGCATCTCTCAAGCA
CTTTTAAACGCACAAGATCGGGATTGTATGGCCGGTTGGGGAGCTGTCGT
TCATATCATCGAAAAAGACAAAGTGACTACACGAAAACTTAAAGGTAGAA
TGGATTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000300XLOC_000300Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000476-proteinTCONS_00000476-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000476-exon-sc0000002-1491911889:1335129..1336163TCONS_00000476-exon-sc0000002-1491911889:1335129..1336163Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1510915933:1335129..1336163TCONS_00000476-exon-sc0000002-1510915933:1335129..1336163Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1575043694:1335129..1336163TCONS_00000476-exon-sc0000002-1575043694:1335129..1336163Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1491911889:1338730..1338914TCONS_00000476-exon-sc0000002-1491911889:1338730..1338914Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1510915933:1338730..1338914TCONS_00000476-exon-sc0000002-1510915933:1338730..1338914Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1575043694:1338730..1338914TCONS_00000476-exon-sc0000002-1575043694:1338730..1338914Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1491911889:1339670..1339777TCONS_00000476-exon-sc0000002-1491911889:1339670..1339777Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1510915933:1339670..1339777TCONS_00000476-exon-sc0000002-1510915933:1339670..1339777Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1575043694:1339670..1339777TCONS_00000476-exon-sc0000002-1575043694:1339670..1339777Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1491911889:1340590..1340735TCONS_00000476-exon-sc0000002-1491911889:1340590..1340735Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1510915933:1340590..1340735TCONS_00000476-exon-sc0000002-1510915933:1340590..1340735Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1575043694:1340590..1340735TCONS_00000476-exon-sc0000002-1575043694:1340590..1340735Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1491911889:1342199..1342325TCONS_00000476-exon-sc0000002-1491911889:1342199..1342325Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1510915933:1342199..1342325TCONS_00000476-exon-sc0000002-1510915933:1342199..1342325Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1575043694:1342199..1342325TCONS_00000476-exon-sc0000002-1575043694:1342199..1342325Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1491911889:1342692..1343039TCONS_00000476-exon-sc0000002-1491911889:1342692..1343039Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1510915933:1342692..1343039TCONS_00000476-exon-sc0000002-1510915933:1342692..1343039Clytia hemisphaericaexon
TCONS_00000476-exon-sc0000002-1575043694:1342692..1343039TCONS_00000476-exon-sc0000002-1575043694:1342692..1343039Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1335129..1343039 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
201.076 208.315 143.954 138.73 94.0905 73.199 115.069 125.427 128.393 119.125 108.662 95.0164 68.6066 65.9952 76.3776 87.7996 104.572 105.814 36.3079 47.9285 81.1937 80.3998 97.1141 92.0358 99.3141 94.4536 84.9688 62.7825 71.5159 62.2999
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR029055Ntn_hydrolases_N
IPR001353Proteasome_sua/b
IPR016050Proteasome_bsu_CS
IPR023333Proteasome_suB-type
IPR033811Proteasome_beta_3
Vocabulary: Cellular Component
TermDefinition
GO:0005839proteasome core complex
GO:0019774proteasome core complex, beta-subunit complex
Vocabulary: Biological Process
TermDefinition
GO:0051603proteolysis involved in cellular protein catabolic process
GO:0043161proteasome-mediated ubiquitin-dependent protein catabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0004298threonine-type endopeptidase activity
GO:0004175endopeptidase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
biological_process GO:0051603 proteolysis involved in cellular protein catabolic process
cellular_component GO:0005839 proteasome core complex
cellular_component GO:0019774 proteasome core complex, beta-subunit complex
molecular_function GO:0004175 endopeptidase activity
molecular_function GO:0004298 threonine-type endopeptidase activity
Blast
BLAST of TCONS_00000476 vs. Swiss-Prot (Human)
Match: PSB3 (Proteasome subunit beta type-3 OS=Homo sapiens GN=PSMB3 PE=1 SV=2)

HSP 1 Score: 298.901 bits (764), Expect = 1.635e-96
Identity = 133/205 (64.88%), Postives = 169/205 (82.44%), Query Frame = 1
Query: 1033 MSIMSYNGSALVAMKGKDCVAIASDLRYGIQLQTVAFDFEKIFQISDKLYLGLSGLATDIQTVSNLAKFRTNLYELRENRKVSPKAFMNIMSNILYGRRFGPYFVEPIICGLHPKTNEPYIASCDLIGCPMEPEDFVVGGTCSEQLYGMCEVVWEPDMGPDDLFESISQALLNAQDRDCMAGWGAVVHIIEKDKVTTRKLKGRMD 1647
            MSIMSYNG A++AMKGK+CVAIA+D R+GIQ Q V  DF+KIF + D+LY+GL+GLATD+QTV+   KFR NLYEL+E R++ P   M++++N+LY +RFGPY+ EP+I GL PKT +P+I S DLIGCPM  +DFVV GTC+EQ+YGMCE +WEP+M PD LFE+ISQA+LNA DRD ++G G +VHIIEKDK+TTR LK RMD
Sbjct:    1 MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD 205          
The following BLAST results are available for this feature:
BLAST of TCONS_00000476 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PSB31.635e-9664.88Proteasome subunit beta type-3 OS=Homo sapiens GN=... [more]
back to top