Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000448 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000448
Unique NameTCONS_00000448
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2554

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000448 ID=TCONS_00000448|Name=TCONS_00000448|organism=Clytia hemisphaerica|type=transcript|length=2554bp
atgTGTTTCATTTCTTTTCTTATAGAATAATTTAATTGAattatgttttt
tcttaaattggCAATTGGGATTTGTTGTGTGGTAGTTGTATTGAGCTCAG
ACTGTTTAAAAACAGTGATAAACAGTAAAGGGACCAAATATTTTCTCgat
gagatttttcaaaaatatgctaCCAACGATAAGATGACAATCACCGAATT
TTCTacattcattaaaaaatttgatattgGTGAGATCAAGATAACATGTG
ATAAAAACGACCCACACTGCATGGAGGAATCACACAATGTTCAaaggaga
agaagaaatttGCCAGATGCTTATAATTCATCATCACACAAAAGTCATTG
GAATGACCATGCTAGAAAGTGTTTGAAGCCACGTGAACTACTTCGTCGCA
ATGAAATCAATTCAACCAAAACATCCATTACACGTGAAGATTTCGTCAAA
ATTTGTCCTTCCATACTTCAACAAATCGAAAGCAAGAAATGTTTGCACCT
TCATCGGACAACGAAAGTCGTTCTCGGACACGATGATGCTCCGGACAGAA
AATCAGTTTGGTTGTACGGTATGTTGTCCATCACAGTTATCAGTTTACTT
TCACTTGCTGTCATTACCATGATCCCATGTTTAAAGAAGTCCTTTTACCA
TAAAATCATGGCTTATCTTATGGCACTGGCTGTTGGAACTCTGGCTGGTG
ATGCCATGCTCCATTTGATCCCTCATGCTTTTGCAGAAGGTGCGAACTCA
GCAGCGAACTTGGTGATCAACGATGAGCAGAAATTGAAACAACATTATTC
GCAAGTCTATCGTGCTTCTTTCGTTCTTCTTGGTATCTATATCTTTTTCT
TAGTGGAACACCTCATGAAACTCAAAGTCATTTGTAAGGGTAATCATGGC
CACAGCCATGGTGGAGGAGGTCACACGGCAGTGCCAGTAAATGATGAAGA
ACGGTCGAGTAGTCCACCTGCCAGTCCTGGTGCTAATGATTTggatgacg
atgatgatgaaaAAGCTATCGTTCAGTTTgataaagaagatgaaaaagtt
gctCTAAAGAACAATGGCGCAGCTTCACCCACATTGAGTTGTCAATCCAA
TTTACACTCAAACGGTGACGGGGGCAACAACACTGTATCAGAAGGAGGCC
ATTACCATAGCGACGATCGACACCATCATCATCACCATGGTGAGAAAAAC
GTAACCAAGGATACCAAAATCACCAGCCTCGCTTGGATGGTCATCGTTGG
AGATggttttcataattttacggatGGTCTAGCTGTGGGTGTGGCTTATT
CTGCATCTCTCTCAAGTGGACTGAGCACGACCATTGCCGTTTTTTGTCAT
GAACTTCCACATGAATTGGGTGATTTTGCCATTCTAATATCAAACGGGAT
GTCAATCAAACAAGCCATCATATACAACCTTGTGTCTGCCATATTGGCTT
ATCTTGGATTAATCGCTGGTATCCTGTTGGGAGGATCCGAAATGGGACGT
CATTTTATTCTCTCCATAACGGCTGGTCTTTTTCTTTACGTCTCCTTAGC
TGACATGTTACCAGAGCTGAGCCATCAAGAAGTACCAAATGCTTCAAAAT
TCTCAGCCTTCGTTTGCCAACATCTTGGCATTCTCAGTGGTTTTGCTATC
ATGTTATTCATTTCATTATACGAACATGCTATATAATGAAGAAATCGCGA
AAGCTAGATTCAAATTATCTTGAAAATCGGATTACCGGAATGAATCCGAT
AACGATGAGATGGAAGATCGGCAGACTGATTTTCGGTTCGATTGAGAAGA
GATTCCCTTCTAATACATACATGATGCACTAGGGTCAAAGAATGTGCTTG
AACGAAAGATAATGGAAGAAGGAGGTGGATTTCAGCTTGAACTCTGATGA
CATTATGACATTTGCtgctttttgaaaagtgaaactgattttggaatCTG
AGCGAGTAAATCTTTAGTTTAAAGCCTGAAAGGCTaaagtagaatctcta
acccttagaagttcctttgtttttgaggactgcattttttggaATCTAGC
GACagatccggcgtttgtgtaagagcaacgcgcgggcgttctggatggga
gataagtgacttcatttcccatccaggagtctcgagtctagcccttagGG
CGTGGAAGTCAATGAgcgtacagttgactctcttaCTCGATCTTCAAGCC
CTCTTCAAGGGACCGAGAATTTTTCTCGAATAATGGCAATATTCGGATTA
CGGAGAGCATTTAATACAAGCGAGGAAACCAATGCTTTggatcgaattac
agaaagattcgagttAAGCGGGTTCGATAATTAGAGAGGGTTTGACTGTA
TATCTTTTTTTTCGTTAAGAGTAGAACTTTTATTTATAGAAGCAGATAAT
CTTTTTTAAAGACAACagaatatttgttttgttttgttttacaaTATATA
GAAAAGGGATATATCGAGATGGAGATATTTAACCTGCAGAAAAGAAACAA
TCCTATCGCGAAATGAAATTCACACGGAAATATCTATATACTCAAATTAA
TTNA
Run BLAST on NCBI

protein sequence of TCONS_00000448-protein

>TCONS_00000448-protein ID=TCONS_00000448-protein|Name=TCONS_00000448-protein|organism=Clytia hemisphaerica|type=polypeptide|length=547bp
MFFLKLAIGICCVVVVLSSDCLKTVINSKGTKYFLDEIFQKYATNDKMTI
TEFSTFIKKFDIGEIKITCDKNDPHCMEESHNVQRRRRNLPDAYNSSSHK
SHWNDHARKCLKPRELLRRNEINSTKTSITREDFVKICPSILQQIESKKC
LHLHRTTKVVLGHDDAPDRKSVWLYGMLSITVISLLSLAVITMIPCLKKS
FYHKIMAYLMALAVGTLAGDAMLHLIPHAFAEGANSAANLVINDEQKLKQ
HYSQVYRASFVLLGIYIFFLVEHLMKLKVICKGNHGHSHGGGGHTAVPVN
DEERSSSPPASPGANDLDDDDDEKAIVQFDKEDEKVALKNNGAASPTLSC
QSNLHSNGDGGNNTVSEGGHYHSDDRHHHHHHGEKNVTKDTKITSLAWMV
IVGDGFHNFTDGLAVGVAYSASLSSGLSTTIAVFCHELPHELGDFAILIS
NGMSIKQAIIYNLVSAILAYLGLIAGILLGGSEMGRHFILSITAGLFLYV
SLADMLPELSHQEVPNASKFSAFVCQHLGILSGFAIMLFISLYEHAI
Run BLAST on NCBI

transcript from alignment at sc0000002:899013..909064+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000448 ID=TCONS_00000448|Name=TCONS_00000448|organism=Clytia hemisphaerica|type=transcript|length=10052bp|location=Sequence derived from alignment at sc0000002:899013..909064+ (Clytia hemisphaerica)
atgTGTTTCATTTCTTTTCTTATAGAATAATTTAATTGAattatgttttt tcttaaattggCAATTGGGATTTGTTGTGTGGTAGTTGTATTGAGCTCAG ACTGTTTAAAAACAGTGATAAACAGTAAAGGGACCAAATATTTTCTCgat gagatttttcaaaaatatgctaCCAACGATAAGATGACAATCACCGAATT TTCTacattcattaaaaaatttgatattgGTGAGATCAAGATAACATGTG ATAAAAACGACCCACACTGCATGGAGGAATCACACAATGTTCAaaggaga agaagaaatttGCCAGATGCTTATAATTCATCATCACACAAAAGTCATTG GAATGACCATGCTAGAAAGGTAtacttttctctcttttttcagCCTGTGT TTTAAATTAATAAGGGAATTAACATTTATTTCAGGAACTGATTTAGTTGT TTGCAATGATTCATATTCTCGTATACAATATGCAGAACCTTTTATGAGGC TATCAATATATGGGACAATTGCGGTTTAATAAAAAATAACGGTTTATGTA AATTCCTCCTTAATTTTCAGTTCTATTTTGTTTACTGATATTTTTCTCAT TCTGTCAGACAGGGAAATCATTTTGTGATATCTGGaatctttattttgac atgtcATTGAACTGAGCTTCCTCAAATTTATTATAAATTGGTTTAATCGT TTTATTAATCAATGTTTTATGAAACATTATTGAATTAGGTCAATTCAcag aacttttttcatattagTCCATTCAGTAACTCTCAATGTCACCGAAAAAA ATTCTGAATTATTAAACAACCTGAAATCTCTATAACTTTGTTGAATTATC TTTTgagcaaaaacaatttttaaatagttAATTATAATCAATCTTTACTT TTATAGNACAACCTGAAATCTCTATAACTTTGTTGAATTATCTTTTgagc aaaaacaatttttaaatagttAATTATAATCAATCTTTACTTTTATAGTC CCATTTCGTacgatttttttgcttccaagcTAATTTTCTTAACAGGTCTC TAAAACCCATTTAGACAAAATTGTTTGTTTAAAGAACTGAGTACCCTTTG GCATCTCTAAAGAGTACTTAAaaattaggaatttttttcaataacattGA GAACAGTAGTGACAGTTTTATAAGAGTCGCAAAATTCAGTCATCTCTTGG AGACAAGTTTTAAATCTTTCTCTCTCTATTATAAAAGTTGATATAATATC CTGAGAATATTCTATCAAGATCCTCGATTCTAcctatttcaaagttttca cgCCTAGACTATTTTGATGATAGAATTTTATCCACACGCTGACACTGATG GctcagtttgttttttttaatgtagcTTTTTTTATGAATCTTAACCAGTT GGTTTTCTTTTAATTCATAAATCCATATTAGTTCCGTTCTCTAACTGTCC CGACGGAAAGGCTCCGCTGTGTTTTATAAAACATAAAGACTTCTATAGAA TGAATATAGAACCGTTATAATTAAATATAGCTGAGAATCGGATACTCTAA ATGAGATTTCGCAATCATTAATCTTTAGTTATTATAAACCTGAGCTAGAA TTGTCTTCATAGAAAGGAATGCCACGCAGTCAATACAGATCTCTCTGAGG ATCATTTTGTTTTGGGGTGCAAAAAGACGGTCATATCTTTTTGCACACAT GCCGTTAAAAGGACCGTGAGAGAATTATAATTGCCTCGTCATTAACGTCA TTAAGATTAGAAGCACCTTAATTGAGTAATAGAATTGGCTTCTCTAGCTA GAATTTTGAATACGAGAATGCGTGGCTATAAACTTTTTATAAACTCTTAA GTGTTATTTACAAGATTAAAATTGCTGCAGCGTTTATGACCACGGCCTGA TACTGCAAGTcttaagtctttttttttttacaaaatgatCTGAGGTCTTT CATAATGTTGTCGCGTCTAAAAGGATTAGCATTAGAtttatcaaatcaaa attagaTCAGTATCGGTAAATTGATCAGTGTTTGACAGCTTTATTACAGA CAAGAATCAGCTTTTTTGCACTCCTCTCTAAGGTAGCCTCTTGCCATCAA ATTGTTACGTAAATGTCAAAAGCTATTTTGGCTTAACTTGATATCATTTC TGACATTACACAAACAGGAAAACAATTTCCTACGATTTTGGCATATAAGA TTAGGTGTCCAGAAAGGGGGTAATGTTTTTGCACATTGATGCTATATTCA ATTCAAACTATTATTAAAACTAATGTATTTTTGCAACCGTCCCTAAACGG AAAATAGCAAAACATTGTTCCTCAATGCATTATAAATCTTTTAATGAGCA TCTCCAAATTCCAATAAAACTCTGCAAATTTGATCAAGCACATACTagga ttatatatttttaattctGTAAAATGTAGCTTGTTTTCAGATCCCTTTGG AGCTACTAGACCTGTAGATTCAAACCATTATCGTCCGATTCCAGTGTTAA AAATGGTTGAAACAGTTGcgtctccgtaactcgaacacgcCTTGGGAACA CAATTCGTTCGAGAtaaggagatatttgagttaaagagactctaatGTAT AAAAATTCATCTTTAGCTGAACACACAACTGCgtacttatgaaaaaaaac taatcttctggatttaaaatttttctaactGAATTATGTAGGCAAGACTT GATAAATTCTGGCTTAAAGTTGTTTCAATCTTGCATAGATTTCAATCTGG ATTATATTTAGTCGCGTGCGTATAAAACCGCCATACTTAACTGATTTTAG ATATCAACCAACATgatcaaatttgatttgtcGCCTCCTTGAGGTCACGA ATGATTGTTGTGTCCAAAGAATAAGGTAGAACGTTGTTTCAATCAAGCTA AATccgtcaatttaaaaaaaaaggtcaACCAGATTTTGAAATAACTGACA GAAATACATCTGTAGGTGTTATCAAATAGTCACTAGTTTGGACGTTCCTT ATTATCTAGTGCACAAAGAACATAGGGTGCGAAACTTGACATATCTGAAA CACATTTACCAAGTATAATATGAgtaatttgacatttttttaattttgag aatAGCAAACTTTGGATTAATAGCATACTCTCGAGTttctaataaacgta cagtaaCGAAtaaagaggccccccagcggacccaaatttcacgcattcac gcaaaaaatttttcgcaattcacgcattcacgcaagtttttctcgaaatt cacgcaaacccaattttttgggaaatcggggagattttcggaaaaaatcg gggaaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNaaaaaaagtatgacaaggctgtact cgagatattattcgaccggatctggtcatgcacttgagaaaaacttaact cagtagtgattttttcctgtagacctgactataaaacaccgtgtttagta gcgtcataagaagcccccaaatagaaagcgttacgtaatttttcaacttt aatcacatgccatcacgcaaaatatttgattcttctaacttgtcacgatc gtttagaaaaggtgaagcttctgcagttaacgtatcgcgatagtcagtga aaagatatgcgccgcaggcgaatttttgtacaaaaaattgcttaaacatt atcaaaaataggtcaaacaaactcgagtatgacaccgtgatgcttagctc aggggtaaggaggtttacgcagagaggaaacttttgcatttctgtcactc gcgtttggctaaaaatgctctctttaacaccattgaaaaagaatgtagtc taaattcgttagatgcaaggtacgatcgcttgatagcttgtaaaatgagg taaaagaatgaacatttgttgcgagcgaagcgatcaaaaaaaattaaaaa gaaaggttttaatcagggctcNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaataagtttctttt tatttgcaaaaacgtggtgaagtcatggccgcctcctgcccccagtgact ctggccctggccctggccctggattactcatcatgcataaccatggtttt atcttaaacaaacactttcaagggcgcaaattagagttatttaagattcg agggccaatacatgtttggcctgagcgaaaaaatctggaaatttaaggtg tctagattgctagaaagcgcatctaaatcatgaatcgtcTTATAgaatag agaatttgaaagttgctgattATTTTGTAcaccttcacctggcatccctt gaatttggaataggtgcgcacctttgtgaaaaggaaaaattcacacGTTC ACtcaaaaaacagggcagattcacgcattcacgcaatagaaatatggatt ttcacgttcacgcaagttttttcaattcacgcattcacgcaatagaaata tggattttcacgttcacgcaagttttttcaattcacgcattcacgcaatt ttttttcgattttcacgcattcacgcaaccaaaaaagccaattcacgcat tcacgcaattttttttcgattttcacgcattcacgcaaccaaaaaagccc attcacgcattcacgcaaaccgctgggggggccccaATAAACATATACAG GGTTGAAAATAGAGGCGTAAACCTAATTGAAGGGTCTTTTCCGGTTCGGT TAGGGGGTAAATAATGGTTATTCTGCTTTCATTTGACGAATAGATAAAAC CTCCATATTCAAAAGTATTTAGCCTTAGAAACACAAGTAGGCTTTTGAAA TTGAGgaaaatatttgttgaaattaataaacgtacatgtagtttattagg cacccgagagtaccCATTTAAGAATACAGTGGaatctctttaattcgaac ctctacaatTTAAATAACTACTCAAATCGGACAGGATTCATGGTtctttc agttaacaatgcctactctataactcgaaatttccttaactcgaacaaat ctgTGTTCccatgcgtgttcgagttatgctGACTCGCAAATgcaatattt tgataaataatgTTGCCCGAATATAATTTTTACTCCCTAAAACAAaagta atttaaatttttctcgaATGTCATTGAGtcatttattttcacttttgaaa CTCATAGTGTTTGAAGCCACGTGAACTACTTCGTCGCAATGAAATCAATT CAACCAAAACATCCATTACACGTGAAGATTTCGTCAAAATTTGTCCTTCC ATACTTCAACAAATCGAAAGCAAGAAATGTTTGCACCTTCATCGGACAAC GAAAGTCGTTCTCGGACACGATGATGCTCCGGACAGAAAATCAGGTATTT CACGAAGGAAAGAGTATTTCTTTCAACCACTCACCTTATAAAAGTAAAAT GTTTACATGGGAGCATGAATAAAATCTTCTTCCATGTCATGAGTATTTCA CAACTAAAAATATGATcaccaaaatatcaaaatgtatattttatgtttta agaattttaattCATAAAAATGATAAACCTATATCTCAAAACTAAGGCGT TGTTTTGCACGTACttcaggcgtacaaacttttgcgaacagaaactttcg cgaatatTACCCGAAAGCTTTtgctcgcgaaaatttgttcACCTAAAGTA TTTGCTAATTGGTTTTGTACACTATCATATCTCTTCTTTAGTTTGGTTGT ACGGTATGTTGTCCATCACAGTTATCAGTTTACTTTCACTTGCTGTCATT ACCATGATCCCATGTTTAAAGAAGTCCTTTTACCATAAAATCATGGCTTA TCTTATGGCACTGGCTGTTGGAACTCTGGCTGGTGATGCCATGCTCCATT TGATCCCTCATGTGAGTGACGAAAACTCGTGCTTCTATCATATTTTCTCC TCTGCTCTAAATTCTATATTATTGTCtaattttcatcatggatactTTTC CTTACTACTTTTAGTTGAAAGGCTGAATCTTTCTAAATCGTTTTATAATA CCCCTTTTTCATTACACCGGTGAAATTTAAAGAAGATTTCTATTTTCAAT GCCCATTGGTGAAGTCGGGATCAAGCTTCCTTCCTTCCTGCACTAAAAAT GTCTTAATTTCATCGCTTTCAAATCGTAAGATATTTCAGCTACTTTTGAC TTGTCGGTGAATTAGATTAGGGCACTActatcactgacctttatatatcc ctggaccaagctatatctgccatctttgatagaagttttttttgaattgg tacccgtaaagaagccattgcagtggNGTGATAGAAgtcttttttgaatt ggtacccgtaaagaagccattgtagtggtAAAAATTAACGGCGTCTAACg gtgctacatcatcaaaagtttttgagataaagtagatctagcgctttCGA TGCAtctacaccgctattgagtagtgccgccattaggggcATATAAggcc gggattgagaagcttggtccagggtatataaaggtcagtgactaCTACAG AGGTTTTTACTATACGAATCGTATTTTTGCAGGCTTTTGCAGAAGGTGCG AACTCAGCAGCGAACTTGGTGATCAACGATGAGCAGAAATTGAAACAACA TTATTCGCAAGTCTATCGTGCTTCTTTCGTTCTTCTTGGTATCTATATCT TTTTCTTAGTGGAACACCTCATGAAACTCAAAGTCATTTGTAAGGTAAGA CCAGCCACTTTCCATTACCATTATAATGACCTTTATCGTGTGCTTACACG CTTTATTTTTATTAAGAGCAGCTACATAAGATCGTAACAGGGAAATTTTG CAAAAACCTAATTTAACCTAAGTTTAGCCTGAAGGGCTTGTCGAGCCTAA AAATCTCGATAAATTAAGAGTAGCTGAGGTTGGGACAAAATTGACTGGCT TTTATAAGGAGTGTGTTTTTTACAGTATGTCTAAAAGACAATTTTTATGG CGGTTAAAAGACTTTTCCATCTTTTCAACATTCAAGTCGAAGAACCAGGA ACTTTACTGAACTCTGTTATGAATTATATTGGCTTTCTTTTATCAGATgc catttttattatttcatttttgtcAGGGTAATCATGGCCACAGCCATGGT GGAGGAGGTCACACGGCAGTGCCAGTAAATGATGAAGAACGGTCGAGTAG TCCACCTGCCAGTCCTGGTGCTAATGATTTggatgacgatgatgatgaaa AAGCTATCGTTCAGTTTgataaagaagatgaaaaagttgctCTAAAGGTA TAATCTAGTAAAACTTCATACAAGAAGAACTTTATTTTGTACGAGATAAA AAATAGCCGTCATTTATTGCAATTTGACGTAACTCTACGTGACGACATAA GAAAATACTTTTCACTCTAGATAGTCTTTAGATTTTGAAATCTTcacttt tcaaatttgtaaaagcCCACTTTCAAAAGCAGTGTTAGACAAATAAGATC GAAATTGTTAATACATTATATCCTACCCTTTTCCAAGAACAATGGCGCAG CTTCACCCACATTGAGTTGTCAATCCAATTTACACTCAAACGGTGACGGG GGCAACAACACTGTATCAGAAGGAGGCCATTACCATAGCGACGATCGACA CCATCATCATCACCATGGTGAGAAAAACGTAACCAAGGATACCAAAATCA CCAGCCTCGCTTGGATGGTCATCGTTGGAGATggttttcataattttacg gatGGTCTAGCTGTGGGTGTGGCTTATTCTGCATCTCTCTCAAGTGGACT GAGCACGACCATTGCCGTTTTTTGTCATGAACTTCCACATGAATTGGGTA AGAGGTTTTTTTCTTAGGCTAGACTATATTATAGatataaatattatttt atgaatTCGCTCAACGGCTCAATGGTTGTTCGATCAGAATATTGTATTCT TAAGCTTTAGACGAGAATATTACTTCCACCAAAGCGACAGGTGTTGTCTA AAAGGTCTTGATGTTATAAAATAAGTAAATCATACAAGCCACTTTATAGC GTATGTAAACAAAGTCAGCTTTGTAAAACTGTAGGATGCCTGGGGCATTT TCACTTTCAATATTTCTTCAAAAACGGGCTTTTAGATTGTGTCACCCTTC CCAATAAATTCATAATACAGGCTCACCTGTCGAATTGATCGAGTTTGTTT GTATATCGGACATGTACGGAGAGACAAATTTCTCCGAGCTAAAGAGTCTA CATTATAAGGGTTCATCAACTGGATAGCTTCGATTCTAACAGGTTCAAGT TATCGAGACTCTGTTACTCTTATTCTTTCTCACCAGGTGATTTTGCCATT CTAATATCAAACGGGATGTCAATCAAACAAGCCATCATATACAACCTTGT GTCTGCCATATTGGCTTATCTTGGATTAATCGCTGGTATCCTGTTGGGAG GATCCGAAATGGGACGTCATTTTATTCTCTCCATAACGGCTGGTCTTTTT CTTTACGTCTCCTTAGCTGACATGGTAAgttttgaatatgttttaaataa agaaaagtgACCTTCATTACTCGTTCAACTTTTCCAATAGAACGAATCCT CTAGATTTGTGGGTTATCCTTCGATAAGATCTTTTAAATAGTCTTGTACA CTCTAAAGAACTGGCTATGCGTCTTATTGAGACCTCTTACAATGCAAAAT ACTCAATACGACTATCGCTGACCAACACCAACTGCTCTAGAGCAGCGAAT TAGATATCGCTTATTGATGATTGTAATTTGatgtttgaatttgttttatc TATAGTTACCAGAGCTGAGCCATCAAGAAGTACCAAATGCTTCAAAATTC TCAGCCTTCGTTTGCCAACATCTTGGCATTCTCAGTGGTTTTGCTATCAT GTTATTCATTTCATTATACGAACATGCTATATAATGAAGAAATCGCGAAA GCTAGATTCAAATTATCTTGAAAATCGGATTACCGGAATGAATCCGATAA CGATGAGATGGAAGATCGGCAGACTGATTTTCGGTTCGATTGAGAAGAGA TTCCCTTCTAATACATACATGATGCACTAGGGTCAAAGAATGTGCTTGAA CGAAAGATAATGGAAGAAGGAGGTGGATTTCAGCTTGAACTCTGATGACA TTATGACATTTGCtgctttttgaaaagtgaaactgattttggaatCTGAG CGAGTAAATCTTTAGTTTAAAGCCTGAAAGGCTaaagtagaatctctaac ccttagaagttcctttgtttttgaggactgcattttttggaATCTAGCGA Cagatccggcgtttgtgtaagagcaacgcgcgggcgttctggatgggaga taagtgacttcatttcccatccaggagtctcgagtctagcccttagGGCG TGGAAGTCAATGAgcgtacagttgactctcttaCTCGATCTTCAAGCCCT CTTCAAGGGACCGAGAATTTTTCTCGAATAATGGCAATATTCGGATTACG GAGAGCATTTAATACAAGCGAGGAAACCAATGCTTTggatcgaattacag aaagattcgagttAAGCGGGTTCGATAATTAGAGAGGGTTTGACTGTATA TCTTTTTTTTCGTTAAGAGTAGAACTTTTATTTATAGAAGCAGATAATCT TTTTTAAAGACAACagaatatttgttttgttttgttttacaaTATATAGA AAAGGGATATATCGAGATGGAGATATTTAACCTGCAGAAAAGAAACAATC CTATCGCGAAATGAAATTCACACGGAAATATCTATATACTCAAATTAATT NA

Coding sequence (CDS) from alignment at sc0000002:899013..909064+

>TCONS_00000448 ID=TCONS_00000448|Name=TCONS_00000448|organism=Clytia hemisphaerica|type=CDS|length=13152bp|location=Sequence derived from alignment at sc0000002:899013..909064+ (Clytia hemisphaerica)
atgttttttcttaaattggCAATTGGGATTTGTTGTGTGGTAGTTGTATT
GAGCTCAGACTGTTTAAAAACAGTGATAAACAGTAAAGGGACCAAATATT
TTCTCgatgagatttttcaaaaatatgctaCCAACGATAAGATGACAATC
ACCGAATTTTCTacattcattaaaaaatttgatattgGTGAGATCAAGAT
AACATGTGATAAAAACGACCCACACTGCATGGAGGAATCACACAATGTTC
AaaggagaagaagaaatttGCCAGATGCTTATAATTCATCATCACACAAA
AGTCATTGGAATGACCATGCTAGAAAGTGTTTGAAGCCACGTGAACTACT
TCGTCGCAATGAAATCAATTCAACCAAAACATCCATTACACGTGAAGATT
TCGTCAAAATTTGTCCTTCCATACTTCAACAAATCGAAAGCAAGAAATGT
TTGCACCTTCATCGGACAACGAAAGTCGTTCTCGGACACGATGATGCTCC
GGACAGAAAATCAGTTTGGTTGTACGGTATGTTGTCCATCACAGTTATCA
GTTTACTTTCACTTGCTGTCATTACCATGATCCCATGTTTAAAGAAGTCC
TTTTACCATAAAATCATGGCTTATCTTATGGCACTGGCTGTTGGAACTCT
GGCTGGTGATGCCATGCTCCATTTGATCCCTCATGCTTTTGCAGAAGGTG
CGAACTCAGCAGCGAACTTGGTGATCAACGATGAGCAGAAATTGAAACAA
CATTATTCGCAAGTCTATCGTGCTTCTTTCGTTCTTCTTGGTATCTATAT
CTTTTTCTTAGTGGAACACCTCATGAAACTCAAAGTCATTTGTAAGGGTA
ATCATGGCCACAGCCATGGTGGAGGAGGTCACACGGCAGTGCCAGTAAAT
GATGAAGAACGGTCGAGTAGTCCACCTGCCAGTCCTGGTGCTAATGATTT
ggatgacgatgatgatgaaaAAGCTATCGTTCAGTTTgataaagaagatg
aaaaagttgctCTAAAGAACAATGGCGCAGCTTCACCCACATTGAGTTGT
CAATCCAATTTACACTCAAACGGTGACGGGGGCAACAACACTGTATCAGA
AGGAGGCCATTACCATAGCGACGATCGACACCATCATCATCACCATGGTG
AGAAAAACGTAACCAAGGATACCAAAATCACCAGCCTCGCTTGGATGGTC
ATCGTTGGAGATggttttcataattttacggatGGTCTAGCTGTGGGTGT
GGCTTATTCTGCATCTCTCTCAAGTGGACTGAGCACGACCATTGCCGTTT
TTTGTCATGAACTTCCACATGAATTGGGTGATTTTGCCATTCTAATATCA
AACGGGATGTCAATCAAACAAGCCATCATATACAACCTTGTGTCTGCCAT
ATTGGCTTATCTTGGATTAATCGCTGGTATCCTGTTGGGAGGATCCGAAA
TGGGACGTCATTTTATTCTCTCCATAACGGCTGGTCTTTTTCTTTACGTC
TCCTTAGCTGACATGTTACCAGAGCTGAGCCATCAAGAAGTACCAAATGC
TTCAAAATTCTCAGCCTTCGTTTGCCAACATCTTGGCATTCTCAGTGGTT
TTGCTATCATGTTATTCATTTCATTATACGAACATGCTATATAAatgttt
tttcttaaattggCAATTGGGATTTGTTGTGTGGTAGTTGTATTGAGCTC
AGACTGTTTAAAAACAGTGATAAACAGTAAAGGGACCAAATATTTTCTCg
atgagatttttcaaaaatatgctaCCAACGATAAGATGACAATCACCGAA
TTTTCTacattcattaaaaaatttgatattgGTGAGATCAAGATAACATG
TGATAAAAACGACCCACACTGCATGGAGGAATCACACAATGTTCAaagga
gaagaagaaatttGCCAGATGCTTATAATTCATCATCACACAAAAGTCAT
TGGAATGACCATGCTAGAAAGTGTTTGAAGCCACGTGAACTACTTCGTCG
CAATGAAATCAATTCAACCAAAACATCCATTACACGTGAAGATTTCGTCA
AAATTTGTCCTTCCATACTTCAACAAATCGAAAGCAAGAAATGTTTGCAC
CTTCATCGGACAACGAAAGTCGTTCTCGGACACGATGATGCTCCGGACAG
AAAATCAGTTTGGTTGTACGGTATGTTGTCCATCACAGTTATCAGTTTAC
TTTCACTTGCTGTCATTACCATGATCCCATGTTTAAAGAAGTCCTTTTAC
CATAAAATCATGGCTTATCTTATGGCACTGGCTGTTGGAACTCTGGCTGG
TGATGCCATGCTCCATTTGATCCCTCATGCTTTTGCAGAAGGTGCGAACT
CAGCAGCGAACTTGGTGATCAACGATGAGCAGAAATTGAAACAACATTAT
TCGCAAGTCTATCGTGCTTCTTTCGTTCTTCTTGGTATCTATATCTTTTT
CTTAGTGGAACACCTCATGAAACTCAAAGTCATTTGTAAGGGTAATCATG
GCCACAGCCATGGTGGAGGAGGTCACACGGCAGTGCCAGTAAATGATGAA
GAACGGTCGAGTAGTCCACCTGCCAGTCCTGGTGCTAATGATTTggatga
cgatgatgatgaaaAAGCTATCGTTCAGTTTgataaagaagatgaaaaag
ttgctCTAAAGAACAATGGCGCAGCTTCACCCACATTGAGTTGTCAATCC
AATTTACACTCAAACGGTGACGGGGGCAACAACACTGTATCAGAAGGAGG
CCATTACCATAGCGACGATCGACACCATCATCATCACCATGGTGAGAAAA
ACGTAACCAAGGATACCAAAATCACCAGCCTCGCTTGGATGGTCATCGTT
GGAGATggttttcataattttacggatGGTCTAGCTGTGGGTGTGGCTTA
TTCTGCATCTCTCTCAAGTGGACTGAGCACGACCATTGCCGTTTTTTGTC
ATGAACTTCCACATGAATTGGGTGATTTTGCCATTCTAATATCAAACGGG
ATGTCAATCAAACAAGCCATCATATACAACCTTGTGTCTGCCATATTGGC
TTATCTTGGATTAATCGCTGGTATCCTGTTGGGAGGATCCGAAATGGGAC
GTCATTTTATTCTCTCCATAACGGCTGGTCTTTTTCTTTACGTCTCCTTA
GCTGACATGTTACCAGAGCTGAGCCATCAAGAAGTACCAAATGCTTCAAA
ATTCTCAGCCTTCGTTTGCCAACATCTTGGCATTCTCAGTGGTTTTGCTA
TCATGTTATTCATTTCATTATACGAACATGCTATATAAatgttttttctt
aaattggCAATTGGGATTTGTTGTGTGGTAGTTGTATTGAGCTCAGACTG
TTTAAAAACAGTGATAAACAGTAAAGGGACCAAATATTTTCTCgatgaga
tttttcaaaaatatgctaCCAACGATAAGATGACAATCACCGAATTTTCT
acattcattaaaaaatttgatattgGTGAGATCAAGATAACATGTGATAA
AAACGACCCACACTGCATGGAGGAATCACACAATGTTCAaaggagaagaa
gaaatttGCCAGATGCTTATAATTCATCATCACACAAAAGTCATTGGAAT
GACCATGCTAGAAAGTGTTTGAAGCCACGTGAACTACTTCGTCGCAATGA
AATCAATTCAACCAAAACATCCATTACACGTGAAGATTTCGTCAAAATTT
GTCCTTCCATACTTCAACAAATCGAAAGCAAGAAATGTTTGCACCTTCAT
CGGACAACGAAAGTCGTTCTCGGACACGATGATGCTCCGGACAGAAAATC
AGTTTGGTTGTACGGTATGTTGTCCATCACAGTTATCAGTTTACTTTCAC
TTGCTGTCATTACCATGATCCCATGTTTAAAGAAGTCCTTTTACCATAAA
ATCATGGCTTATCTTATGGCACTGGCTGTTGGAACTCTGGCTGGTGATGC
CATGCTCCATTTGATCCCTCATGCTTTTGCAGAAGGTGCGAACTCAGCAG
CGAACTTGGTGATCAACGATGAGCAGAAATTGAAACAACATTATTCGCAA
GTCTATCGTGCTTCTTTCGTTCTTCTTGGTATCTATATCTTTTTCTTAGT
GGAACACCTCATGAAACTCAAAGTCATTTGTAAGGGTAATCATGGCCACA
GCCATGGTGGAGGAGGTCACACGGCAGTGCCAGTAAATGATGAAGAACGG
TCGAGTAGTCCACCTGCCAGTCCTGGTGCTAATGATTTggatgacgatga
tgatgaaaAAGCTATCGTTCAGTTTgataaagaagatgaaaaagttgctC
TAAAGAACAATGGCGCAGCTTCACCCACATTGAGTTGTCAATCCAATTTA
CACTCAAACGGTGACGGGGGCAACAACACTGTATCAGAAGGAGGCCATTA
CCATAGCGACGATCGACACCATCATCATCACCATGGTGAGAAAAACGTAA
CCAAGGATACCAAAATCACCAGCCTCGCTTGGATGGTCATCGTTGGAGAT
ggttttcataattttacggatGGTCTAGCTGTGGGTGTGGCTTATTCTGC
ATCTCTCTCAAGTGGACTGAGCACGACCATTGCCGTTTTTTGTCATGAAC
TTCCACATGAATTGGGTGATTTTGCCATTCTAATATCAAACGGGATGTCA
ATCAAACAAGCCATCATATACAACCTTGTGTCTGCCATATTGGCTTATCT
TGGATTAATCGCTGGTATCCTGTTGGGAGGATCCGAAATGGGACGTCATT
TTATTCTCTCCATAACGGCTGGTCTTTTTCTTTACGTCTCCTTAGCTGAC
ATGTTACCAGAGCTGAGCCATCAAGAAGTACCAAATGCTTCAAAATTCTC
AGCCTTCGTTTGCCAACATCTTGGCATTCTCAGTGGTTTTGCTATCATGT
TATTCATTTCATTATACGAACATGCTATATAAatgttttttcttaaattg
gCAATTGGGATTTGTTGTGTGGTAGTTGTATTGAGCTCAGACTGTTTAAA
AACAGTGATAAACAGTAAAGGGACCAAATATTTTCTCgatgagatttttc
aaaaatatgctaCCAACGATAAGATGACAATCACCGAATTTTCTacattc
attaaaaaatttgatattgGTGAGATCAAGATAACATGTGATAAAAACGA
CCCACACTGCATGGAGGAATCACACAATGTTCAaaggagaagaagaaatt
tGCCAGATGCTTATAATTCATCATCACACAAAAGTCATTGGAATGACCAT
GCTAGAAAGTGTTTGAAGCCACGTGAACTACTTCGTCGCAATGAAATCAA
TTCAACCAAAACATCCATTACACGTGAAGATTTCGTCAAAATTTGTCCTT
CCATACTTCAACAAATCGAAAGCAAGAAATGTTTGCACCTTCATCGGACA
ACGAAAGTCGTTCTCGGACACGATGATGCTCCGGACAGAAAATCAGTTTG
GTTGTACGGTATGTTGTCCATCACAGTTATCAGTTTACTTTCACTTGCTG
TCATTACCATGATCCCATGTTTAAAGAAGTCCTTTTACCATAAAATCATG
GCTTATCTTATGGCACTGGCTGTTGGAACTCTGGCTGGTGATGCCATGCT
CCATTTGATCCCTCATGCTTTTGCAGAAGGTGCGAACTCAGCAGCGAACT
TGGTGATCAACGATGAGCAGAAATTGAAACAACATTATTCGCAAGTCTAT
CGTGCTTCTTTCGTTCTTCTTGGTATCTATATCTTTTTCTTAGTGGAACA
CCTCATGAAACTCAAAGTCATTTGTAAGGGTAATCATGGCCACAGCCATG
GTGGAGGAGGTCACACGGCAGTGCCAGTAAATGATGAAGAACGGTCGAGT
AGTCCACCTGCCAGTCCTGGTGCTAATGATTTggatgacgatgatgatga
aaAAGCTATCGTTCAGTTTgataaagaagatgaaaaagttgctCTAAAGA
ACAATGGCGCAGCTTCACCCACATTGAGTTGTCAATCCAATTTACACTCA
AACGGTGACGGGGGCAACAACACTGTATCAGAAGGAGGCCATTACCATAG
CGACGATCGACACCATCATCATCACCATGGTGAGAAAAACGTAACCAAGG
ATACCAAAATCACCAGCCTCGCTTGGATGGTCATCGTTGGAGATggtttt
cataattttacggatGGTCTAGCTGTGGGTGTGGCTTATTCTGCATCTCT
CTCAAGTGGACTGAGCACGACCATTGCCGTTTTTTGTCATGAACTTCCAC
ATGAATTGGGTGATTTTGCCATTCTAATATCAAACGGGATGTCAATCAAA
CAAGCCATCATATACAACCTTGTGTCTGCCATATTGGCTTATCTTGGATT
AATCGCTGGTATCCTGTTGGGAGGATCCGAAATGGGACGTCATTTTATTC
TCTCCATAACGGCTGGTCTTTTTCTTTACGTCTCCTTAGCTGACATGTTA
CCAGAGCTGAGCCATCAAGAAGTACCAAATGCTTCAAAATTCTCAGCCTT
CGTTTGCCAACATCTTGGCATTCTCAGTGGTTTTGCTATCATGTTATTCA
TTTCATTATACGAACATGCTATATAAatgttttttcttaaattggCAATT
GGGATTTGTTGTGTGGTAGTTGTATTGAGCTCAGACTGTTTAAAAACAGT
GATAAACAGTAAAGGGACCAAATATTTTCTCgatgagatttttcaaaaat
atgctaCCAACGATAAGATGACAATCACCGAATTTTCTacattcattaaa
aaatttgatattgGTGAGATCAAGATAACATGTGATAAAAACGACCCACA
CTGCATGGAGGAATCACACAATGTTCAaaggagaagaagaaatttGCCAG
ATGCTTATAATTCATCATCACACAAAAGTCATTGGAATGACCATGCTAGA
AAGTGTTTGAAGCCACGTGAACTACTTCGTCGCAATGAAATCAATTCAAC
CAAAACATCCATTACACGTGAAGATTTCGTCAAAATTTGTCCTTCCATAC
TTCAACAAATCGAAAGCAAGAAATGTTTGCACCTTCATCGGACAACGAAA
GTCGTTCTCGGACACGATGATGCTCCGGACAGAAAATCAGTTTGGTTGTA
CGGTATGTTGTCCATCACAGTTATCAGTTTACTTTCACTTGCTGTCATTA
CCATGATCCCATGTTTAAAGAAGTCCTTTTACCATAAAATCATGGCTTAT
CTTATGGCACTGGCTGTTGGAACTCTGGCTGGTGATGCCATGCTCCATTT
GATCCCTCATGCTTTTGCAGAAGGTGCGAACTCAGCAGCGAACTTGGTGA
TCAACGATGAGCAGAAATTGAAACAACATTATTCGCAAGTCTATCGTGCT
TCTTTCGTTCTTCTTGGTATCTATATCTTTTTCTTAGTGGAACACCTCAT
GAAACTCAAAGTCATTTGTAAGGGTAATCATGGCCACAGCCATGGTGGAG
GAGGTCACACGGCAGTGCCAGTAAATGATGAAGAACGGTCGAGTAGTCCA
CCTGCCAGTCCTGGTGCTAATGATTTggatgacgatgatgatgaaaAAGC
TATCGTTCAGTTTgataaagaagatgaaaaagttgctCTAAAGAACAATG
GCGCAGCTTCACCCACATTGAGTTGTCAATCCAATTTACACTCAAACGGT
GACGGGGGCAACAACACTGTATCAGAAGGAGGCCATTACCATAGCGACGA
TCGACACCATCATCATCACCATGGTGAGAAAAACGTAACCAAGGATACCA
AAATCACCAGCCTCGCTTGGATGGTCATCGTTGGAGATggttttcataat
tttacggatGGTCTAGCTGTGGGTGTGGCTTATTCTGCATCTCTCTCAAG
TGGACTGAGCACGACCATTGCCGTTTTTTGTCATGAACTTCCACATGAAT
TGGGTGATTTTGCCATTCTAATATCAAACGGGATGTCAATCAAACAAGCC
ATCATATACAACCTTGTGTCTGCCATATTGGCTTATCTTGGATTAATCGC
TGGTATCCTGTTGGGAGGATCCGAAATGGGACGTCATTTTATTCTCTCCA
TAACGGCTGGTCTTTTTCTTTACGTCTCCTTAGCTGACATGTTACCAGAG
CTGAGCCATCAAGAAGTACCAAATGCTTCAAAATTCTCAGCCTTCGTTTG
CCAACATCTTGGCATTCTCAGTGGTTTTGCTATCATGTTATTCATTTCAT
TATACGAACATGCTATATAAatgttttttcttaaattggCAATTGGGATT
TGTTGTGTGGTAGTTGTATTGAGCTCAGACTGTTTAAAAACAGTGATAAA
CAGTAAAGGGACCAAATATTTTCTCgatgagatttttcaaaaatatgcta
CCAACGATAAGATGACAATCACCGAATTTTCTacattcattaaaaaattt
gatattgGTGAGATCAAGATAACATGTGATAAAAACGACCCACACTGCAT
GGAGGAATCACACAATGTTCAaaggagaagaagaaatttGCCAGATGCTT
ATAATTCATCATCACACAAAAGTCATTGGAATGACCATGCTAGAAAGTGT
TTGAAGCCACGTGAACTACTTCGTCGCAATGAAATCAATTCAACCAAAAC
ATCCATTACACGTGAAGATTTCGTCAAAATTTGTCCTTCCATACTTCAAC
AAATCGAAAGCAAGAAATGTTTGCACCTTCATCGGACAACGAAAGTCGTT
CTCGGACACGATGATGCTCCGGACAGAAAATCAGTTTGGTTGTACGGTAT
GTTGTCCATCACAGTTATCAGTTTACTTTCACTTGCTGTCATTACCATGA
TCCCATGTTTAAAGAAGTCCTTTTACCATAAAATCATGGCTTATCTTATG
GCACTGGCTGTTGGAACTCTGGCTGGTGATGCCATGCTCCATTTGATCCC
TCATGCTTTTGCAGAAGGTGCGAACTCAGCAGCGAACTTGGTGATCAACG
ATGAGCAGAAATTGAAACAACATTATTCGCAAGTCTATCGTGCTTCTTTC
GTTCTTCTTGGTATCTATATCTTTTTCTTAGTGGAACACCTCATGAAACT
CAAAGTCATTTGTAAGGGTAATCATGGCCACAGCCATGGTGGAGGAGGTC
ACACGGCAGTGCCAGTAAATGATGAAGAACGGTCGAGTAGTCCACCTGCC
AGTCCTGGTGCTAATGATTTggatgacgatgatgatgaaaAAGCTATCGT
TCAGTTTgataaagaagatgaaaaagttgctCTAAAGAACAATGGCGCAG
CTTCACCCACATTGAGTTGTCAATCCAATTTACACTCAAACGGTGACGGG
GGCAACAACACTGTATCAGAAGGAGGCCATTACCATAGCGACGATCGACA
CCATCATCATCACCATGGTGAGAAAAACGTAACCAAGGATACCAAAATCA
CCAGCCTCGCTTGGATGGTCATCGTTGGAGATggttttcataattttacg
gatGGTCTAGCTGTGGGTGTGGCTTATTCTGCATCTCTCTCAAGTGGACT
GAGCACGACCATTGCCGTTTTTTGTCATGAACTTCCACATGAATTGGGTG
ATTTTGCCATTCTAATATCAAACGGGATGTCAATCAAACAAGCCATCATA
TACAACCTTGTGTCTGCCATATTGGCTTATCTTGGATTAATCGCTGGTAT
CCTGTTGGGAGGATCCGAAATGGGACGTCATTTTATTCTCTCCATAACGG
CTGGTCTTTTTCTTTACGTCTCCTTAGCTGACATGTTACCAGAGCTGAGC
CATCAAGAAGTACCAAATGCTTCAAAATTCTCAGCCTTCGTTTGCCAACA
TCTTGGCATTCTCAGTGGTTTTGCTATCATGTTATTCATTTCATTATACG
AACATGCTATATAAatgttttttcttaaattggCAATTGGGATTTGTTGT
GTGGTAGTTGTATTGAGCTCAGACTGTTTAAAAACAGTGATAAACAGTAA
AGGGACCAAATATTTTCTCgatgagatttttcaaaaatatgctaCCAACG
ATAAGATGACAATCACCGAATTTTCTacattcattaaaaaatttgatatt
gGTGAGATCAAGATAACATGTGATAAAAACGACCCACACTGCATGGAGGA
ATCACACAATGTTCAaaggagaagaagaaatttGCCAGATGCTTATAATT
CATCATCACACAAAAGTCATTGGAATGACCATGCTAGAAAGTGTTTGAAG
CCACGTGAACTACTTCGTCGCAATGAAATCAATTCAACCAAAACATCCAT
TACACGTGAAGATTTCGTCAAAATTTGTCCTTCCATACTTCAACAAATCG
AAAGCAAGAAATGTTTGCACCTTCATCGGACAACGAAAGTCGTTCTCGGA
CACGATGATGCTCCGGACAGAAAATCAGTTTGGTTGTACGGTATGTTGTC
CATCACAGTTATCAGTTTACTTTCACTTGCTGTCATTACCATGATCCCAT
GTTTAAAGAAGTCCTTTTACCATAAAATCATGGCTTATCTTATGGCACTG
GCTGTTGGAACTCTGGCTGGTGATGCCATGCTCCATTTGATCCCTCATGC
TTTTGCAGAAGGTGCGAACTCAGCAGCGAACTTGGTGATCAACGATGAGC
AGAAATTGAAACAACATTATTCGCAAGTCTATCGTGCTTCTTTCGTTCTT
CTTGGTATCTATATCTTTTTCTTAGTGGAACACCTCATGAAACTCAAAGT
CATTTGTAAGGGTAATCATGGCCACAGCCATGGTGGAGGAGGTCACACGG
CAGTGCCAGTAAATGATGAAGAACGGTCGAGTAGTCCACCTGCCAGTCCT
GGTGCTAATGATTTggatgacgatgatgatgaaaAAGCTATCGTTCAGTT
TgataaagaagatgaaaaagttgctCTAAAGAACAATGGCGCAGCTTCAC
CCACATTGAGTTGTCAATCCAATTTACACTCAAACGGTGACGGGGGCAAC
AACACTGTATCAGAAGGAGGCCATTACCATAGCGACGATCGACACCATCA
TCATCACCATGGTGAGAAAAACGTAACCAAGGATACCAAAATCACCAGCC
TCGCTTGGATGGTCATCGTTGGAGATggttttcataattttacggatGGT
CTAGCTGTGGGTGTGGCTTATTCTGCATCTCTCTCAAGTGGACTGAGCAC
GACCATTGCCGTTTTTTGTCATGAACTTCCACATGAATTGGGTGATTTTG
CCATTCTAATATCAAACGGGATGTCAATCAAACAAGCCATCATATACAAC
CTTGTGTCTGCCATATTGGCTTATCTTGGATTAATCGCTGGTATCCTGTT
GGGAGGATCCGAAATGGGACGTCATTTTATTCTCTCCATAACGGCTGGTC
TTTTTCTTTACGTCTCCTTAGCTGACATGTTACCAGAGCTGAGCCATCAA
GAAGTACCAAATGCTTCAAAATTCTCAGCCTTCGTTTGCCAACATCTTGG
CATTCTCAGTGGTTTTGCTATCATGTTATTCATTTCATTATACGAACATG
CTATATAAatgttttttcttaaattggCAATTGGGATTTGTTGTGTGGTA
GTTGTATTGAGCTCAGACTGTTTAAAAACAGTGATAAACAGTAAAGGGAC
CAAATATTTTCTCgatgagatttttcaaaaatatgctaCCAACGATAAGA
TGACAATCACCGAATTTTCTacattcattaaaaaatttgatattgGTGAG
ATCAAGATAACATGTGATAAAAACGACCCACACTGCATGGAGGAATCACA
CAATGTTCAaaggagaagaagaaatttGCCAGATGCTTATAATTCATCAT
CACACAAAAGTCATTGGAATGACCATGCTAGAAAGTGTTTGAAGCCACGT
GAACTACTTCGTCGCAATGAAATCAATTCAACCAAAACATCCATTACACG
TGAAGATTTCGTCAAAATTTGTCCTTCCATACTTCAACAAATCGAAAGCA
AGAAATGTTTGCACCTTCATCGGACAACGAAAGTCGTTCTCGGACACGAT
GATGCTCCGGACAGAAAATCAGTTTGGTTGTACGGTATGTTGTCCATCAC
AGTTATCAGTTTACTTTCACTTGCTGTCATTACCATGATCCCATGTTTAA
AGAAGTCCTTTTACCATAAAATCATGGCTTATCTTATGGCACTGGCTGTT
GGAACTCTGGCTGGTGATGCCATGCTCCATTTGATCCCTCATGCTTTTGC
AGAAGGTGCGAACTCAGCAGCGAACTTGGTGATCAACGATGAGCAGAAAT
TGAAACAACATTATTCGCAAGTCTATCGTGCTTCTTTCGTTCTTCTTGGT
ATCTATATCTTTTTCTTAGTGGAACACCTCATGAAACTCAAAGTCATTTG
TAAGGGTAATCATGGCCACAGCCATGGTGGAGGAGGTCACACGGCAGTGC
CAGTAAATGATGAAGAACGGTCGAGTAGTCCACCTGCCAGTCCTGGTGCT
AATGATTTggatgacgatgatgatgaaaAAGCTATCGTTCAGTTTgataa
agaagatgaaaaagttgctCTAAAGAACAATGGCGCAGCTTCACCCACAT
TGAGTTGTCAATCCAATTTACACTCAAACGGTGACGGGGGCAACAACACT
GTATCAGAAGGAGGCCATTACCATAGCGACGATCGACACCATCATCATCA
CCATGGTGAGAAAAACGTAACCAAGGATACCAAAATCACCAGCCTCGCTT
GGATGGTCATCGTTGGAGATggttttcataattttacggatGGTCTAGCT
GTGGGTGTGGCTTATTCTGCATCTCTCTCAAGTGGACTGAGCACGACCAT
TGCCGTTTTTTGTCATGAACTTCCACATGAATTGGGTGATTTTGCCATTC
TAATATCAAACGGGATGTCAATCAAACAAGCCATCATATACAACCTTGTG
TCTGCCATATTGGCTTATCTTGGATTAATCGCTGGTATCCTGTTGGGAGG
ATCCGAAATGGGACGTCATTTTATTCTCTCCATAACGGCTGGTCTTTTTC
TTTACGTCTCCTTAGCTGACATGTTACCAGAGCTGAGCCATCAAGAAGTA
CCAAATGCTTCAAAATTCTCAGCCTTCGTTTGCCAACATCTTGGCATTCT
CAGTGGTTTTGCTATCATGTTATTCATTTCATTATACGAACATGCTATAT
AA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000285XLOC_000285Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000448-exon-sc0000002-1491911889:899013..899381TCONS_00000448-exon-sc0000002-1491911889:899013..899381Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1510915933:899013..899381TCONS_00000448-exon-sc0000002-1510915933:899013..899381Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1575043694:899013..899381TCONS_00000448-exon-sc0000002-1575043694:899013..899381Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1491911889:904470..904656TCONS_00000448-exon-sc0000002-1491911889:904470..904656Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1510915933:904470..904656TCONS_00000448-exon-sc0000002-1510915933:904470..904656Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1575043694:904470..904656TCONS_00000448-exon-sc0000002-1575043694:904470..904656Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1491911889:905004..905173TCONS_00000448-exon-sc0000002-1491911889:905004..905173Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1510915933:905004..905173TCONS_00000448-exon-sc0000002-1510915933:905004..905173Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1575043694:905004..905173TCONS_00000448-exon-sc0000002-1575043694:905004..905173Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1491911889:905845..906006TCONS_00000448-exon-sc0000002-1491911889:905845..906006Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1510915933:905845..906006TCONS_00000448-exon-sc0000002-1510915933:905845..906006Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1575043694:905845..906006TCONS_00000448-exon-sc0000002-1575043694:905845..906006Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1491911889:906389..906559TCONS_00000448-exon-sc0000002-1491911889:906389..906559Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1510915933:906389..906559TCONS_00000448-exon-sc0000002-1510915933:906389..906559Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1575043694:906389..906559TCONS_00000448-exon-sc0000002-1575043694:906389..906559Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1491911889:906800..907109TCONS_00000448-exon-sc0000002-1491911889:906800..907109Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1510915933:906800..907109TCONS_00000448-exon-sc0000002-1510915933:906800..907109Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1575043694:906800..907109TCONS_00000448-exon-sc0000002-1575043694:906800..907109Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1491911889:907599..907786TCONS_00000448-exon-sc0000002-1491911889:907599..907786Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1510915933:907599..907786TCONS_00000448-exon-sc0000002-1510915933:907599..907786Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1575043694:907599..907786TCONS_00000448-exon-sc0000002-1575043694:907599..907786Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1491911889:908068..909064TCONS_00000448-exon-sc0000002-1491911889:908068..909064Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1510915933:908068..909064TCONS_00000448-exon-sc0000002-1510915933:908068..909064Clytia hemisphaericaexon
TCONS_00000448-exon-sc0000002-1575043694:908068..909064TCONS_00000448-exon-sc0000002-1575043694:908068..909064Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000448-proteinTCONS_00000448-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:899013..909064 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
4.79893 4.11894 3.18734 3.20732 8.12169 6.21192 10.093 10.205 13.2019 10.3232 11.6474 14.5019 19.9058 17.8789 19.6484 17.8265 29.0555 24.8956 22.6683 28.4569 31.8876 31.3663 20.6341 27.4931 23.7804 24.2533 12.7766 9.24379 11.8256 11.3034
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003689ZIP
Vocabulary: Biological Process
TermDefinition
GO:0030001metal ion transport
GO:0055085transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Molecular Function
TermDefinition
GO:0046873metal ion transmembrane transporter activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0030001 metal ion transport
biological_process GO:0055085 transmembrane transport
cellular_component GO:0016020 membrane
molecular_function GO:0046873 metal ion transmembrane transporter activity
Blast
BLAST of TCONS_00000448 vs. Swiss-Prot (Human)
Match: S39AA (Zinc transporter ZIP10 OS=Homo sapiens GN=SLC39A10 PE=1 SV=2)

HSP 1 Score: 243.432 bits (620), Expect = 6.492e-68
Identity = 175/526 (33.27%), Postives = 280/526 (53.23%), Query Frame = 1
Query:  298 RRRNLPDAYNSS--SHKSHWN--DHARKCLKPRELLRRNEINSTKTSITREDFVKICPSILQQIESKKCL-HLHR-------TTKVVLGHDDAPDRKSVWLYGMLSITVISLLSLAVITMIPCLKKSFYHKIMAYLMALAVGTLAGDAMLHLIPHAFAEGANS--------AANLVINDEQKLKQHYSQVYRASFVLLGIYIFFLVEHLMKL-----KVICKXXXXXXXXXXXXTAVPVNDEERSSSPPASPGANXXXXXXXEKAIVQFDK-----------------------EDEKVALKNNGAASPTLSCQSNLHS---NGDGGNNTVSEGGXXXXXXXXXXXXXGEKNVTKDTK---ITSLAWMVIVGDGFHNFTDGLAVGVAYSASLSSGLSTTIAVFCHELPHELGDFAILISNGMSIKQAIIYNLVSXXXXXXXXXXXXXXXXSEMGRH------FILSITAGLFLYVSLADMLPELSHQEVPNAS----KFSAFVCQHLGILSGFAIMLFISLYEHAI 1683
            R+R  P   N++  S +   N  DH  +CL   +LL+    +   + I+ + F  +CP++L QI+S+ C+ H  +         K ++  D+A    S W+ G++SITVISLLSL  + ++P + +  +  ++ +L+ALAVGT++GDA+LHL+PH  ++G +           +   ++  K  + Y  V +    L GIY+ F++EH +++     +   K            T      + + ++ P S           + ++V  D+                       E+EK+   ++     T+  + +LH+   N  G N TV    ++    +H HH HG  +   D K   I ++AWMVI+GDG HNF+DGLA+G A+SA L+ G+ST+IAVFCHELPHELGDFA+L+  GM++KQAI+YNL+S       +    +L G+ +G++      +I ++TAG+FLYV+L DMLPE+ H +  N          F+ Q+LG+L GFAIML I+LYE  I
Sbjct:  309 RKREAPHVKNNAIISLRKDLNEDDHHHECLNVTQLLKYYG-HGANSPISTDLFTYLCPALLYQIDSRLCIEHFDKLLVEDINKDKNLVPEDEANIGASAWICGIISITVISLLSLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLPH--SQGGHDHSHQHAHGHGHSHGHESNKFLEEYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGLHTIH-EHDLHAAAHNHHGENKTVLRKHNHQWHHKHSHHSHGPCHSGSDLKETGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGISTSIAVFCHELPHELGDFAVLLKAGMTVKQAIVYNLLS-----AMMAYIGMLIGTAVGQYANNITLWIFAVTAGMFLYVALVDMLPEMLHGDGDNEEHGFCPVGQFILQNLGLLFGFAIMLVIALYEDKI 825          
The following BLAST results are available for this feature:
BLAST of TCONS_00000448 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
S39AA6.492e-6833.27Zinc transporter ZIP10 OS=Homo sapiens GN=SLC39A10... [more]
back to top