Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000447 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000447
Unique NameTCONS_00000447
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2822

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000447 ID=TCONS_00000447|Name=TCONS_00000447|organism=Clytia hemisphaerica|type=transcript|length=2822bp
CAGATTCTCGGAAAAAAGCTTTTTGGGCAGAATTGGGTTGATCCAGGtaa
aggtacattcacttgccaagtgaatcataAGCACCGAGTGAGAATCGATC
CCTGACCTCCCAGACGGGAATCAAGGTTGATAACCGCTACACTACTATGT
CTACCTCCTAAAGCTTGGTAGCTTTTTCCAGTTTCTTGagaattcttttt
tagaaaGTAAAAAATTAGAATGGGACCTGCGGTGCCCATTGAACAAGTTC
AAACAGAAACTTCAGAAGATGGAAAGATCTATGAGAGATCACAACAAGAT
GGTGAAATGTATTCTAAACCTACGGTTGGTATTATTTATCCACCGCCTGA
AGTCAGAAATATTGTTGACAGGACTGCAAACTTTGTAGCTAGAAATGGTC
CTGAATTTGAGGAAAGGATCCGTGGAAATGAAGCTGATAATCCAAAGTTC
AATTTCTTGAACCCTAATGACCCTTACCATGCATATTATGCTCACAAGTT
AAAAGAATACAGAGAAACTGATATTGCAGATCTGCCGTCACTAAACGAAA
AGGAACCACAAAAAGCACCTCAAACTCAAACAAAGAAACAAGCTCCACAA
GTTATAGAAACGATCATTCCAAAAGATCCGCCACCAGCGTATGAATTCAC
GGCAGATCCACCCACCATTTCTGCTCTTGATTTGGACATTGTCAAACTAA
CTGCTCAGTTCGTTGCGAAAAATGGAAAAGGTTTTCTGACCAATCTAATG
ACAAGAGAACAGAGGAATTATCAGTTTGATTTTTTGAGACCACAACACAG
TTTATTCCAATATTTCACCCGTTTAGTTGAACAATATACTAAGGTATTAC
TACCACCTGGGGATATCACACAGAAATTGCAAAAAGACTTAAGTGACCAA
TGGAAGGTATTAGATACAGTAAAATATCGTGTAGAATGGCAACAATATCA
GGATCGTGAAAAACGGAaagttgaagatgaaaaagaaagagagagaaTTG
CATTCGCATCTATCGATTGGCATGATTTCGTTGTCGTGGAAACGGTCAAT
TTCAATGAAGAAGAAACAGCCAATCTTCCACCTCCTGTGAAGAAAGATCA
ACTAGGAGCAAGAATGTTACAAGAAGAACGTATTGAAAAACTGAAGGCCA
CGGGTGAGGACGCGGAACAAGTTGAAATGGACGTggaagaggaagaagaa
gaactGTATCAGCCTTATCAACAAgagcaagaaaaagaaaaggctGACTC
TGATATGGATGAAGAAAGTGACGAAGAAGAGGCTCAACCACCCGCTTTCA
AACCACCTATGATGCCACCCCCGCCAAGTGGTCCTGTTCATATTCGAAAA
TATGATCCGAAAGCTTCCAAACAACCACAACCCACACCCGGTGGTGTGCC
TGAGAAGTATTTGATTTCACCGTTGACGGGTGAGAAGATCCCGGTTGGCT
CGATGGAATCTCACATGAAGATTGCATTGCTCGATCCACGATGGAAAGAA
CAGAAGGAGAAAGCCATCGAAGAGAAGCGACAACAAGAACAAGTCTTTGC
TGAGGGTGTTCATATTGGTGATACTTTGAAACAACTTGCGGAAAGGCGTT
CCGATATTTTCGGAGTCGCTGCAGAGGAGACGCTGATTGGTCGAAAATTG
GGGGAAGAGGAGGAACAGGCGTTGAAAAAGACTCCAAAAGAAGTTTGGGA
CGGTCATACTGCAAGTATCGAGCGAACGACCAAGATGGCGCACTCCAACA
TTACTTACGAAGACCAAATTAAGGCAATCCATAAAGCCAAAGGTCTACTG
CCATCGGAAGACGCTGAGCGTATTGGTCCATCGATGAAGCAACCACCGCC
TAGACCTGGTCCGCCACCACCACGACCAATGCCACCACGCCCTACTCCTC
CTTCTCGGCCAATGGACGACACTCCCGCTCCTATTGTCACTATCCGATCT
GGTGATGGTCCAGGCCCGTCTAAAAACAATCCTCAAGCACCCAAACCACT
TATGGGTGCACCACCCATGGAGCCGCCTCGCAACATGCCACCACCTGTCA
ACATGCCTCCTCGCCCACCACAGAACCCGATGATGCGCCCACCTCCCATG
ATGAGACCTCCAGGACCAGGAGACATGGGTATGATGCAACCACCTCCTCT
CATGCCCCCACCTCCCGGTATGATGATGCCACCACCCCCAGGAGGTATGA
TGCCTCCACCACCGGGTGGAATGATGCCGCCCAGACCACCTCAAATGGAT
GACCCAGGTATGCGAGGTCCTCCACCACAAAATATGGATGATGATGAACC
GGCTTCGAAGAGAGCCAAATTCGATGAGTCCGACCTCATCCCTGAGGACG
CTTTCATGCGACAAAATGCACCAAACGTCACGTTCCGCGTACAAGTTCCG
GATCTACCCGACAAATCTGACTGGCAGTGTCAAGGACAAACTCTTTCCAT
CAGTGCCATGTTGTCTGAATCGTGTGCATCGATCAAAGCAAAGGTCAACG
CAATGATCGGAATGCCTGCTGGCAAACAGAAACTGCAACTTGGATCGTTA
TTCGTGAAGGACTCGAACACATTGGCATTTTATAATTTCACATCATCAAG
TTTGGTACAACTGCAAGTCAAGGAAAGAGGTGGTCGTAAAAAATagatca
atatttttaaaattttattttataagtaGGTACCCcgccattttttaatt
ttgtactTTGAATAGAGTCGATAAATTCAAAGATGAAGTGtaaatatctt
aaaaaaaaagttgtgaCTTAATCTTTTACTTTACACTTTTGTTATAACTT
ATCTAAGAATTCCAATCTAAAG
Run BLAST on NCBI

protein sequence of TCONS_00000447-protein

>TCONS_00000447-protein ID=TCONS_00000447-protein|Name=TCONS_00000447-protein|organism=Clytia hemisphaerica|type=polypeptide|length=808bp
MGPAVPIEQVQTETSEDGKIYERSQQDGEMYSKPTVGIIYPPPEVRNIVD
RTANFVARNGPEFEERIRGNEADNPKFNFLNPNDPYHAYYAHKLKEYRET
DIADLPSLNEKEPQKAPQTQTKKQAPQVIETIIPKDPPPAYEFTADPPTI
SALDLDIVKLTAQFVAKNGKGFLTNLMTREQRNYQFDFLRPQHSLFQYFT
RLVEQYTKVLLPPGDITQKLQKDLSDQWKVLDTVKYRVEWQQYQDREKRK
VEDEKERERIAFASIDWHDFVVVETVNFNEEETANLPPPVKKDQLGARML
QEERIEKLKATGEDAEQVEMDVEEEEEELYQPYQQEQEKEKADSDMDEES
DEEEAQPPAFKPPMMPPPPSGPVHIRKYDPKASKQPQPTPGGVPEKYLIS
PLTGEKIPVGSMESHMKIALLDPRWKEQKEKAIEEKRQQEQVFAEGVHIG
DTLKQLAERRSDIFGVAAEETLIGRKLGEEEEQALKKTPKEVWDGHTASI
ERTTKMAHSNITYEDQIKAIHKAKGLLPSEDAERIGPSMKQPPPRPGPPP
PRPMPPRPTPPSRPMDDTPAPIVTIRSGDGPGPSKNNPQAPKPLMGAPPM
EPPRNMPPPVNMPPRPPQNPMMRPPPMMRPPGPGDMGMMQPPPLMPPPPG
MMMPPPPGGMMPPPPGGMMPPRPPQMDDPGMRGPPPQNMDDDEPASKRAK
FDESDLIPEDAFMRQNAPNVTFRVQVPDLPDKSDWQCQGQTLSISAMLSE
SCASIKAKVNAMIGMPAGKQKLQLGSLFVKDSNTLAFYNFTSSSLVQLQV
KERGGRKK
Run BLAST on NCBI

transcript from alignment at sc0000002:878549..893424+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000447 ID=TCONS_00000447|Name=TCONS_00000447|organism=Clytia hemisphaerica|type=transcript|length=14876bp|location=Sequence derived from alignment at sc0000002:878549..893424+ (Clytia hemisphaerica)
CAGATTCTCGGAAAAAAGCTTTTTGGGCAGAATTGGGTTGATCCAGGtaa aggtacattcacttgccaagtgaatcataAGCACCGAGTGAGAATCGATC CCTGACCTCCCAGACGGGAATCAAGGTTGATAACCGCTACACTACTATGT CTACCTCCTAAAGCTTGGTAGCTTTTTCCAGTTTCTTGagaattcttttt tagaaaGTAAAAAATTAGAATGGGACCTGCGGTGCCCATTGAACAAGTTC AAACAGAAACTTCAGAAGATGGAAAGATCTATGAGAGATCACAACAAGAT GGTGAAATGTATTCTAAACCTACGGTTGGTATTATTTATCCACCGCCTGA AGTCAGAAGTAtcttttcaaattgtttttgctAAAACCATATTTCGtttt tattatatatatatttaacAGTGCCACTGTACCATTAGAAGAATCTATTA AAGGCTGCatgatttaaaggttttttaaaatattatctTCAAGTCAGTAT TATGTTGTGGAAAAGCCAATGGATATCAACCCTTTCCAGTCCCACCCGTG GCACTTGCTGCTTGAATAGATGACGTATGATCTAGTGCAGTTTTGGGACC AATAGAAAGCTGTGGTAGGATTTGAATCAAAAGATTAAAAAGCATATCCT ACAAAATTGCACACTGCATGTCAACCTCTAATActagtgattttttttat tctaatcATCTAAGTGTTGTTGACAGTTATTATCTACTATCCTTTGCAAA ATGGTAGATAGTAACCTATactttcaatattttgtttgtACAATACAGTT ACATAAACTATTTACAACTGTTGATTTCATTGTTTGCCttttattttaac taaaagatttagaaaccttTTTGCATTGTTTTAGTATCCAAATTACCACA TAGACTCTAtgaaaaaagggtaaaaatttcattgaaagtaccattttgtt ttcaagatTCATCTCATTTACTTAAGTGTAATTTGTAAAACTTGCTCTGT GTAGCTATAGAATAACTGGGGGACTGAAAAAAGGTTAACTGTCAAAGGTA ATTAGGTGAAAAGAACTTTATTCCATTTATTGTTCTGATTGtagttaaaa caaaaattcaaaacttcattttttgtagTACTTTAAAGTTTCTTACGTAC AATTATCAGCTACATAAAAAATGATCTAACTTGttggaaaaaattcaaat ttttacaagTCGTACGGTCGTAAAATGTtgtaaaattataataaaaaatt gaaacaagagAAACAAGAAGATGCTATTCTCAAGGGTCCATTAGTCTTTT GACTTGTAATTCAATGTAGTCAATTTTTTCTGATACCTTCAGAAAGTTTA GCGAATCTATCTGTAatgaaattgtaaaattttaaaatttttatataatt tgtttaGTTTACTAAACAATAGATGTGAATCTTGAAATCTCTAAAAGTTT TATGTTTCCTTAGCGTTTTTTCCCTCACAGATATTGTTGACAGGACTGCA AACTTTGTAGCTAGAAATGGTAAGTtactttgattctttctactaTTGCT atatctttttctcaaaatgagATGAATTATGAAAATCTCTTTATATATAT AAATGTGTAAGTCAATTTTTTAGTGcggcttttttctttttacatatttt gaataTGGAGTTGTAAAACATTGATTCTTGTTTTCTTTCAGGTCCTGAAT TTGAGGAAAGGATCCGTGGAAATGAAGCTGATAATCCAAAGTTCAATTTC TTGAACCCTAATGACCCTTACCATGCATATTATGCTCACAAGTTAAAAGA ATACAGAGAAACTGATATTGCAGATCTGCGTAGGTTTAAATTGTGTTGTT TGTCTCAAAAATTGGATTAACAGATACCTTTACtgagagaagaaattttt gctggcAACAATATTCACGAATTTAATTTCACAGTATTTTggtttattta aaagaaattaaattccacgaaacACCTCAAAATGTGTCAACCGCTAAATA TGCTGTTTTTGAGGATTGAATTGCAAAGttttaaattctgcaaaaaattC TTCCCCTTAAGGTAATAGTAATTCTTATTTTAATtctaatagtaggggga aatttgtaaaattgctcgatttttttagtcaaagcacttgttttacattt ttggaaaagctaaaggggtaggggaatcaaaataacttgggtgccaattt tttttcggacactttggtgtgattttcggacaaatacgacggtctcaggc aaatatcatagggtgaaaaatttatgaaaattttagctggaGAAAACgaa gacctgttgtatatttttggaaagctctcaaaaaattaagattagtgata tattgcgagtataggtgatttcagtacctaactcgagatattgagcttcc gaaagcacAAAAACtagacaaaacagctgtttctggctgaaaaacactgt ttttaaggattaatatctcaagttaggtaaagaaatcacctatactcgca atatatcactaatcttgattttttgagagctttccaaaaatatacaacat NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNACATtttaatgatgcaaaaaatcattaaattttttatcattcttacg cggatcatttcaataggatactggtctatctattttattaggtcgttgct ttgactaaaaaagtcgagcgacctcaaataaacgaacaaatttcccccta ctataataacagtgatcaaagttcttccgtctcaagacagatttccgtct cacagaaatttttgtgaaagttttccGTTTTAGTTAGAAATGGTTATTTA GCAAGGAATAGTGATTTTATTCTCTAGAAACATTCTAAGTTGTTTTAATT AACTAATTTTAGTGCCTTTCTAGCCAATCTAGGGGGTAAAAAATCCGAAA ATTTTCTGGCTCTCGGCCCCAACCATAGTGGGGCCTGCGGGTGTCACAGT ATACGGAAATATCTTTATCAAGAAAATTTCTGTCTcaaaaaaaatctgct ttgaCCACTGCACCGTGGAAGGCACATATaccacaaaaaaatacaaaaaa atcataagtTAAAGTCTACTTTCTGCTAGGTTTAAGTGATACCCAATAAG GCTGTTGTAGTAGACTGacaatattttagttttttacttttattctcATA TTTCTATGTTCACATTTTTAGCGTCACTAAACGAAAAGGAACCACAAAAA GCACCTCAAACTCAAACAAAGGTACTTTaaaaaagcactttgaaaagctC ATCACtaaagattttttgcttgttgCTTGAAattagaagtatttttttta aatactatgcatcagtcaaaaaatcaactttttgtacgAAAGGTTTCTGA ATTTCGGAAAAATGCCATGTACTTACTTGGTCCTACTCACTCTTCCAGAA ACAAGCTCCACAAGTTATAGAAACGATCATTCCAAAAGATCCGCCACCAG CGTATGAATTCACGGCAGATCCACCCACCATTTCTGCTCTTGATTTGTAA GTCAAAGCTGTAATTTCTTTTCTAATATCCTTCTACATGtttgtttttta gaaaaataacatTACAAAGATTTCAGTCAATCTTTCTAGACAAACTGATA CATTTCCTATCCATTAAACAATCCACTCAATGACTTGCTGcttttaacaa ataaataatattAACAACACGATCAATTCTTTTAACTTTTGTCATCAAAT AGTGGTTCTTTTTATTTCGTGAAATGTAGTTTTGTATAGCACTTGTAATG CTTGGttcatgttttcttttcagGGACATTGTCAAACTAACTGCTCAGTT CGTTGCGAAAAATGGAAAAGGTTTTCTGACCAATCTAATGACAAGAGAAC AGAGGAATTATCAGTTTGATTTTTTGAGACCACAACACAGTTTATTCCAA TATTTCACCCGTTTAGTTGAACAATATACTAAGGTTTGTATTATTTGCTC gtaatttttcatagaaatatAGGGTTTTTTAAAAAGCAGGAATTTACCAA CTTTTTAGAATATTTGATAACTGATAACACCAAttgaaaacttgaaagtt gttttttgaatTGCTTTCCTTAACAATACAATTTTATCCACCTTATCTTG CAACAGTAACCTCAACTAAACATTGCAGTgtcaaatttccttaaaaatat ctAAACTATGGAGACGAATATCATTGAACTATGTTTTTATTCTTACCTCT AGGTATTACTACCACCTGGGGATATCACACAGAAATTGCAAAAAGACTTA AGTGACCAATGGAAGGTAACTatgaatattttttcacttcaacATATTCA ATTTAAACAGACGGTTGGTTTTCATTTTCGGATGAAGtgttaaaatactt ttttttattgaccGTCCGCCAATTTCTTTGTCCAACCCTACTGTAGTCTG TAGAAATAGTATACTGAAtcctttcttcatttttatggataagaattttt aaggaaaaagacTTCTTGCAACAGGGTTGACTTTTAAGTGCCTTTttgag aaatgaaatttttatttgggaAATTTCTAGAtcttttttgttatttcagG TATTAGATACAGTAAAATATCGTGTAGAATGGCAACAATATCAGGATCGT GAAAAACGGAaagttgaagatgaaaaagaaagagagagaagtatgaattt gaaaagtttacGTTTTTAACGAAAAGATCAACACAGCGTGCTGAAGACCT GTTCTCATTTGAGAATGCTATGTACTGGGTATTTCAAGAGGAATTTACTA AGTAGAACTAAAAAattacattaaaatttgatctcAAACTTAAGATTTTA TCTTTGAAACACCTGGTATTTTttggcttcacttttttcttaccGGTGCA TAAAAGACTATAAAGggcaattttctttcaaattcattctttcaattttt tcattcaGTTGCATTCGCATCTATCGATTGGCATGATTTCGTTGTCGTGG AAACGGTCAATTTCAATGAAGAAGAAACAGGTACCCATCATTTGTATCAT GTACCCCCTCTCAAATCGAATGTTGTATCCTTAGCTGTCCTTAGTTTTAA CATTTCATTGACTACAAAAATTTTTAGCTGAAGGCAGCCATTTAAAAGTC CAAATACTGTAGAAAAAAAACTCAGCCACTAATTTGCCACGACCACTGTA TGACGACGACACATGGACCTTCCGTGGCTAAGAATAATGATAAATGTTTG CTTATAATTATTTCAGCCAATCTTCCACCTCCTGTGAAGAAAGATCAACT AGGAGCAAGAATGTTACAAGAAGAACGTATTGAAAAACTGAAGGTAATTT AAATTCTCTTTATCCTTCTTTTGTTAAACCATAGTACATAATATTATAAT TAAGCTTCTACATTTTTTTTCTGCTGTGGGACAAGTTCGCTATCGATAAA CTGTTTTTTCTTTGCCGAAACTATGAAACTACATTGGATCGTAGAAATTA ATTTACAATGTCTAATCACGTGAAGTGATTTTCTTAGCAAtggtcagttt ttttaagagttttctTTTAGTTCTTTTCTTCTCTGATTTTCCGATTCCGT TTTCCAGGCCACGGGTGAGGACGCGGAACAAGTTGAAATGGACGTggaag aggaagaagaagaactGTATCAGCCTTATCAACAAgagcaagaaaaagaa aaggctGACTCTGATATGGTGAGATGATTTGATGCTATTGTAGTTTCCCG ATTTGTGCGGAATTTGTTGAGCTCTTAATTTTGATAAACATTTTGACATC TTCGCGAAGCGTAGTGATCATGTTGAATATCGATTGTGGatcttcttttg agctataagTTTATCGATACTGTATTgagaatcaattttgaaatttttgt ttcaatccAGGATGAAGAAAGTGACGAAGAAGAGGCTCAACCACCCGCTT TCAAACCACCTATGATGCCACCCCCGCCAAGTGGTCCTGTTCATATTCGA AAATATGATCCGAAAGCTTCCAAACAACCACAACCCACACCCGGTGGTGT GCCTGAGAAGTATGTTTCCTGCATCTCTCGATCACATACAaatgatttta ctttttcagNCTGAGAAGTATGTTTCCTGCATCTCTCGATCACATACAAA TTATTTTACGTTTTCATcataaacatttcaaattcatttagaccatagta taagaaagccgcggctggaatgataacatctgaacttctgttgttctatc tctgtcgtatttgatgactatttttttatcaagagatcagtaatgtagca tctttaatggtaaattttattgttttgtcgttaatacttacttcccagtt tgttttagacattaatgatataccATTAAAGTAaagaaagatcaacaata agaaatttaaacaagcacaaaatggctgggctgaaagaactcagaaaaat aaacaaagtgcctcgaatgccttcgcaatatttcagtgaaatctttttag aaatcaatgaaaaattacatctagataatactgtgaaagtttcaagccag caccttcaaaatttatcattcaaactgacaagaaagttgtcatcttgaat atagttctcataatttcaattttggcgaaaaactattttttccacaaaat acccctaaaatatgtccaaattagttcaagtgttctattgggtacagatt caaagatATCTAGCAATAAAAAAACTTTTTGTGAAGGAAAATGGAAGAGA AAAATTTCAAAAACTATCTACCAATAATAAACTGAGCATCTTAATGTttt tataaagctcggagacagagatagaacagcaattaactgagaagacaatg tggtacatattccagccgcggctttcttatactatgtttagaccaattaa aaaaaacgaattatcGAACTTCAATGTATACTTCCTAAAAACTTGTAAAg taaatcgtttaaatagacaTTGATTGTACAGATCAGAGAAGGGTCGTTCA CGCGTGCCAATTTTGCACTGGCTTTTTAAATAATTGATGTTTgaattatt ttctcttttcaagGTATTTGATTTCACCGTTGACGGGTGAGAAGATCCCG GTTGGCTCGATGGAATCTCACATGAAGATTGCATTGCTCGATCCACGATG GAAAGAACAGAAGGAGAAAGCCATCGAAGAGAAGCGACAACAAGAACAAG TCTTTGCTGAGGGTAACTACTTATTTAGACCCTTTCAAGTGAATCCTTTT AGTCGTTTTGAAAGGATCGATCGGAAATTTGTGAAATTATATTACAatgt accgggtgcaccaaaaaaaagtatacatgTTTGTTGAGATATTGTGGGCt tcagaatttaaattttttgttctttctttttttttgtcgtaTAGAgcagg atgctctaacttaaattttgagctatcatacattaggtttgaaaaagtag ttcgaaagttattaaaaaaactgacttttttttggacctacctgcgGGTA CCCCGGTctgtcctttaaattaacccatgttcgttcgttcgttcgtctgt taccagcttttttcgggattggctcattacttttttctgtttttcggcac aatgatgcaaaatgatgatttctaaaaagtgacggatttttgaaaaacat tattttccggccgaaaatgccggaaatatgccggaaaactgttttttttg gcattttctcgagattttatcattagttttttctgattttatcattagtt ttttctgattttttgctcaaagatgcatattcgcaatgctcaaaacatgg ccgagttcgtttttgcaaattttcattggattttttccttatatttctat gtttttcacacaaaaacattattgataacaagcTCACCATCAAgtatgat tcaattgtcaataaaacagatttttgcgaccagaactttctatttatttt tccctacaacccttccctcttcGGAAGTTATATaagaatttattgcgtta tgcattttcgctaaacgctatattttctgactgatttttttcatttttct cctcgcattgctatctaactttcataatcaggtaggtccattcagcatat atTGTTAAagtcgaaattaaaaaaaaaatcatcaaaaaacagCGAGCGAA Atttttctcttgacacttaccttctttacacataaaaataccaaaaaatg caactatgttcatcaaaactcgttgcagaatttaaaaatatggtaaAGTA AGCTATTCCCATGCGGGATAATATATTTGGAAAAGCtgacaaaaagtttt ggaaatctcctagagaggttttgatgttatgtgtgtgCTATATGAgacaa ctttaaaaaaatatcaccattcctcgactagttgctcaaagaacttgtgt ctgcattgagtttgctcgtGTTGTAAATATTCAGGACGGGCAAATAAGAT GGAAAtactgttggcaaaatataaataagaaaaaaacaacaacaacaaaa caataaaattgtgtttttgccattttggggggggggggggttcaggaTCC AGGATACCAAACCAGGGCCAAAAAACCTGACCCTTCGAGATTTGAAAGTT GTAGACACTACCACCCCTAACTACCAACTTAAAAaccccaattttttaaa aaaggggggacccaacTCCCGAActtgaaaatcctgatttttctgaaaaa gggggccccccccccccccccccaaattggcaatgttaatgtttttattc aaagactattcctcttattaatcactttcattatacaacattttaagtca gataccaattttaaattcagcaaaaattaaaaaaagcggaacccaccccc tcattttggtatcgatagcAACTTAAAGAttcctaaattttcaaaaaaaa ggggTACCATCCCCCtcaatttggtatcgataccaacttgactttttgaa atttgaaaaaaaaattgacaccaccacccggccctaggtttggtatctgg atcctGATCCCCCTGTTTTGTCTTATATATAgcgaaatttcgacattaaa aaaaagtcagtttttttaaataactttcgaactactttttcaaatttaat gtatgatagctcaaaattcaagttagagcatcctctttaCGATAAAAAAA ATGCTGAAGCtaacaatatctcgacaaacctgtatacttttttttggtgc acccggtatgtTGGTGTTGCGTGGATTGTACTATTTACCTACCAGATGAA TAAGTTTTCATTGAATGTTCTTGCCGATTTTTTTTATCCTATTAAAACCA GGTGCGTCTtattttaagggctctgaccatagtgaatttttcataattgc cgtgtttaaaatgtgttttctcactgatgtaaccaacaaaactatggcat gttatacattttctgttagacaaactattcctgaatctgaaaattgaaaa attgcattgaaaaaatttgataaagaagaaaatgaagacctttgagagga agagtatttcaactttgaagagcttagtttaagcgaagaaaaaacatgtt gaaaaatctttcgcagtagatggtgtatcttttaccgaacaataaaaatt tttgcggaaaatttttgtaaatgcttctttgtctcgaaatcttcaaaata gtggtttttcatcaatttttcatctggattttgcttaaaaaaacaatttt tcatctggattttgcttaaaaaaacaatttttcatctggattttgcttaa aaaaacagtcataacttttgacacatctttttagaaaaattttccgcaaa atctaaaatagttcaattctttgcggaaattttgaaaaaagttcgaaaca aaaaggttgattacccattaaaacttagcactttttataaaagaaggtga tgcaacatattattaacgtctttttaaagttcataacgtcatttttgcaa ttaaagtCTTAATTACTCATAAGGGGCTTGATTAAAAAGcattataaagg caattctttgttaaaagtgttaaaaaatctaaaacataacttttatgttc agatactaaaatcaattttctgactatggtcagagcccttaagcatGCTT ACGCGAATGATTAAAGATATCTTCATTTGCACGCTCATATAGAAGATAAA TAAGTCAACTAACTTTAGTTAAACAGTTTCTaatccattttttttttcat gtcaGGTGTTCATATTGGTGATACTTTGAAACAACTTGCGGAAAGGCGTT CCGATATTTTCGGAGTCGCTGCAGAGGAGACGCTGATTGGTCGAAAATTG GGGGAAGAGGAGGAACAGGCGTTGAAAAAGACTCCAAAAGAAGTTTGGGA CGGTCATACTGCAAGTATCGAGCGAACGACCAAGATGGCGCACTCCAACA TTACTTACGAAGACCAAATTAAGGCAATCCATAAAGCCAAAGGTCTACTG TAAGTGGTTtgttattttatgtttttctcGTTTGACGCCAATGGATACTT CCATCAGAGATACATGGAGTTAGAGAAAATTTATCACATTCTCTTGATTG GTAGTATGAAAGTTTTGATCACATACTTGCGCCGCAATGGAGATCGTTTG AGTTCTGATCACTTCCAAGTAGCGTGTTAAGGATGTATGGAGACAGACTC TCTACCTTGTCGATGTTTTGCATCATtgttgaaataattttatttctttA TTAATGTTCTTTATGATATTCTTCCCTGTTTTGGTCATTTATGTTTTTTT TCTTTTTAACTCATCCAGGCCATCGGAAGACGCTGAGCGTATTGGTCCAT CGATGAAGCAACCACCGCCTAGACCTGGTCCGCCACCACCACGACCAATG CCACCACGCCCTACTCCTCCTTCTCGGCCAATGGACGACACTCCCGCTCC TATTGTCACTATCCGATCTGGTGATGGTCCAGGCCCGTCTAAAAACAATC CTCAAGCACCCAAACCACTTATGGGTGCACCACCCATGGAGCCGCCTCGC AACATGCCACCACCTGTCAACATGCCTCCTCGCCCACCACAGAACCCGAT GATGCGCCCACCTCCCATGATGAGACCTCCAGGACCAGGAGACATGGGTA TGATGCAACCACCTCCTCTCATGCCCCCACCTCCCGGTATGATGATGCCA CCACCCCCAGGAGGTATGATGCCTCCACCACCGGGTGGAATGATGCCGCC CAGACCACCTCAAATGGATGACCCAGGTATATATGAATTTCTTCTGAACT TTCAATCGAAAATTTGGCACATTTATTTGCTAAATTTGAGACCCTTTTAT TACATACAAGCTGTTGTCAAATAACATTTAAGGCAGACCTATTGCAAAAA AGATGATATAGTAAAATAGGTAGTCGGGTTTCTTGATTCTTTCTcctttt gaaattaaattgaattgaatttgatttcttttcttttccttcaAGGTATG CGAGGTCCTCCACCACAAAATATGGATGATGATGAACCGGCTTCGAAGAG AGCCAAATTCGATGAGTCCGACCTCATCCCTGAGGACGCTTTCATGCGAC AAAATGCACCAAACGTCACGTTCCGCGTACAAGTTCCGGATCTACCCGAC AAATCTGACTGGCAGTGTCAAGGACAAACTCTTTCCATCAGTGCCATGTT GTCTGAATCGGTAAGTTGTTGCTGATCCTTGTTGCATGTCAAAGTTTTTA GGTCTTTGGTTAATTCTTtcttattcgatcttcaagggaccaaaaattAT CTTCGTATTAAAAaaggattcgaattacagagagagacttttcagctgag gggccaatatttcaattcgaattacagaaaaaataGAGAGAGAGTTGACT TGTTACTTTTACTTTGagcgaaaaaaaaatatgtttggcAAATCATCAAA ACTCTCCATCACTAAGGCATCATCATAACTTAAATATTTGGTTTTCTTTA GTGTGCATCGATCAAAGCAAAGGTCAACGCAATGATCGGAATGCCTGCTG GCAAACAGAAACTGCAACTTGGAGTAAGTAGTCCCTTTGGCTTGGTAGTA GTGTTCCTcctataaaagaaaaactaaagtctgtccagatataattggca gtggaaacaagaatgcctgtaacttttgatggtcaaatataactatggaa tttttttttgcttgttttagagaatcaaaagcgctatatttcaatgtatt ttcggttgaaaaattcgcgatttttagcggttaaatttgcgattgcaaaa attgagctttttttctacttatgctataacgtccatttttacaccagtgg tagttcaaccttaggttaagaagtttgttaaatttcaaggcaaaccgaaa agtccttcggaagatatgggatcCGAAATaacccttggtagcacttttct gtgaaatatcaaatctccaacttattactaaaaacgggggtagtgatatg attgataacaCAGTTTTTTGATNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcaagc aaaaagaatttccataattatatttgactgtcaaaagttacaggcattct tgtttccactgccaattatatctggacagactttaaatcCGTTTATATTC GAAACAAATTATTGGAATTGTTTCCGCAGTCGACCCTAAAGAACACTCGc ttattgggccattccagtaaAAAATCACAcgagggtggacgaaccttttc aagtcaaaaaaaaattattgaaaatgtgtagttaccccctggaaaatggc aaaatgtaCTAAAACACCTTTCGaaaaattattatgaaaaatataaaaat tatacCTTAAAGTAAGGGTGGACGATTAGCctattaccccctggaaattt tagaatgattttttacccccttataaaaatgaaaaaacaacccctggaaa tttttttcagattaccctccggaaatgttcgtccagattaccctctggaa attgTCGTCcacctgtatggatataaaatggaataacCCATTTAAGCAAT CGCATCTTTTACATCAGCAATTTATTTTGATCCTTAAAAAAGAGTAAATA ATATGTCTGTCGTTTTGAAGTATTTCGAACCAAGAAATTCTTTTTACGTT CATAAAATATCCTGCaaagttcaattttcaatatttttttcattacaGTC GTTATTCGTGAAGGACTCGAACACATTGGCATTTTATAATTTCACATCAT CAAGTTTGGTACAACTGCAAGTCAAGGAAAGAGGTGGTCGTAAAAAATag atcaatatttttaaaattttattttataagtaGGTACCCcgccatttttt aattttgtactTTGAATAGAGTCGATAAATTCAAAGATGAAGTGtaaata tcttaaaaaaaaagttgtgaCTTAATCTTTTACTTTACACTTTTGTTATA ACTTATCTAAGAATTCCAATCTAAAG

Coding sequence (CDS) from alignment at sc0000002:878549..893424+

>TCONS_00000447 ID=TCONS_00000447|Name=TCONS_00000447|organism=Clytia hemisphaerica|type=CDS|length=43686bp|location=Sequence derived from alignment at sc0000002:878549..893424+ (Clytia hemisphaerica)
ATGGGACCTGCGGTGCCCATTGAACAAGTTCAAACAGAAACTTCAGAAGA
TGGAAAGATCTATGAGAGATCACAACAAGATGGTGAAATGTATTCTAAAC
CTACGGTTGGTATTATTTATCCACCGCCTGAAGTCAGAAATATTGTTGAC
AGGACTGCAAACTTTGTAGCTAGAAATGGTCCTGAATTTGAGGAAAGGAT
CCGTGGAAATGAAGCTGATAATCCAAAGTTCAATTTCTTGAACCCTAATG
ACCCTTACCATGCATATTATGCTCACAAGTTAAAAGAATACAGAGAAACT
GATATTGCAGATCTGCCGTCACTAAACGAAAAGGAACCACAAAAAGCACC
TCAAACTCAAACAAAGAAACAAGCTCCACAAGTTATAGAAACGATCATTC
CAAAAGATCCGCCACCAGCGTATGAATTCACGGCAGATCCACCCACCATT
TCTGCTCTTGATTTGGACATTGTCAAACTAACTGCTCAGTTCGTTGCGAA
AAATGGAAAAGGTTTTCTGACCAATCTAATGACAAGAGAACAGAGGAATT
ATCAGTTTGATTTTTTGAGACCACAACACAGTTTATTCCAATATTTCACC
CGTTTAGTTGAACAATATACTAAGGTATTACTACCACCTGGGGATATCAC
ACAGAAATTGCAAAAAGACTTAAGTGACCAATGGAAGGTATTAGATACAG
TAAAATATCGTGTAGAATGGCAACAATATCAGGATCGTGAAAAACGGAaa
gttgaagatgaaaaagaaagagagagaaTTGCATTCGCATCTATCGATTG
GCATGATTTCGTTGTCGTGGAAACGGTCAATTTCAATGAAGAAGAAACAG
CCAATCTTCCACCTCCTGTGAAGAAAGATCAACTAGGAGCAAGAATGTTA
CAAGAAGAACGTATTGAAAAACTGAAGGCCACGGGTGAGGACGCGGAACA
AGTTGAAATGGACGTggaagaggaagaagaagaactGTATCAGCCTTATC
AACAAgagcaagaaaaagaaaaggctGACTCTGATATGGATGAAGAAAGT
GACGAAGAAGAGGCTCAACCACCCGCTTTCAAACCACCTATGATGCCACC
CCCGCCAAGTGGTCCTGTTCATATTCGAAAATATGATCCGAAAGCTTCCA
AACAACCACAACCCACACCCGGTGGTGTGCCTGAGAAGTATTTGATTTCA
CCGTTGACGGGTGAGAAGATCCCGGTTGGCTCGATGGAATCTCACATGAA
GATTGCATTGCTCGATCCACGATGGAAAGAACAGAAGGAGAAAGCCATCG
AAGAGAAGCGACAACAAGAACAAGTCTTTGCTGAGGGTGTTCATATTGGT
GATACTTTGAAACAACTTGCGGAAAGGCGTTCCGATATTTTCGGAGTCGC
TGCAGAGGAGACGCTGATTGGTCGAAAATTGGGGGAAGAGGAGGAACAGG
CGTTGAAAAAGACTCCAAAAGAAGTTTGGGACGGTCATACTGCAAGTATC
GAGCGAACGACCAAGATGGCGCACTCCAACATTACTTACGAAGACCAAAT
TAAGGCAATCCATAAAGCCAAAGGTCTACTGCCATCGGAAGACGCTGAGC
GTATTGGTCCATCGATGAAGCAACCACCGCCTAGACCTGGTCCGCCACCA
CCACGACCAATGCCACCACGCCCTACTCCTCCTTCTCGGCCAATGGACGA
CACTCCCGCTCCTATTGTCACTATCCGATCTGGTGATGGTCCAGGCCCGT
CTAAAAACAATCCTCAAGCACCCAAACCACTTATGGGTGCACCACCCATG
GAGCCGCCTCGCAACATGCCACCACCTGTCAACATGCCTCCTCGCCCACC
ACAGAACCCGATGATGCGCCCACCTCCCATGATGAGACCTCCAGGACCAG
GAGACATGGGTATGATGCAACCACCTCCTCTCATGCCCCCACCTCCCGGT
ATGATGATGCCACCACCCCCAGGAGGTATGATGCCTCCACCACCGGGTGG
AATGATGCCGCCCAGACCACCTCAAATGGATGACCCAGGTATGCGAGGTC
CTCCACCACAAAATATGGATGATGATGAACCGGCTTCGAAGAGAGCCAAA
TTCGATGAGTCCGACCTCATCCCTGAGGACGCTTTCATGCGACAAAATGC
ACCAAACGTCACGTTCCGCGTACAAGTTCCGGATCTACCCGACAAATCTG
ACTGGCAGTGTCAAGGACAAACTCTTTCCATCAGTGCCATGTTGTCTGAA
TCGTGTGCATCGATCAAAGCAAAGGTCAACGCAATGATCGGAATGCCTGC
TGGCAAACAGAAACTGCAACTTGGATCGTTATTCGTGAAGGACTCGAACA
CATTGGCATTTTATAATTTCACATCATCAAGTTTGGTACAACTGCAAGTC
AAGGAAAGAGGTGGTCGTAAAAAATagATGGGACCTGCGGTGCCCATTGA
ACAAGTTCAAACAGAAACTTCAGAAGATGGAAAGATCTATGAGAGATCAC
AACAAGATGGTGAAATGTATTCTAAACCTACGGTTGGTATTATTTATCCA
CCGCCTGAAGTCAGAAATATTGTTGACAGGACTGCAAACTTTGTAGCTAG
AAATGGTCCTGAATTTGAGGAAAGGATCCGTGGAAATGAAGCTGATAATC
CAAAGTTCAATTTCTTGAACCCTAATGACCCTTACCATGCATATTATGCT
CACAAGTTAAAAGAATACAGAGAAACTGATATTGCAGATCTGCCGTCACT
AAACGAAAAGGAACCACAAAAAGCACCTCAAACTCAAACAAAGAAACAAG
CTCCACAAGTTATAGAAACGATCATTCCAAAAGATCCGCCACCAGCGTAT
GAATTCACGGCAGATCCACCCACCATTTCTGCTCTTGATTTGGACATTGT
CAAACTAACTGCTCAGTTCGTTGCGAAAAATGGAAAAGGTTTTCTGACCA
ATCTAATGACAAGAGAACAGAGGAATTATCAGTTTGATTTTTTGAGACCA
CAACACAGTTTATTCCAATATTTCACCCGTTTAGTTGAACAATATACTAA
GGTATTACTACCACCTGGGGATATCACACAGAAATTGCAAAAAGACTTAA
GTGACCAATGGAAGGTATTAGATACAGTAAAATATCGTGTAGAATGGCAA
CAATATCAGGATCGTGAAAAACGGAaagttgaagatgaaaaagaaagaga
gagaaTTGCATTCGCATCTATCGATTGGCATGATTTCGTTGTCGTGGAAA
CGGTCAATTTCAATGAAGAAGAAACAGCCAATCTTCCACCTCCTGTGAAG
AAAGATCAACTAGGAGCAAGAATGTTACAAGAAGAACGTATTGAAAAACT
GAAGGCCACGGGTGAGGACGCGGAACAAGTTGAAATGGACGTggaagagg
aagaagaagaactGTATCAGCCTTATCAACAAgagcaagaaaaagaaaag
gctGACTCTGATATGGATGAAGAAAGTGACGAAGAAGAGGCTCAACCACC
CGCTTTCAAACCACCTATGATGCCACCCCCGCCAAGTGGTCCTGTTCATA
TTCGAAAATATGATCCGAAAGCTTCCAAACAACCACAACCCACACCCGGT
GGTGTGCCTGAGAAGTATTTGATTTCACCGTTGACGGGTGAGAAGATCCC
GGTTGGCTCGATGGAATCTCACATGAAGATTGCATTGCTCGATCCACGAT
GGAAAGAACAGAAGGAGAAAGCCATCGAAGAGAAGCGACAACAAGAACAA
GTCTTTGCTGAGGGTGTTCATATTGGTGATACTTTGAAACAACTTGCGGA
AAGGCGTTCCGATATTTTCGGAGTCGCTGCAGAGGAGACGCTGATTGGTC
GAAAATTGGGGGAAGAGGAGGAACAGGCGTTGAAAAAGACTCCAAAAGAA
GTTTGGGACGGTCATACTGCAAGTATCGAGCGAACGACCAAGATGGCGCA
CTCCAACATTACTTACGAAGACCAAATTAAGGCAATCCATAAAGCCAAAG
GTCTACTGCCATCGGAAGACGCTGAGCGTATTGGTCCATCGATGAAGCAA
CCACCGCCTAGACCTGGTCCGCCACCACCACGACCAATGCCACCACGCCC
TACTCCTCCTTCTCGGCCAATGGACGACACTCCCGCTCCTATTGTCACTA
TCCGATCTGGTGATGGTCCAGGCCCGTCTAAAAACAATCCTCAAGCACCC
AAACCACTTATGGGTGCACCACCCATGGAGCCGCCTCGCAACATGCCACC
ACCTGTCAACATGCCTCCTCGCCCACCACAGAACCCGATGATGCGCCCAC
CTCCCATGATGAGACCTCCAGGACCAGGAGACATGGGTATGATGCAACCA
CCTCCTCTCATGCCCCCACCTCCCGGTATGATGATGCCACCACCCCCAGG
AGGTATGATGCCTCCACCACCGGGTGGAATGATGCCGCCCAGACCACCTC
AAATGGATGACCCAGGTATGCGAGGTCCTCCACCACAAAATATGGATGAT
GATGAACCGGCTTCGAAGAGAGCCAAATTCGATGAGTCCGACCTCATCCC
TGAGGACGCTTTCATGCGACAAAATGCACCAAACGTCACGTTCCGCGTAC
AAGTTCCGGATCTACCCGACAAATCTGACTGGCAGTGTCAAGGACAAACT
CTTTCCATCAGTGCCATGTTGTCTGAATCGTGTGCATCGATCAAAGCAAA
GGTCAACGCAATGATCGGAATGCCTGCTGGCAAACAGAAACTGCAACTTG
GATCGTTATTCGTGAAGGACTCGAACACATTGGCATTTTATAATTTCACA
TCATCAAGTTTGGTACAACTGCAAGTCAAGGAAAGAGGTGGTCGTAAAAA
ATagATGGGACCTGCGGTGCCCATTGAACAAGTTCAAACAGAAACTTCAG
AAGATGGAAAGATCTATGAGAGATCACAACAAGATGGTGAAATGTATTCT
AAACCTACGGTTGGTATTATTTATCCACCGCCTGAAGTCAGAAATATTGT
TGACAGGACTGCAAACTTTGTAGCTAGAAATGGTCCTGAATTTGAGGAAA
GGATCCGTGGAAATGAAGCTGATAATCCAAAGTTCAATTTCTTGAACCCT
AATGACCCTTACCATGCATATTATGCTCACAAGTTAAAAGAATACAGAGA
AACTGATATTGCAGATCTGCCGTCACTAAACGAAAAGGAACCACAAAAAG
CACCTCAAACTCAAACAAAGAAACAAGCTCCACAAGTTATAGAAACGATC
ATTCCAAAAGATCCGCCACCAGCGTATGAATTCACGGCAGATCCACCCAC
CATTTCTGCTCTTGATTTGGACATTGTCAAACTAACTGCTCAGTTCGTTG
CGAAAAATGGAAAAGGTTTTCTGACCAATCTAATGACAAGAGAACAGAGG
AATTATCAGTTTGATTTTTTGAGACCACAACACAGTTTATTCCAATATTT
CACCCGTTTAGTTGAACAATATACTAAGGTATTACTACCACCTGGGGATA
TCACACAGAAATTGCAAAAAGACTTAAGTGACCAATGGAAGGTATTAGAT
ACAGTAAAATATCGTGTAGAATGGCAACAATATCAGGATCGTGAAAAACG
GAaagttgaagatgaaaaagaaagagagagaaTTGCATTCGCATCTATCG
ATTGGCATGATTTCGTTGTCGTGGAAACGGTCAATTTCAATGAAGAAGAA
ACAGCCAATCTTCCACCTCCTGTGAAGAAAGATCAACTAGGAGCAAGAAT
GTTACAAGAAGAACGTATTGAAAAACTGAAGGCCACGGGTGAGGACGCGG
AACAAGTTGAAATGGACGTggaagaggaagaagaagaactGTATCAGCCT
TATCAACAAgagcaagaaaaagaaaaggctGACTCTGATATGGATGAAGA
AAGTGACGAAGAAGAGGCTCAACCACCCGCTTTCAAACCACCTATGATGC
CACCCCCGCCAAGTGGTCCTGTTCATATTCGAAAATATGATCCGAAAGCT
TCCAAACAACCACAACCCACACCCGGTGGTGTGCCTGAGAAGTATTTGAT
TTCACCGTTGACGGGTGAGAAGATCCCGGTTGGCTCGATGGAATCTCACA
TGAAGATTGCATTGCTCGATCCACGATGGAAAGAACAGAAGGAGAAAGCC
ATCGAAGAGAAGCGACAACAAGAACAAGTCTTTGCTGAGGGTGTTCATAT
TGGTGATACTTTGAAACAACTTGCGGAAAGGCGTTCCGATATTTTCGGAG
TCGCTGCAGAGGAGACGCTGATTGGTCGAAAATTGGGGGAAGAGGAGGAA
CAGGCGTTGAAAAAGACTCCAAAAGAAGTTTGGGACGGTCATACTGCAAG
TATCGAGCGAACGACCAAGATGGCGCACTCCAACATTACTTACGAAGACC
AAATTAAGGCAATCCATAAAGCCAAAGGTCTACTGCCATCGGAAGACGCT
GAGCGTATTGGTCCATCGATGAAGCAACCACCGCCTAGACCTGGTCCGCC
ACCACCACGACCAATGCCACCACGCCCTACTCCTCCTTCTCGGCCAATGG
ACGACACTCCCGCTCCTATTGTCACTATCCGATCTGGTGATGGTCCAGGC
CCGTCTAAAAACAATCCTCAAGCACCCAAACCACTTATGGGTGCACCACC
CATGGAGCCGCCTCGCAACATGCCACCACCTGTCAACATGCCTCCTCGCC
CACCACAGAACCCGATGATGCGCCCACCTCCCATGATGAGACCTCCAGGA
CCAGGAGACATGGGTATGATGCAACCACCTCCTCTCATGCCCCCACCTCC
CGGTATGATGATGCCACCACCCCCAGGAGGTATGATGCCTCCACCACCGG
GTGGAATGATGCCGCCCAGACCACCTCAAATGGATGACCCAGGTATGCGA
GGTCCTCCACCACAAAATATGGATGATGATGAACCGGCTTCGAAGAGAGC
CAAATTCGATGAGTCCGACCTCATCCCTGAGGACGCTTTCATGCGACAAA
ATGCACCAAACGTCACGTTCCGCGTACAAGTTCCGGATCTACCCGACAAA
TCTGACTGGCAGTGTCAAGGACAAACTCTTTCCATCAGTGCCATGTTGTC
TGAATCGTGTGCATCGATCAAAGCAAAGGTCAACGCAATGATCGGAATGC
CTGCTGGCAAACAGAAACTGCAACTTGGATCGTTATTCGTGAAGGACTCG
AACACATTGGCATTTTATAATTTCACATCATCAAGTTTGGTACAACTGCA
AGTCAAGGAAAGAGGTGGTCGTAAAAAATagATGGGACCTGCGGTGCCCA
TTGAACAAGTTCAAACAGAAACTTCAGAAGATGGAAAGATCTATGAGAGA
TCACAACAAGATGGTGAAATGTATTCTAAACCTACGGTTGGTATTATTTA
TCCACCGCCTGAAGTCAGAAATATTGTTGACAGGACTGCAAACTTTGTAG
CTAGAAATGGTCCTGAATTTGAGGAAAGGATCCGTGGAAATGAAGCTGAT
AATCCAAAGTTCAATTTCTTGAACCCTAATGACCCTTACCATGCATATTA
TGCTCACAAGTTAAAAGAATACAGAGAAACTGATATTGCAGATCTGCCGT
CACTAAACGAAAAGGAACCACAAAAAGCACCTCAAACTCAAACAAAGAAA
CAAGCTCCACAAGTTATAGAAACGATCATTCCAAAAGATCCGCCACCAGC
GTATGAATTCACGGCAGATCCACCCACCATTTCTGCTCTTGATTTGGACA
TTGTCAAACTAACTGCTCAGTTCGTTGCGAAAAATGGAAAAGGTTTTCTG
ACCAATCTAATGACAAGAGAACAGAGGAATTATCAGTTTGATTTTTTGAG
ACCACAACACAGTTTATTCCAATATTTCACCCGTTTAGTTGAACAATATA
CTAAGGTATTACTACCACCTGGGGATATCACACAGAAATTGCAAAAAGAC
TTAAGTGACCAATGGAAGGTATTAGATACAGTAAAATATCGTGTAGAATG
GCAACAATATCAGGATCGTGAAAAACGGAaagttgaagatgaaaaagaaa
gagagagaaTTGCATTCGCATCTATCGATTGGCATGATTTCGTTGTCGTG
GAAACGGTCAATTTCAATGAAGAAGAAACAGCCAATCTTCCACCTCCTGT
GAAGAAAGATCAACTAGGAGCAAGAATGTTACAAGAAGAACGTATTGAAA
AACTGAAGGCCACGGGTGAGGACGCGGAACAAGTTGAAATGGACGTggaa
gaggaagaagaagaactGTATCAGCCTTATCAACAAgagcaagaaaaaga
aaaggctGACTCTGATATGGATGAAGAAAGTGACGAAGAAGAGGCTCAAC
CACCCGCTTTCAAACCACCTATGATGCCACCCCCGCCAAGTGGTCCTGTT
CATATTCGAAAATATGATCCGAAAGCTTCCAAACAACCACAACCCACACC
CGGTGGTGTGCCTGAGAAGTATTTGATTTCACCGTTGACGGGTGAGAAGA
TCCCGGTTGGCTCGATGGAATCTCACATGAAGATTGCATTGCTCGATCCA
CGATGGAAAGAACAGAAGGAGAAAGCCATCGAAGAGAAGCGACAACAAGA
ACAAGTCTTTGCTGAGGGTGTTCATATTGGTGATACTTTGAAACAACTTG
CGGAAAGGCGTTCCGATATTTTCGGAGTCGCTGCAGAGGAGACGCTGATT
GGTCGAAAATTGGGGGAAGAGGAGGAACAGGCGTTGAAAAAGACTCCAAA
AGAAGTTTGGGACGGTCATACTGCAAGTATCGAGCGAACGACCAAGATGG
CGCACTCCAACATTACTTACGAAGACCAAATTAAGGCAATCCATAAAGCC
AAAGGTCTACTGCCATCGGAAGACGCTGAGCGTATTGGTCCATCGATGAA
GCAACCACCGCCTAGACCTGGTCCGCCACCACCACGACCAATGCCACCAC
GCCCTACTCCTCCTTCTCGGCCAATGGACGACACTCCCGCTCCTATTGTC
ACTATCCGATCTGGTGATGGTCCAGGCCCGTCTAAAAACAATCCTCAAGC
ACCCAAACCACTTATGGGTGCACCACCCATGGAGCCGCCTCGCAACATGC
CACCACCTGTCAACATGCCTCCTCGCCCACCACAGAACCCGATGATGCGC
CCACCTCCCATGATGAGACCTCCAGGACCAGGAGACATGGGTATGATGCA
ACCACCTCCTCTCATGCCCCCACCTCCCGGTATGATGATGCCACCACCCC
CAGGAGGTATGATGCCTCCACCACCGGGTGGAATGATGCCGCCCAGACCA
CCTCAAATGGATGACCCAGGTATGCGAGGTCCTCCACCACAAAATATGGA
TGATGATGAACCGGCTTCGAAGAGAGCCAAATTCGATGAGTCCGACCTCA
TCCCTGAGGACGCTTTCATGCGACAAAATGCACCAAACGTCACGTTCCGC
GTACAAGTTCCGGATCTACCCGACAAATCTGACTGGCAGTGTCAAGGACA
AACTCTTTCCATCAGTGCCATGTTGTCTGAATCGTGTGCATCGATCAAAG
CAAAGGTCAACGCAATGATCGGAATGCCTGCTGGCAAACAGAAACTGCAA
CTTGGATCGTTATTCGTGAAGGACTCGAACACATTGGCATTTTATAATTT
CACATCATCAAGTTTGGTACAACTGCAAGTCAAGGAAAGAGGTGGTCGTA
AAAAATagATGGGACCTGCGGTGCCCATTGAACAAGTTCAAACAGAAACT
TCAGAAGATGGAAAGATCTATGAGAGATCACAACAAGATGGTGAAATGTA
TTCTAAACCTACGGTTGGTATTATTTATCCACCGCCTGAAGTCAGAAATA
TTGTTGACAGGACTGCAAACTTTGTAGCTAGAAATGGTCCTGAATTTGAG
GAAAGGATCCGTGGAAATGAAGCTGATAATCCAAAGTTCAATTTCTTGAA
CCCTAATGACCCTTACCATGCATATTATGCTCACAAGTTAAAAGAATACA
GAGAAACTGATATTGCAGATCTGCCGTCACTAAACGAAAAGGAACCACAA
AAAGCACCTCAAACTCAAACAAAGAAACAAGCTCCACAAGTTATAGAAAC
GATCATTCCAAAAGATCCGCCACCAGCGTATGAATTCACGGCAGATCCAC
CCACCATTTCTGCTCTTGATTTGGACATTGTCAAACTAACTGCTCAGTTC
GTTGCGAAAAATGGAAAAGGTTTTCTGACCAATCTAATGACAAGAGAACA
GAGGAATTATCAGTTTGATTTTTTGAGACCACAACACAGTTTATTCCAAT
ATTTCACCCGTTTAGTTGAACAATATACTAAGGTATTACTACCACCTGGG
GATATCACACAGAAATTGCAAAAAGACTTAAGTGACCAATGGAAGGTATT
AGATACAGTAAAATATCGTGTAGAATGGCAACAATATCAGGATCGTGAAA
AACGGAaagttgaagatgaaaaagaaagagagagaaTTGCATTCGCATCT
ATCGATTGGCATGATTTCGTTGTCGTGGAAACGGTCAATTTCAATGAAGA
AGAAACAGCCAATCTTCCACCTCCTGTGAAGAAAGATCAACTAGGAGCAA
GAATGTTACAAGAAGAACGTATTGAAAAACTGAAGGCCACGGGTGAGGAC
GCGGAACAAGTTGAAATGGACGTggaagaggaagaagaagaactGTATCA
GCCTTATCAACAAgagcaagaaaaagaaaaggctGACTCTGATATGGATG
AAGAAAGTGACGAAGAAGAGGCTCAACCACCCGCTTTCAAACCACCTATG
ATGCCACCCCCGCCAAGTGGTCCTGTTCATATTCGAAAATATGATCCGAA
AGCTTCCAAACAACCACAACCCACACCCGGTGGTGTGCCTGAGAAGTATT
TGATTTCACCGTTGACGGGTGAGAAGATCCCGGTTGGCTCGATGGAATCT
CACATGAAGATTGCATTGCTCGATCCACGATGGAAAGAACAGAAGGAGAA
AGCCATCGAAGAGAAGCGACAACAAGAACAAGTCTTTGCTGAGGGTGTTC
ATATTGGTGATACTTTGAAACAACTTGCGGAAAGGCGTTCCGATATTTTC
GGAGTCGCTGCAGAGGAGACGCTGATTGGTCGAAAATTGGGGGAAGAGGA
GGAACAGGCGTTGAAAAAGACTCCAAAAGAAGTTTGGGACGGTCATACTG
CAAGTATCGAGCGAACGACCAAGATGGCGCACTCCAACATTACTTACGAA
GACCAAATTAAGGCAATCCATAAAGCCAAAGGTCTACTGCCATCGGAAGA
CGCTGAGCGTATTGGTCCATCGATGAAGCAACCACCGCCTAGACCTGGTC
CGCCACCACCACGACCAATGCCACCACGCCCTACTCCTCCTTCTCGGCCA
ATGGACGACACTCCCGCTCCTATTGTCACTATCCGATCTGGTGATGGTCC
AGGCCCGTCTAAAAACAATCCTCAAGCACCCAAACCACTTATGGGTGCAC
CACCCATGGAGCCGCCTCGCAACATGCCACCACCTGTCAACATGCCTCCT
CGCCCACCACAGAACCCGATGATGCGCCCACCTCCCATGATGAGACCTCC
AGGACCAGGAGACATGGGTATGATGCAACCACCTCCTCTCATGCCCCCAC
CTCCCGGTATGATGATGCCACCACCCCCAGGAGGTATGATGCCTCCACCA
CCGGGTGGAATGATGCCGCCCAGACCACCTCAAATGGATGACCCAGGTAT
GCGAGGTCCTCCACCACAAAATATGGATGATGATGAACCGGCTTCGAAGA
GAGCCAAATTCGATGAGTCCGACCTCATCCCTGAGGACGCTTTCATGCGA
CAAAATGCACCAAACGTCACGTTCCGCGTACAAGTTCCGGATCTACCCGA
CAAATCTGACTGGCAGTGTCAAGGACAAACTCTTTCCATCAGTGCCATGT
TGTCTGAATCGTGTGCATCGATCAAAGCAAAGGTCAACGCAATGATCGGA
ATGCCTGCTGGCAAACAGAAACTGCAACTTGGATCGTTATTCGTGAAGGA
CTCGAACACATTGGCATTTTATAATTTCACATCATCAAGTTTGGTACAAC
TGCAAGTCAAGGAAAGAGGTGGTCGTAAAAAATagATGGGACCTGCGGTG
CCCATTGAACAAGTTCAAACAGAAACTTCAGAAGATGGAAAGATCTATGA
GAGATCACAACAAGATGGTGAAATGTATTCTAAACCTACGGTTGGTATTA
TTTATCCACCGCCTGAAGTCAGAAATATTGTTGACAGGACTGCAAACTTT
GTAGCTAGAAATGGTCCTGAATTTGAGGAAAGGATCCGTGGAAATGAAGC
TGATAATCCAAAGTTCAATTTCTTGAACCCTAATGACCCTTACCATGCAT
ATTATGCTCACAAGTTAAAAGAATACAGAGAAACTGATATTGCAGATCTG
CCGTCACTAAACGAAAAGGAACCACAAAAAGCACCTCAAACTCAAACAAA
GAAACAAGCTCCACAAGTTATAGAAACGATCATTCCAAAAGATCCGCCAC
CAGCGTATGAATTCACGGCAGATCCACCCACCATTTCTGCTCTTGATTTG
GACATTGTCAAACTAACTGCTCAGTTCGTTGCGAAAAATGGAAAAGGTTT
TCTGACCAATCTAATGACAAGAGAACAGAGGAATTATCAGTTTGATTTTT
TGAGACCACAACACAGTTTATTCCAATATTTCACCCGTTTAGTTGAACAA
TATACTAAGGTATTACTACCACCTGGGGATATCACACAGAAATTGCAAAA
AGACTTAAGTGACCAATGGAAGGTATTAGATACAGTAAAATATCGTGTAG
AATGGCAACAATATCAGGATCGTGAAAAACGGAaagttgaagatgaaaaa
gaaagagagagaaTTGCATTCGCATCTATCGATTGGCATGATTTCGTTGT
CGTGGAAACGGTCAATTTCAATGAAGAAGAAACAGCCAATCTTCCACCTC
CTGTGAAGAAAGATCAACTAGGAGCAAGAATGTTACAAGAAGAACGTATT
GAAAAACTGAAGGCCACGGGTGAGGACGCGGAACAAGTTGAAATGGACGT
ggaagaggaagaagaagaactGTATCAGCCTTATCAACAAgagcaagaaa
aagaaaaggctGACTCTGATATGGATGAAGAAAGTGACGAAGAAGAGGCT
CAACCACCCGCTTTCAAACCACCTATGATGCCACCCCCGCCAAGTGGTCC
TGTTCATATTCGAAAATATGATCCGAAAGCTTCCAAACAACCACAACCCA
CACCCGGTGGTGTGCCTGAGAAGTATTTGATTTCACCGTTGACGGGTGAG
AAGATCCCGGTTGGCTCGATGGAATCTCACATGAAGATTGCATTGCTCGA
TCCACGATGGAAAGAACAGAAGGAGAAAGCCATCGAAGAGAAGCGACAAC
AAGAACAAGTCTTTGCTGAGGGTGTTCATATTGGTGATACTTTGAAACAA
CTTGCGGAAAGGCGTTCCGATATTTTCGGAGTCGCTGCAGAGGAGACGCT
GATTGGTCGAAAATTGGGGGAAGAGGAGGAACAGGCGTTGAAAAAGACTC
CAAAAGAAGTTTGGGACGGTCATACTGCAAGTATCGAGCGAACGACCAAG
ATGGCGCACTCCAACATTACTTACGAAGACCAAATTAAGGCAATCCATAA
AGCCAAAGGTCTACTGCCATCGGAAGACGCTGAGCGTATTGGTCCATCGA
TGAAGCAACCACCGCCTAGACCTGGTCCGCCACCACCACGACCAATGCCA
CCACGCCCTACTCCTCCTTCTCGGCCAATGGACGACACTCCCGCTCCTAT
TGTCACTATCCGATCTGGTGATGGTCCAGGCCCGTCTAAAAACAATCCTC
AAGCACCCAAACCACTTATGGGTGCACCACCCATGGAGCCGCCTCGCAAC
ATGCCACCACCTGTCAACATGCCTCCTCGCCCACCACAGAACCCGATGAT
GCGCCCACCTCCCATGATGAGACCTCCAGGACCAGGAGACATGGGTATGA
TGCAACCACCTCCTCTCATGCCCCCACCTCCCGGTATGATGATGCCACCA
CCCCCAGGAGGTATGATGCCTCCACCACCGGGTGGAATGATGCCGCCCAG
ACCACCTCAAATGGATGACCCAGGTATGCGAGGTCCTCCACCACAAAATA
TGGATGATGATGAACCGGCTTCGAAGAGAGCCAAATTCGATGAGTCCGAC
CTCATCCCTGAGGACGCTTTCATGCGACAAAATGCACCAAACGTCACGTT
CCGCGTACAAGTTCCGGATCTACCCGACAAATCTGACTGGCAGTGTCAAG
GACAAACTCTTTCCATCAGTGCCATGTTGTCTGAATCGTGTGCATCGATC
AAAGCAAAGGTCAACGCAATGATCGGAATGCCTGCTGGCAAACAGAAACT
GCAACTTGGATCGTTATTCGTGAAGGACTCGAACACATTGGCATTTTATA
ATTTCACATCATCAAGTTTGGTACAACTGCAAGTCAAGGAAAGAGGTGGT
CGTAAAAAATagATGGGACCTGCGGTGCCCATTGAACAAGTTCAAACAGA
AACTTCAGAAGATGGAAAGATCTATGAGAGATCACAACAAGATGGTGAAA
TGTATTCTAAACCTACGGTTGGTATTATTTATCCACCGCCTGAAGTCAGA
AATATTGTTGACAGGACTGCAAACTTTGTAGCTAGAAATGGTCCTGAATT
TGAGGAAAGGATCCGTGGAAATGAAGCTGATAATCCAAAGTTCAATTTCT
TGAACCCTAATGACCCTTACCATGCATATTATGCTCACAAGTTAAAAGAA
TACAGAGAAACTGATATTGCAGATCTGCCGTCACTAAACGAAAAGGAACC
ACAAAAAGCACCTCAAACTCAAACAAAGAAACAAGCTCCACAAGTTATAG
AAACGATCATTCCAAAAGATCCGCCACCAGCGTATGAATTCACGGCAGAT
CCACCCACCATTTCTGCTCTTGATTTGGACATTGTCAAACTAACTGCTCA
GTTCGTTGCGAAAAATGGAAAAGGTTTTCTGACCAATCTAATGACAAGAG
AACAGAGGAATTATCAGTTTGATTTTTTGAGACCACAACACAGTTTATTC
CAATATTTCACCCGTTTAGTTGAACAATATACTAAGGTATTACTACCACC
TGGGGATATCACACAGAAATTGCAAAAAGACTTAAGTGACCAATGGAAGG
TATTAGATACAGTAAAATATCGTGTAGAATGGCAACAATATCAGGATCGT
GAAAAACGGAaagttgaagatgaaaaagaaagagagagaaTTGCATTCGC
ATCTATCGATTGGCATGATTTCGTTGTCGTGGAAACGGTCAATTTCAATG
AAGAAGAAACAGCCAATCTTCCACCTCCTGTGAAGAAAGATCAACTAGGA
GCAAGAATGTTACAAGAAGAACGTATTGAAAAACTGAAGGCCACGGGTGA
GGACGCGGAACAAGTTGAAATGGACGTggaagaggaagaagaagaactGT
ATCAGCCTTATCAACAAgagcaagaaaaagaaaaggctGACTCTGATATG
GATGAAGAAAGTGACGAAGAAGAGGCTCAACCACCCGCTTTCAAACCACC
TATGATGCCACCCCCGCCAAGTGGTCCTGTTCATATTCGAAAATATGATC
CGAAAGCTTCCAAACAACCACAACCCACACCCGGTGGTGTGCCTGAGAAG
TATTTGATTTCACCGTTGACGGGTGAGAAGATCCCGGTTGGCTCGATGGA
ATCTCACATGAAGATTGCATTGCTCGATCCACGATGGAAAGAACAGAAGG
AGAAAGCCATCGAAGAGAAGCGACAACAAGAACAAGTCTTTGCTGAGGGT
GTTCATATTGGTGATACTTTGAAACAACTTGCGGAAAGGCGTTCCGATAT
TTTCGGAGTCGCTGCAGAGGAGACGCTGATTGGTCGAAAATTGGGGGAAG
AGGAGGAACAGGCGTTGAAAAAGACTCCAAAAGAAGTTTGGGACGGTCAT
ACTGCAAGTATCGAGCGAACGACCAAGATGGCGCACTCCAACATTACTTA
CGAAGACCAAATTAAGGCAATCCATAAAGCCAAAGGTCTACTGCCATCGG
AAGACGCTGAGCGTATTGGTCCATCGATGAAGCAACCACCGCCTAGACCT
GGTCCGCCACCACCACGACCAATGCCACCACGCCCTACTCCTCCTTCTCG
GCCAATGGACGACACTCCCGCTCCTATTGTCACTATCCGATCTGGTGATG
GTCCAGGCCCGTCTAAAAACAATCCTCAAGCACCCAAACCACTTATGGGT
GCACCACCCATGGAGCCGCCTCGCAACATGCCACCACCTGTCAACATGCC
TCCTCGCCCACCACAGAACCCGATGATGCGCCCACCTCCCATGATGAGAC
CTCCAGGACCAGGAGACATGGGTATGATGCAACCACCTCCTCTCATGCCC
CCACCTCCCGGTATGATGATGCCACCACCCCCAGGAGGTATGATGCCTCC
ACCACCGGGTGGAATGATGCCGCCCAGACCACCTCAAATGGATGACCCAG
GTATGCGAGGTCCTCCACCACAAAATATGGATGATGATGAACCGGCTTCG
AAGAGAGCCAAATTCGATGAGTCCGACCTCATCCCTGAGGACGCTTTCAT
GCGACAAAATGCACCAAACGTCACGTTCCGCGTACAAGTTCCGGATCTAC
CCGACAAATCTGACTGGCAGTGTCAAGGACAAACTCTTTCCATCAGTGCC
ATGTTGTCTGAATCGTGTGCATCGATCAAAGCAAAGGTCAACGCAATGAT
CGGAATGCCTGCTGGCAAACAGAAACTGCAACTTGGATCGTTATTCGTGA
AGGACTCGAACACATTGGCATTTTATAATTTCACATCATCAAGTTTGGTA
CAACTGCAAGTCAAGGAAAGAGGTGGTCGTAAAAAATagATGGGACCTGC
GGTGCCCATTGAACAAGTTCAAACAGAAACTTCAGAAGATGGAAAGATCT
ATGAGAGATCACAACAAGATGGTGAAATGTATTCTAAACCTACGGTTGGT
ATTATTTATCCACCGCCTGAAGTCAGAAATATTGTTGACAGGACTGCAAA
CTTTGTAGCTAGAAATGGTCCTGAATTTGAGGAAAGGATCCGTGGAAATG
AAGCTGATAATCCAAAGTTCAATTTCTTGAACCCTAATGACCCTTACCAT
GCATATTATGCTCACAAGTTAAAAGAATACAGAGAAACTGATATTGCAGA
TCTGCCGTCACTAAACGAAAAGGAACCACAAAAAGCACCTCAAACTCAAA
CAAAGAAACAAGCTCCACAAGTTATAGAAACGATCATTCCAAAAGATCCG
CCACCAGCGTATGAATTCACGGCAGATCCACCCACCATTTCTGCTCTTGA
TTTGGACATTGTCAAACTAACTGCTCAGTTCGTTGCGAAAAATGGAAAAG
GTTTTCTGACCAATCTAATGACAAGAGAACAGAGGAATTATCAGTTTGAT
TTTTTGAGACCACAACACAGTTTATTCCAATATTTCACCCGTTTAGTTGA
ACAATATACTAAGGTATTACTACCACCTGGGGATATCACACAGAAATTGC
AAAAAGACTTAAGTGACCAATGGAAGGTATTAGATACAGTAAAATATCGT
GTAGAATGGCAACAATATCAGGATCGTGAAAAACGGAaagttgaagatga
aaaagaaagagagagaaTTGCATTCGCATCTATCGATTGGCATGATTTCG
TTGTCGTGGAAACGGTCAATTTCAATGAAGAAGAAACAGCCAATCTTCCA
CCTCCTGTGAAGAAAGATCAACTAGGAGCAAGAATGTTACAAGAAGAACG
TATTGAAAAACTGAAGGCCACGGGTGAGGACGCGGAACAAGTTGAAATGG
ACGTggaagaggaagaagaagaactGTATCAGCCTTATCAACAAgagcaa
gaaaaagaaaaggctGACTCTGATATGGATGAAGAAAGTGACGAAGAAGA
GGCTCAACCACCCGCTTTCAAACCACCTATGATGCCACCCCCGCCAAGTG
GTCCTGTTCATATTCGAAAATATGATCCGAAAGCTTCCAAACAACCACAA
CCCACACCCGGTGGTGTGCCTGAGAAGTATTTGATTTCACCGTTGACGGG
TGAGAAGATCCCGGTTGGCTCGATGGAATCTCACATGAAGATTGCATTGC
TCGATCCACGATGGAAAGAACAGAAGGAGAAAGCCATCGAAGAGAAGCGA
CAACAAGAACAAGTCTTTGCTGAGGGTGTTCATATTGGTGATACTTTGAA
ACAACTTGCGGAAAGGCGTTCCGATATTTTCGGAGTCGCTGCAGAGGAGA
CGCTGATTGGTCGAAAATTGGGGGAAGAGGAGGAACAGGCGTTGAAAAAG
ACTCCAAAAGAAGTTTGGGACGGTCATACTGCAAGTATCGAGCGAACGAC
CAAGATGGCGCACTCCAACATTACTTACGAAGACCAAATTAAGGCAATCC
ATAAAGCCAAAGGTCTACTGCCATCGGAAGACGCTGAGCGTATTGGTCCA
TCGATGAAGCAACCACCGCCTAGACCTGGTCCGCCACCACCACGACCAAT
GCCACCACGCCCTACTCCTCCTTCTCGGCCAATGGACGACACTCCCGCTC
CTATTGTCACTATCCGATCTGGTGATGGTCCAGGCCCGTCTAAAAACAAT
CCTCAAGCACCCAAACCACTTATGGGTGCACCACCCATGGAGCCGCCTCG
CAACATGCCACCACCTGTCAACATGCCTCCTCGCCCACCACAGAACCCGA
TGATGCGCCCACCTCCCATGATGAGACCTCCAGGACCAGGAGACATGGGT
ATGATGCAACCACCTCCTCTCATGCCCCCACCTCCCGGTATGATGATGCC
ACCACCCCCAGGAGGTATGATGCCTCCACCACCGGGTGGAATGATGCCGC
CCAGACCACCTCAAATGGATGACCCAGGTATGCGAGGTCCTCCACCACAA
AATATGGATGATGATGAACCGGCTTCGAAGAGAGCCAAATTCGATGAGTC
CGACCTCATCCCTGAGGACGCTTTCATGCGACAAAATGCACCAAACGTCA
CGTTCCGCGTACAAGTTCCGGATCTACCCGACAAATCTGACTGGCAGTGT
CAAGGACAAACTCTTTCCATCAGTGCCATGTTGTCTGAATCGTGTGCATC
GATCAAAGCAAAGGTCAACGCAATGATCGGAATGCCTGCTGGCAAACAGA
AACTGCAACTTGGATCGTTATTCGTGAAGGACTCGAACACATTGGCATTT
TATAATTTCACATCATCAAGTTTGGTACAACTGCAAGTCAAGGAAAGAGG
TGGTCGTAAAAAATagATGGGACCTGCGGTGCCCATTGAACAAGTTCAAA
CAGAAACTTCAGAAGATGGAAAGATCTATGAGAGATCACAACAAGATGGT
GAAATGTATTCTAAACCTACGGTTGGTATTATTTATCCACCGCCTGAAGT
CAGAAATATTGTTGACAGGACTGCAAACTTTGTAGCTAGAAATGGTCCTG
AATTTGAGGAAAGGATCCGTGGAAATGAAGCTGATAATCCAAAGTTCAAT
TTCTTGAACCCTAATGACCCTTACCATGCATATTATGCTCACAAGTTAAA
AGAATACAGAGAAACTGATATTGCAGATCTGCCGTCACTAAACGAAAAGG
AACCACAAAAAGCACCTCAAACTCAAACAAAGAAACAAGCTCCACAAGTT
ATAGAAACGATCATTCCAAAAGATCCGCCACCAGCGTATGAATTCACGGC
AGATCCACCCACCATTTCTGCTCTTGATTTGGACATTGTCAAACTAACTG
CTCAGTTCGTTGCGAAAAATGGAAAAGGTTTTCTGACCAATCTAATGACA
AGAGAACAGAGGAATTATCAGTTTGATTTTTTGAGACCACAACACAGTTT
ATTCCAATATTTCACCCGTTTAGTTGAACAATATACTAAGGTATTACTAC
CACCTGGGGATATCACACAGAAATTGCAAAAAGACTTAAGTGACCAATGG
AAGGTATTAGATACAGTAAAATATCGTGTAGAATGGCAACAATATCAGGA
TCGTGAAAAACGGAaagttgaagatgaaaaagaaagagagagaaTTGCAT
TCGCATCTATCGATTGGCATGATTTCGTTGTCGTGGAAACGGTCAATTTC
AATGAAGAAGAAACAGCCAATCTTCCACCTCCTGTGAAGAAAGATCAACT
AGGAGCAAGAATGTTACAAGAAGAACGTATTGAAAAACTGAAGGCCACGG
GTGAGGACGCGGAACAAGTTGAAATGGACGTggaagaggaagaagaagaa
ctGTATCAGCCTTATCAACAAgagcaagaaaaagaaaaggctGACTCTGA
TATGGATGAAGAAAGTGACGAAGAAGAGGCTCAACCACCCGCTTTCAAAC
CACCTATGATGCCACCCCCGCCAAGTGGTCCTGTTCATATTCGAAAATAT
GATCCGAAAGCTTCCAAACAACCACAACCCACACCCGGTGGTGTGCCTGA
GAAGTATTTGATTTCACCGTTGACGGGTGAGAAGATCCCGGTTGGCTCGA
TGGAATCTCACATGAAGATTGCATTGCTCGATCCACGATGGAAAGAACAG
AAGGAGAAAGCCATCGAAGAGAAGCGACAACAAGAACAAGTCTTTGCTGA
GGGTGTTCATATTGGTGATACTTTGAAACAACTTGCGGAAAGGCGTTCCG
ATATTTTCGGAGTCGCTGCAGAGGAGACGCTGATTGGTCGAAAATTGGGG
GAAGAGGAGGAACAGGCGTTGAAAAAGACTCCAAAAGAAGTTTGGGACGG
TCATACTGCAAGTATCGAGCGAACGACCAAGATGGCGCACTCCAACATTA
CTTACGAAGACCAAATTAAGGCAATCCATAAAGCCAAAGGTCTACTGCCA
TCGGAAGACGCTGAGCGTATTGGTCCATCGATGAAGCAACCACCGCCTAG
ACCTGGTCCGCCACCACCACGACCAATGCCACCACGCCCTACTCCTCCTT
CTCGGCCAATGGACGACACTCCCGCTCCTATTGTCACTATCCGATCTGGT
GATGGTCCAGGCCCGTCTAAAAACAATCCTCAAGCACCCAAACCACTTAT
GGGTGCACCACCCATGGAGCCGCCTCGCAACATGCCACCACCTGTCAACA
TGCCTCCTCGCCCACCACAGAACCCGATGATGCGCCCACCTCCCATGATG
AGACCTCCAGGACCAGGAGACATGGGTATGATGCAACCACCTCCTCTCAT
GCCCCCACCTCCCGGTATGATGATGCCACCACCCCCAGGAGGTATGATGC
CTCCACCACCGGGTGGAATGATGCCGCCCAGACCACCTCAAATGGATGAC
CCAGGTATGCGAGGTCCTCCACCACAAAATATGGATGATGATGAACCGGC
TTCGAAGAGAGCCAAATTCGATGAGTCCGACCTCATCCCTGAGGACGCTT
TCATGCGACAAAATGCACCAAACGTCACGTTCCGCGTACAAGTTCCGGAT
CTACCCGACAAATCTGACTGGCAGTGTCAAGGACAAACTCTTTCCATCAG
TGCCATGTTGTCTGAATCGTGTGCATCGATCAAAGCAAAGGTCAACGCAA
TGATCGGAATGCCTGCTGGCAAACAGAAACTGCAACTTGGATCGTTATTC
GTGAAGGACTCGAACACATTGGCATTTTATAATTTCACATCATCAAGTTT
GGTACAACTGCAAGTCAAGGAAAGAGGTGGTCGTAAAAAATagATGGGAC
CTGCGGTGCCCATTGAACAAGTTCAAACAGAAACTTCAGAAGATGGAAAG
ATCTATGAGAGATCACAACAAGATGGTGAAATGTATTCTAAACCTACGGT
TGGTATTATTTATCCACCGCCTGAAGTCAGAAATATTGTTGACAGGACTG
CAAACTTTGTAGCTAGAAATGGTCCTGAATTTGAGGAAAGGATCCGTGGA
AATGAAGCTGATAATCCAAAGTTCAATTTCTTGAACCCTAATGACCCTTA
CCATGCATATTATGCTCACAAGTTAAAAGAATACAGAGAAACTGATATTG
CAGATCTGCCGTCACTAAACGAAAAGGAACCACAAAAAGCACCTCAAACT
CAAACAAAGAAACAAGCTCCACAAGTTATAGAAACGATCATTCCAAAAGA
TCCGCCACCAGCGTATGAATTCACGGCAGATCCACCCACCATTTCTGCTC
TTGATTTGGACATTGTCAAACTAACTGCTCAGTTCGTTGCGAAAAATGGA
AAAGGTTTTCTGACCAATCTAATGACAAGAGAACAGAGGAATTATCAGTT
TGATTTTTTGAGACCACAACACAGTTTATTCCAATATTTCACCCGTTTAG
TTGAACAATATACTAAGGTATTACTACCACCTGGGGATATCACACAGAAA
TTGCAAAAAGACTTAAGTGACCAATGGAAGGTATTAGATACAGTAAAATA
TCGTGTAGAATGGCAACAATATCAGGATCGTGAAAAACGGAaagttgaag
atgaaaaagaaagagagagaaTTGCATTCGCATCTATCGATTGGCATGAT
TTCGTTGTCGTGGAAACGGTCAATTTCAATGAAGAAGAAACAGCCAATCT
TCCACCTCCTGTGAAGAAAGATCAACTAGGAGCAAGAATGTTACAAGAAG
AACGTATTGAAAAACTGAAGGCCACGGGTGAGGACGCGGAACAAGTTGAA
ATGGACGTggaagaggaagaagaagaactGTATCAGCCTTATCAACAAga
gcaagaaaaagaaaaggctGACTCTGATATGGATGAAGAAAGTGACGAAG
AAGAGGCTCAACCACCCGCTTTCAAACCACCTATGATGCCACCCCCGCCA
AGTGGTCCTGTTCATATTCGAAAATATGATCCGAAAGCTTCCAAACAACC
ACAACCCACACCCGGTGGTGTGCCTGAGAAGTATTTGATTTCACCGTTGA
CGGGTGAGAAGATCCCGGTTGGCTCGATGGAATCTCACATGAAGATTGCA
TTGCTCGATCCACGATGGAAAGAACAGAAGGAGAAAGCCATCGAAGAGAA
GCGACAACAAGAACAAGTCTTTGCTGAGGGTGTTCATATTGGTGATACTT
TGAAACAACTTGCGGAAAGGCGTTCCGATATTTTCGGAGTCGCTGCAGAG
GAGACGCTGATTGGTCGAAAATTGGGGGAAGAGGAGGAACAGGCGTTGAA
AAAGACTCCAAAAGAAGTTTGGGACGGTCATACTGCAAGTATCGAGCGAA
CGACCAAGATGGCGCACTCCAACATTACTTACGAAGACCAAATTAAGGCA
ATCCATAAAGCCAAAGGTCTACTGCCATCGGAAGACGCTGAGCGTATTGG
TCCATCGATGAAGCAACCACCGCCTAGACCTGGTCCGCCACCACCACGAC
CAATGCCACCACGCCCTACTCCTCCTTCTCGGCCAATGGACGACACTCCC
GCTCCTATTGTCACTATCCGATCTGGTGATGGTCCAGGCCCGTCTAAAAA
CAATCCTCAAGCACCCAAACCACTTATGGGTGCACCACCCATGGAGCCGC
CTCGCAACATGCCACCACCTGTCAACATGCCTCCTCGCCCACCACAGAAC
CCGATGATGCGCCCACCTCCCATGATGAGACCTCCAGGACCAGGAGACAT
GGGTATGATGCAACCACCTCCTCTCATGCCCCCACCTCCCGGTATGATGA
TGCCACCACCCCCAGGAGGTATGATGCCTCCACCACCGGGTGGAATGATG
CCGCCCAGACCACCTCAAATGGATGACCCAGGTATGCGAGGTCCTCCACC
ACAAAATATGGATGATGATGAACCGGCTTCGAAGAGAGCCAAATTCGATG
AGTCCGACCTCATCCCTGAGGACGCTTTCATGCGACAAAATGCACCAAAC
GTCACGTTCCGCGTACAAGTTCCGGATCTACCCGACAAATCTGACTGGCA
GTGTCAAGGACAAACTCTTTCCATCAGTGCCATGTTGTCTGAATCGTGTG
CATCGATCAAAGCAAAGGTCAACGCAATGATCGGAATGCCTGCTGGCAAA
CAGAAACTGCAACTTGGATCGTTATTCGTGAAGGACTCGAACACATTGGC
ATTTTATAATTTCACATCATCAAGTTTGGTACAACTGCAAGTCAAGGAAA
GAGGTGGTCGTAAAAAATagATGGGACCTGCGGTGCCCATTGAACAAGTT
CAAACAGAAACTTCAGAAGATGGAAAGATCTATGAGAGATCACAACAAGA
TGGTGAAATGTATTCTAAACCTACGGTTGGTATTATTTATCCACCGCCTG
AAGTCAGAAATATTGTTGACAGGACTGCAAACTTTGTAGCTAGAAATGGT
CCTGAATTTGAGGAAAGGATCCGTGGAAATGAAGCTGATAATCCAAAGTT
CAATTTCTTGAACCCTAATGACCCTTACCATGCATATTATGCTCACAAGT
TAAAAGAATACAGAGAAACTGATATTGCAGATCTGCCGTCACTAAACGAA
AAGGAACCACAAAAAGCACCTCAAACTCAAACAAAGAAACAAGCTCCACA
AGTTATAGAAACGATCATTCCAAAAGATCCGCCACCAGCGTATGAATTCA
CGGCAGATCCACCCACCATTTCTGCTCTTGATTTGGACATTGTCAAACTA
ACTGCTCAGTTCGTTGCGAAAAATGGAAAAGGTTTTCTGACCAATCTAAT
GACAAGAGAACAGAGGAATTATCAGTTTGATTTTTTGAGACCACAACACA
GTTTATTCCAATATTTCACCCGTTTAGTTGAACAATATACTAAGGTATTA
CTACCACCTGGGGATATCACACAGAAATTGCAAAAAGACTTAAGTGACCA
ATGGAAGGTATTAGATACAGTAAAATATCGTGTAGAATGGCAACAATATC
AGGATCGTGAAAAACGGAaagttgaagatgaaaaagaaagagagagaaTT
GCATTCGCATCTATCGATTGGCATGATTTCGTTGTCGTGGAAACGGTCAA
TTTCAATGAAGAAGAAACAGCCAATCTTCCACCTCCTGTGAAGAAAGATC
AACTAGGAGCAAGAATGTTACAAGAAGAACGTATTGAAAAACTGAAGGCC
ACGGGTGAGGACGCGGAACAAGTTGAAATGGACGTggaagaggaagaaga
agaactGTATCAGCCTTATCAACAAgagcaagaaaaagaaaaggctGACT
CTGATATGGATGAAGAAAGTGACGAAGAAGAGGCTCAACCACCCGCTTTC
AAACCACCTATGATGCCACCCCCGCCAAGTGGTCCTGTTCATATTCGAAA
ATATGATCCGAAAGCTTCCAAACAACCACAACCCACACCCGGTGGTGTGC
CTGAGAAGTATTTGATTTCACCGTTGACGGGTGAGAAGATCCCGGTTGGC
TCGATGGAATCTCACATGAAGATTGCATTGCTCGATCCACGATGGAAAGA
ACAGAAGGAGAAAGCCATCGAAGAGAAGCGACAACAAGAACAAGTCTTTG
CTGAGGGTGTTCATATTGGTGATACTTTGAAACAACTTGCGGAAAGGCGT
TCCGATATTTTCGGAGTCGCTGCAGAGGAGACGCTGATTGGTCGAAAATT
GGGGGAAGAGGAGGAACAGGCGTTGAAAAAGACTCCAAAAGAAGTTTGGG
ACGGTCATACTGCAAGTATCGAGCGAACGACCAAGATGGCGCACTCCAAC
ATTACTTACGAAGACCAAATTAAGGCAATCCATAAAGCCAAAGGTCTACT
GCCATCGGAAGACGCTGAGCGTATTGGTCCATCGATGAAGCAACCACCGC
CTAGACCTGGTCCGCCACCACCACGACCAATGCCACCACGCCCTACTCCT
CCTTCTCGGCCAATGGACGACACTCCCGCTCCTATTGTCACTATCCGATC
TGGTGATGGTCCAGGCCCGTCTAAAAACAATCCTCAAGCACCCAAACCAC
TTATGGGTGCACCACCCATGGAGCCGCCTCGCAACATGCCACCACCTGTC
AACATGCCTCCTCGCCCACCACAGAACCCGATGATGCGCCCACCTCCCAT
GATGAGACCTCCAGGACCAGGAGACATGGGTATGATGCAACCACCTCCTC
TCATGCCCCCACCTCCCGGTATGATGATGCCACCACCCCCAGGAGGTATG
ATGCCTCCACCACCGGGTGGAATGATGCCGCCCAGACCACCTCAAATGGA
TGACCCAGGTATGCGAGGTCCTCCACCACAAAATATGGATGATGATGAAC
CGGCTTCGAAGAGAGCCAAATTCGATGAGTCCGACCTCATCCCTGAGGAC
GCTTTCATGCGACAAAATGCACCAAACGTCACGTTCCGCGTACAAGTTCC
GGATCTACCCGACAAATCTGACTGGCAGTGTCAAGGACAAACTCTTTCCA
TCAGTGCCATGTTGTCTGAATCGTGTGCATCGATCAAAGCAAAGGTCAAC
GCAATGATCGGAATGCCTGCTGGCAAACAGAAACTGCAACTTGGATCGTT
ATTCGTGAAGGACTCGAACACATTGGCATTTTATAATTTCACATCATCAA
GTTTGGTACAACTGCAAGTCAAGGAAAGAGGTGGTCGTAAAAAATagATG
GGACCTGCGGTGCCCATTGAACAAGTTCAAACAGAAACTTCAGAAGATGG
AAAGATCTATGAGAGATCACAACAAGATGGTGAAATGTATTCTAAACCTA
CGGTTGGTATTATTTATCCACCGCCTGAAGTCAGAAATATTGTTGACAGG
ACTGCAAACTTTGTAGCTAGAAATGGTCCTGAATTTGAGGAAAGGATCCG
TGGAAATGAAGCTGATAATCCAAAGTTCAATTTCTTGAACCCTAATGACC
CTTACCATGCATATTATGCTCACAAGTTAAAAGAATACAGAGAAACTGAT
ATTGCAGATCTGCCGTCACTAAACGAAAAGGAACCACAAAAAGCACCTCA
AACTCAAACAAAGAAACAAGCTCCACAAGTTATAGAAACGATCATTCCAA
AAGATCCGCCACCAGCGTATGAATTCACGGCAGATCCACCCACCATTTCT
GCTCTTGATTTGGACATTGTCAAACTAACTGCTCAGTTCGTTGCGAAAAA
TGGAAAAGGTTTTCTGACCAATCTAATGACAAGAGAACAGAGGAATTATC
AGTTTGATTTTTTGAGACCACAACACAGTTTATTCCAATATTTCACCCGT
TTAGTTGAACAATATACTAAGGTATTACTACCACCTGGGGATATCACACA
GAAATTGCAAAAAGACTTAAGTGACCAATGGAAGGTATTAGATACAGTAA
AATATCGTGTAGAATGGCAACAATATCAGGATCGTGAAAAACGGAaagtt
gaagatgaaaaagaaagagagagaaTTGCATTCGCATCTATCGATTGGCA
TGATTTCGTTGTCGTGGAAACGGTCAATTTCAATGAAGAAGAAACAGCCA
ATCTTCCACCTCCTGTGAAGAAAGATCAACTAGGAGCAAGAATGTTACAA
GAAGAACGTATTGAAAAACTGAAGGCCACGGGTGAGGACGCGGAACAAGT
TGAAATGGACGTggaagaggaagaagaagaactGTATCAGCCTTATCAAC
AAgagcaagaaaaagaaaaggctGACTCTGATATGGATGAAGAAAGTGAC
GAAGAAGAGGCTCAACCACCCGCTTTCAAACCACCTATGATGCCACCCCC
GCCAAGTGGTCCTGTTCATATTCGAAAATATGATCCGAAAGCTTCCAAAC
AACCACAACCCACACCCGGTGGTGTGCCTGAGAAGTATTTGATTTCACCG
TTGACGGGTGAGAAGATCCCGGTTGGCTCGATGGAATCTCACATGAAGAT
TGCATTGCTCGATCCACGATGGAAAGAACAGAAGGAGAAAGCCATCGAAG
AGAAGCGACAACAAGAACAAGTCTTTGCTGAGGGTGTTCATATTGGTGAT
ACTTTGAAACAACTTGCGGAAAGGCGTTCCGATATTTTCGGAGTCGCTGC
AGAGGAGACGCTGATTGGTCGAAAATTGGGGGAAGAGGAGGAACAGGCGT
TGAAAAAGACTCCAAAAGAAGTTTGGGACGGTCATACTGCAAGTATCGAG
CGAACGACCAAGATGGCGCACTCCAACATTACTTACGAAGACCAAATTAA
GGCAATCCATAAAGCCAAAGGTCTACTGCCATCGGAAGACGCTGAGCGTA
TTGGTCCATCGATGAAGCAACCACCGCCTAGACCTGGTCCGCCACCACCA
CGACCAATGCCACCACGCCCTACTCCTCCTTCTCGGCCAATGGACGACAC
TCCCGCTCCTATTGTCACTATCCGATCTGGTGATGGTCCAGGCCCGTCTA
AAAACAATCCTCAAGCACCCAAACCACTTATGGGTGCACCACCCATGGAG
CCGCCTCGCAACATGCCACCACCTGTCAACATGCCTCCTCGCCCACCACA
GAACCCGATGATGCGCCCACCTCCCATGATGAGACCTCCAGGACCAGGAG
ACATGGGTATGATGCAACCACCTCCTCTCATGCCCCCACCTCCCGGTATG
ATGATGCCACCACCCCCAGGAGGTATGATGCCTCCACCACCGGGTGGAAT
GATGCCGCCCAGACCACCTCAAATGGATGACCCAGGTATGCGAGGTCCTC
CACCACAAAATATGGATGATGATGAACCGGCTTCGAAGAGAGCCAAATTC
GATGAGTCCGACCTCATCCCTGAGGACGCTTTCATGCGACAAAATGCACC
AAACGTCACGTTCCGCGTACAAGTTCCGGATCTACCCGACAAATCTGACT
GGCAGTGTCAAGGACAAACTCTTTCCATCAGTGCCATGTTGTCTGAATCG
TGTGCATCGATCAAAGCAAAGGTCAACGCAATGATCGGAATGCCTGCTGG
CAAACAGAAACTGCAACTTGGATCGTTATTCGTGAAGGACTCGAACACAT
TGGCATTTTATAATTTCACATCATCAAGTTTGGTACAACTGCAAGTCAAG
GAAAGAGGTGGTCGTAAAAAATagATGGGACCTGCGGTGCCCATTGAACA
AGTTCAAACAGAAACTTCAGAAGATGGAAAGATCTATGAGAGATCACAAC
AAGATGGTGAAATGTATTCTAAACCTACGGTTGGTATTATTTATCCACCG
CCTGAAGTCAGAAATATTGTTGACAGGACTGCAAACTTTGTAGCTAGAAA
TGGTCCTGAATTTGAGGAAAGGATCCGTGGAAATGAAGCTGATAATCCAA
AGTTCAATTTCTTGAACCCTAATGACCCTTACCATGCATATTATGCTCAC
AAGTTAAAAGAATACAGAGAAACTGATATTGCAGATCTGCCGTCACTAAA
CGAAAAGGAACCACAAAAAGCACCTCAAACTCAAACAAAGAAACAAGCTC
CACAAGTTATAGAAACGATCATTCCAAAAGATCCGCCACCAGCGTATGAA
TTCACGGCAGATCCACCCACCATTTCTGCTCTTGATTTGGACATTGTCAA
ACTAACTGCTCAGTTCGTTGCGAAAAATGGAAAAGGTTTTCTGACCAATC
TAATGACAAGAGAACAGAGGAATTATCAGTTTGATTTTTTGAGACCACAA
CACAGTTTATTCCAATATTTCACCCGTTTAGTTGAACAATATACTAAGGT
ATTACTACCACCTGGGGATATCACACAGAAATTGCAAAAAGACTTAAGTG
ACCAATGGAAGGTATTAGATACAGTAAAATATCGTGTAGAATGGCAACAA
TATCAGGATCGTGAAAAACGGAaagttgaagatgaaaaagaaagagagag
aaTTGCATTCGCATCTATCGATTGGCATGATTTCGTTGTCGTGGAAACGG
TCAATTTCAATGAAGAAGAAACAGCCAATCTTCCACCTCCTGTGAAGAAA
GATCAACTAGGAGCAAGAATGTTACAAGAAGAACGTATTGAAAAACTGAA
GGCCACGGGTGAGGACGCGGAACAAGTTGAAATGGACGTggaagaggaag
aagaagaactGTATCAGCCTTATCAACAAgagcaagaaaaagaaaaggct
GACTCTGATATGGATGAAGAAAGTGACGAAGAAGAGGCTCAACCACCCGC
TTTCAAACCACCTATGATGCCACCCCCGCCAAGTGGTCCTGTTCATATTC
GAAAATATGATCCGAAAGCTTCCAAACAACCACAACCCACACCCGGTGGT
GTGCCTGAGAAGTATTTGATTTCACCGTTGACGGGTGAGAAGATCCCGGT
TGGCTCGATGGAATCTCACATGAAGATTGCATTGCTCGATCCACGATGGA
AAGAACAGAAGGAGAAAGCCATCGAAGAGAAGCGACAACAAGAACAAGTC
TTTGCTGAGGGTGTTCATATTGGTGATACTTTGAAACAACTTGCGGAAAG
GCGTTCCGATATTTTCGGAGTCGCTGCAGAGGAGACGCTGATTGGTCGAA
AATTGGGGGAAGAGGAGGAACAGGCGTTGAAAAAGACTCCAAAAGAAGTT
TGGGACGGTCATACTGCAAGTATCGAGCGAACGACCAAGATGGCGCACTC
CAACATTACTTACGAAGACCAAATTAAGGCAATCCATAAAGCCAAAGGTC
TACTGCCATCGGAAGACGCTGAGCGTATTGGTCCATCGATGAAGCAACCA
CCGCCTAGACCTGGTCCGCCACCACCACGACCAATGCCACCACGCCCTAC
TCCTCCTTCTCGGCCAATGGACGACACTCCCGCTCCTATTGTCACTATCC
GATCTGGTGATGGTCCAGGCCCGTCTAAAAACAATCCTCAAGCACCCAAA
CCACTTATGGGTGCACCACCCATGGAGCCGCCTCGCAACATGCCACCACC
TGTCAACATGCCTCCTCGCCCACCACAGAACCCGATGATGCGCCCACCTC
CCATGATGAGACCTCCAGGACCAGGAGACATGGGTATGATGCAACCACCT
CCTCTCATGCCCCCACCTCCCGGTATGATGATGCCACCACCCCCAGGAGG
TATGATGCCTCCACCACCGGGTGGAATGATGCCGCCCAGACCACCTCAAA
TGGATGACCCAGGTATGCGAGGTCCTCCACCACAAAATATGGATGATGAT
GAACCGGCTTCGAAGAGAGCCAAATTCGATGAGTCCGACCTCATCCCTGA
GGACGCTTTCATGCGACAAAATGCACCAAACGTCACGTTCCGCGTACAAG
TTCCGGATCTACCCGACAAATCTGACTGGCAGTGTCAAGGACAAACTCTT
TCCATCAGTGCCATGTTGTCTGAATCGTGTGCATCGATCAAAGCAAAGGT
CAACGCAATGATCGGAATGCCTGCTGGCAAACAGAAACTGCAACTTGGAT
CGTTATTCGTGAAGGACTCGAACACATTGGCATTTTATAATTTCACATCA
TCAAGTTTGGTACAACTGCAAGTCAAGGAAAGAGGTGGTCGTAAAAAATa
gATGGGACCTGCGGTGCCCATTGAACAAGTTCAAACAGAAACTTCAGAAG
ATGGAAAGATCTATGAGAGATCACAACAAGATGGTGAAATGTATTCTAAA
CCTACGGTTGGTATTATTTATCCACCGCCTGAAGTCAGAAATATTGTTGA
CAGGACTGCAAACTTTGTAGCTAGAAATGGTCCTGAATTTGAGGAAAGGA
TCCGTGGAAATGAAGCTGATAATCCAAAGTTCAATTTCTTGAACCCTAAT
GACCCTTACCATGCATATTATGCTCACAAGTTAAAAGAATACAGAGAAAC
TGATATTGCAGATCTGCCGTCACTAAACGAAAAGGAACCACAAAAAGCAC
CTCAAACTCAAACAAAGAAACAAGCTCCACAAGTTATAGAAACGATCATT
CCAAAAGATCCGCCACCAGCGTATGAATTCACGGCAGATCCACCCACCAT
TTCTGCTCTTGATTTGGACATTGTCAAACTAACTGCTCAGTTCGTTGCGA
AAAATGGAAAAGGTTTTCTGACCAATCTAATGACAAGAGAACAGAGGAAT
TATCAGTTTGATTTTTTGAGACCACAACACAGTTTATTCCAATATTTCAC
CCGTTTAGTTGAACAATATACTAAGGTATTACTACCACCTGGGGATATCA
CACAGAAATTGCAAAAAGACTTAAGTGACCAATGGAAGGTATTAGATACA
GTAAAATATCGTGTAGAATGGCAACAATATCAGGATCGTGAAAAACGGAa
agttgaagatgaaaaagaaagagagagaaTTGCATTCGCATCTATCGATT
GGCATGATTTCGTTGTCGTGGAAACGGTCAATTTCAATGAAGAAGAAACA
GCCAATCTTCCACCTCCTGTGAAGAAAGATCAACTAGGAGCAAGAATGTT
ACAAGAAGAACGTATTGAAAAACTGAAGGCCACGGGTGAGGACGCGGAAC
AAGTTGAAATGGACGTggaagaggaagaagaagaactGTATCAGCCTTAT
CAACAAgagcaagaaaaagaaaaggctGACTCTGATATGGATGAAGAAAG
TGACGAAGAAGAGGCTCAACCACCCGCTTTCAAACCACCTATGATGCCAC
CCCCGCCAAGTGGTCCTGTTCATATTCGAAAATATGATCCGAAAGCTTCC
AAACAACCACAACCCACACCCGGTGGTGTGCCTGAGAAGTATTTGATTTC
ACCGTTGACGGGTGAGAAGATCCCGGTTGGCTCGATGGAATCTCACATGA
AGATTGCATTGCTCGATCCACGATGGAAAGAACAGAAGGAGAAAGCCATC
GAAGAGAAGCGACAACAAGAACAAGTCTTTGCTGAGGGTGTTCATATTGG
TGATACTTTGAAACAACTTGCGGAAAGGCGTTCCGATATTTTCGGAGTCG
CTGCAGAGGAGACGCTGATTGGTCGAAAATTGGGGGAAGAGGAGGAACAG
GCGTTGAAAAAGACTCCAAAAGAAGTTTGGGACGGTCATACTGCAAGTAT
CGAGCGAACGACCAAGATGGCGCACTCCAACATTACTTACGAAGACCAAA
TTAAGGCAATCCATAAAGCCAAAGGTCTACTGCCATCGGAAGACGCTGAG
CGTATTGGTCCATCGATGAAGCAACCACCGCCTAGACCTGGTCCGCCACC
ACCACGACCAATGCCACCACGCCCTACTCCTCCTTCTCGGCCAATGGACG
ACACTCCCGCTCCTATTGTCACTATCCGATCTGGTGATGGTCCAGGCCCG
TCTAAAAACAATCCTCAAGCACCCAAACCACTTATGGGTGCACCACCCAT
GGAGCCGCCTCGCAACATGCCACCACCTGTCAACATGCCTCCTCGCCCAC
CACAGAACCCGATGATGCGCCCACCTCCCATGATGAGACCTCCAGGACCA
GGAGACATGGGTATGATGCAACCACCTCCTCTCATGCCCCCACCTCCCGG
TATGATGATGCCACCACCCCCAGGAGGTATGATGCCTCCACCACCGGGTG
GAATGATGCCGCCCAGACCACCTCAAATGGATGACCCAGGTATGCGAGGT
CCTCCACCACAAAATATGGATGATGATGAACCGGCTTCGAAGAGAGCCAA
ATTCGATGAGTCCGACCTCATCCCTGAGGACGCTTTCATGCGACAAAATG
CACCAAACGTCACGTTCCGCGTACAAGTTCCGGATCTACCCGACAAATCT
GACTGGCAGTGTCAAGGACAAACTCTTTCCATCAGTGCCATGTTGTCTGA
ATCGTGTGCATCGATCAAAGCAAAGGTCAACGCAATGATCGGAATGCCTG
CTGGCAAACAGAAACTGCAACTTGGATCGTTATTCGTGAAGGACTCGAAC
ACATTGGCATTTTATAATTTCACATCATCAAGTTTGGTACAACTGCAAGT
CAAGGAAAGAGGTGGTCGTAAAAAATagATGGGACCTGCGGTGCCCATTG
AACAAGTTCAAACAGAAACTTCAGAAGATGGAAAGATCTATGAGAGATCA
CAACAAGATGGTGAAATGTATTCTAAACCTACGGTTGGTATTATTTATCC
ACCGCCTGAAGTCAGAAATATTGTTGACAGGACTGCAAACTTTGTAGCTA
GAAATGGTCCTGAATTTGAGGAAAGGATCCGTGGAAATGAAGCTGATAAT
CCAAAGTTCAATTTCTTGAACCCTAATGACCCTTACCATGCATATTATGC
TCACAAGTTAAAAGAATACAGAGAAACTGATATTGCAGATCTGCCGTCAC
TAAACGAAAAGGAACCACAAAAAGCACCTCAAACTCAAACAAAGAAACAA
GCTCCACAAGTTATAGAAACGATCATTCCAAAAGATCCGCCACCAGCGTA
TGAATTCACGGCAGATCCACCCACCATTTCTGCTCTTGATTTGGACATTG
TCAAACTAACTGCTCAGTTCGTTGCGAAAAATGGAAAAGGTTTTCTGACC
AATCTAATGACAAGAGAACAGAGGAATTATCAGTTTGATTTTTTGAGACC
ACAACACAGTTTATTCCAATATTTCACCCGTTTAGTTGAACAATATACTA
AGGTATTACTACCACCTGGGGATATCACACAGAAATTGCAAAAAGACTTA
AGTGACCAATGGAAGGTATTAGATACAGTAAAATATCGTGTAGAATGGCA
ACAATATCAGGATCGTGAAAAACGGAaagttgaagatgaaaaagaaagag
agagaaTTGCATTCGCATCTATCGATTGGCATGATTTCGTTGTCGTGGAA
ACGGTCAATTTCAATGAAGAAGAAACAGCCAATCTTCCACCTCCTGTGAA
GAAAGATCAACTAGGAGCAAGAATGTTACAAGAAGAACGTATTGAAAAAC
TGAAGGCCACGGGTGAGGACGCGGAACAAGTTGAAATGGACGTggaagag
gaagaagaagaactGTATCAGCCTTATCAACAAgagcaagaaaaagaaaa
ggctGACTCTGATATGGATGAAGAAAGTGACGAAGAAGAGGCTCAACCAC
CCGCTTTCAAACCACCTATGATGCCACCCCCGCCAAGTGGTCCTGTTCAT
ATTCGAAAATATGATCCGAAAGCTTCCAAACAACCACAACCCACACCCGG
TGGTGTGCCTGAGAAGTATTTGATTTCACCGTTGACGGGTGAGAAGATCC
CGGTTGGCTCGATGGAATCTCACATGAAGATTGCATTGCTCGATCCACGA
TGGAAAGAACAGAAGGAGAAAGCCATCGAAGAGAAGCGACAACAAGAACA
AGTCTTTGCTGAGGGTGTTCATATTGGTGATACTTTGAAACAACTTGCGG
AAAGGCGTTCCGATATTTTCGGAGTCGCTGCAGAGGAGACGCTGATTGGT
CGAAAATTGGGGGAAGAGGAGGAACAGGCGTTGAAAAAGACTCCAAAAGA
AGTTTGGGACGGTCATACTGCAAGTATCGAGCGAACGACCAAGATGGCGC
ACTCCAACATTACTTACGAAGACCAAATTAAGGCAATCCATAAAGCCAAA
GGTCTACTGCCATCGGAAGACGCTGAGCGTATTGGTCCATCGATGAAGCA
ACCACCGCCTAGACCTGGTCCGCCACCACCACGACCAATGCCACCACGCC
CTACTCCTCCTTCTCGGCCAATGGACGACACTCCCGCTCCTATTGTCACT
ATCCGATCTGGTGATGGTCCAGGCCCGTCTAAAAACAATCCTCAAGCACC
CAAACCACTTATGGGTGCACCACCCATGGAGCCGCCTCGCAACATGCCAC
CACCTGTCAACATGCCTCCTCGCCCACCACAGAACCCGATGATGCGCCCA
CCTCCCATGATGAGACCTCCAGGACCAGGAGACATGGGTATGATGCAACC
ACCTCCTCTCATGCCCCCACCTCCCGGTATGATGATGCCACCACCCCCAG
GAGGTATGATGCCTCCACCACCGGGTGGAATGATGCCGCCCAGACCACCT
CAAATGGATGACCCAGGTATGCGAGGTCCTCCACCACAAAATATGGATGA
TGATGAACCGGCTTCGAAGAGAGCCAAATTCGATGAGTCCGACCTCATCC
CTGAGGACGCTTTCATGCGACAAAATGCACCAAACGTCACGTTCCGCGTA
CAAGTTCCGGATCTACCCGACAAATCTGACTGGCAGTGTCAAGGACAAAC
TCTTTCCATCAGTGCCATGTTGTCTGAATCGTGTGCATCGATCAAAGCAA
AGGTCAACGCAATGATCGGAATGCCTGCTGGCAAACAGAAACTGCAACTT
GGATCGTTATTCGTGAAGGACTCGAACACATTGGCATTTTATAATTTCAC
ATCATCAAGTTTGGTACAACTGCAAGTCAAGGAAAGAGGTGGTCGTAAAA
AATagATGGGACCTGCGGTGCCCATTGAACAAGTTCAAACAGAAACTTCA
GAAGATGGAAAGATCTATGAGAGATCACAACAAGATGGTGAAATGTATTC
TAAACCTACGGTTGGTATTATTTATCCACCGCCTGAAGTCAGAAATATTG
TTGACAGGACTGCAAACTTTGTAGCTAGAAATGGTCCTGAATTTGAGGAA
AGGATCCGTGGAAATGAAGCTGATAATCCAAAGTTCAATTTCTTGAACCC
TAATGACCCTTACCATGCATATTATGCTCACAAGTTAAAAGAATACAGAG
AAACTGATATTGCAGATCTGCCGTCACTAAACGAAAAGGAACCACAAAAA
GCACCTCAAACTCAAACAAAGAAACAAGCTCCACAAGTTATAGAAACGAT
CATTCCAAAAGATCCGCCACCAGCGTATGAATTCACGGCAGATCCACCCA
CCATTTCTGCTCTTGATTTGGACATTGTCAAACTAACTGCTCAGTTCGTT
GCGAAAAATGGAAAAGGTTTTCTGACCAATCTAATGACAAGAGAACAGAG
GAATTATCAGTTTGATTTTTTGAGACCACAACACAGTTTATTCCAATATT
TCACCCGTTTAGTTGAACAATATACTAAGGTATTACTACCACCTGGGGAT
ATCACACAGAAATTGCAAAAAGACTTAAGTGACCAATGGAAGGTATTAGA
TACAGTAAAATATCGTGTAGAATGGCAACAATATCAGGATCGTGAAAAAC
GGAaagttgaagatgaaaaagaaagagagagaaTTGCATTCGCATCTATC
GATTGGCATGATTTCGTTGTCGTGGAAACGGTCAATTTCAATGAAGAAGA
AACAGCCAATCTTCCACCTCCTGTGAAGAAAGATCAACTAGGAGCAAGAA
TGTTACAAGAAGAACGTATTGAAAAACTGAAGGCCACGGGTGAGGACGCG
GAACAAGTTGAAATGGACGTggaagaggaagaagaagaactGTATCAGCC
TTATCAACAAgagcaagaaaaagaaaaggctGACTCTGATATGGATGAAG
AAAGTGACGAAGAAGAGGCTCAACCACCCGCTTTCAAACCACCTATGATG
CCACCCCCGCCAAGTGGTCCTGTTCATATTCGAAAATATGATCCGAAAGC
TTCCAAACAACCACAACCCACACCCGGTGGTGTGCCTGAGAAGTATTTGA
TTTCACCGTTGACGGGTGAGAAGATCCCGGTTGGCTCGATGGAATCTCAC
ATGAAGATTGCATTGCTCGATCCACGATGGAAAGAACAGAAGGAGAAAGC
CATCGAAGAGAAGCGACAACAAGAACAAGTCTTTGCTGAGGGTGTTCATA
TTGGTGATACTTTGAAACAACTTGCGGAAAGGCGTTCCGATATTTTCGGA
GTCGCTGCAGAGGAGACGCTGATTGGTCGAAAATTGGGGGAAGAGGAGGA
ACAGGCGTTGAAAAAGACTCCAAAAGAAGTTTGGGACGGTCATACTGCAA
GTATCGAGCGAACGACCAAGATGGCGCACTCCAACATTACTTACGAAGAC
CAAATTAAGGCAATCCATAAAGCCAAAGGTCTACTGCCATCGGAAGACGC
TGAGCGTATTGGTCCATCGATGAAGCAACCACCGCCTAGACCTGGTCCGC
CACCACCACGACCAATGCCACCACGCCCTACTCCTCCTTCTCGGCCAATG
GACGACACTCCCGCTCCTATTGTCACTATCCGATCTGGTGATGGTCCAGG
CCCGTCTAAAAACAATCCTCAAGCACCCAAACCACTTATGGGTGCACCAC
CCATGGAGCCGCCTCGCAACATGCCACCACCTGTCAACATGCCTCCTCGC
CCACCACAGAACCCGATGATGCGCCCACCTCCCATGATGAGACCTCCAGG
ACCAGGAGACATGGGTATGATGCAACCACCTCCTCTCATGCCCCCACCTC
CCGGTATGATGATGCCACCACCCCCAGGAGGTATGATGCCTCCACCACCG
GGTGGAATGATGCCGCCCAGACCACCTCAAATGGATGACCCAGGTATGCG
AGGTCCTCCACCACAAAATATGGATGATGATGAACCGGCTTCGAAGAGAG
CCAAATTCGATGAGTCCGACCTCATCCCTGAGGACGCTTTCATGCGACAA
AATGCACCAAACGTCACGTTCCGCGTACAAGTTCCGGATCTACCCGACAA
ATCTGACTGGCAGTGTCAAGGACAAACTCTTTCCATCAGTGCCATGTTGT
CTGAATCGTGTGCATCGATCAAAGCAAAGGTCAACGCAATGATCGGAATG
CCTGCTGGCAAACAGAAACTGCAACTTGGATCGTTATTCGTGAAGGACTC
GAACACATTGGCATTTTATAATTTCACATCATCAAGTTTGGTACAACTGC
AAGTCAAGGAAAGAGGTGGTCGTAAAAAATagATGGGACCTGCGGTGCCC
ATTGAACAAGTTCAAACAGAAACTTCAGAAGATGGAAAGATCTATGAGAG
ATCACAACAAGATGGTGAAATGTATTCTAAACCTACGGTTGGTATTATTT
ATCCACCGCCTGAAGTCAGAAATATTGTTGACAGGACTGCAAACTTTGTA
GCTAGAAATGGTCCTGAATTTGAGGAAAGGATCCGTGGAAATGAAGCTGA
TAATCCAAAGTTCAATTTCTTGAACCCTAATGACCCTTACCATGCATATT
ATGCTCACAAGTTAAAAGAATACAGAGAAACTGATATTGCAGATCTGCCG
TCACTAAACGAAAAGGAACCACAAAAAGCACCTCAAACTCAAACAAAGAA
ACAAGCTCCACAAGTTATAGAAACGATCATTCCAAAAGATCCGCCACCAG
CGTATGAATTCACGGCAGATCCACCCACCATTTCTGCTCTTGATTTGGAC
ATTGTCAAACTAACTGCTCAGTTCGTTGCGAAAAATGGAAAAGGTTTTCT
GACCAATCTAATGACAAGAGAACAGAGGAATTATCAGTTTGATTTTTTGA
GACCACAACACAGTTTATTCCAATATTTCACCCGTTTAGTTGAACAATAT
ACTAAGGTATTACTACCACCTGGGGATATCACACAGAAATTGCAAAAAGA
CTTAAGTGACCAATGGAAGGTATTAGATACAGTAAAATATCGTGTAGAAT
GGCAACAATATCAGGATCGTGAAAAACGGAaagttgaagatgaaaaagaa
agagagagaaTTGCATTCGCATCTATCGATTGGCATGATTTCGTTGTCGT
GGAAACGGTCAATTTCAATGAAGAAGAAACAGCCAATCTTCCACCTCCTG
TGAAGAAAGATCAACTAGGAGCAAGAATGTTACAAGAAGAACGTATTGAA
AAACTGAAGGCCACGGGTGAGGACGCGGAACAAGTTGAAATGGACGTgga
agaggaagaagaagaactGTATCAGCCTTATCAACAAgagcaagaaaaag
aaaaggctGACTCTGATATGGATGAAGAAAGTGACGAAGAAGAGGCTCAA
CCACCCGCTTTCAAACCACCTATGATGCCACCCCCGCCAAGTGGTCCTGT
TCATATTCGAAAATATGATCCGAAAGCTTCCAAACAACCACAACCCACAC
CCGGTGGTGTGCCTGAGAAGTATTTGATTTCACCGTTGACGGGTGAGAAG
ATCCCGGTTGGCTCGATGGAATCTCACATGAAGATTGCATTGCTCGATCC
ACGATGGAAAGAACAGAAGGAGAAAGCCATCGAAGAGAAGCGACAACAAG
AACAAGTCTTTGCTGAGGGTGTTCATATTGGTGATACTTTGAAACAACTT
GCGGAAAGGCGTTCCGATATTTTCGGAGTCGCTGCAGAGGAGACGCTGAT
TGGTCGAAAATTGGGGGAAGAGGAGGAACAGGCGTTGAAAAAGACTCCAA
AAGAAGTTTGGGACGGTCATACTGCAAGTATCGAGCGAACGACCAAGATG
GCGCACTCCAACATTACTTACGAAGACCAAATTAAGGCAATCCATAAAGC
CAAAGGTCTACTGCCATCGGAAGACGCTGAGCGTATTGGTCCATCGATGA
AGCAACCACCGCCTAGACCTGGTCCGCCACCACCACGACCAATGCCACCA
CGCCCTACTCCTCCTTCTCGGCCAATGGACGACACTCCCGCTCCTATTGT
CACTATCCGATCTGGTGATGGTCCAGGCCCGTCTAAAAACAATCCTCAAG
CACCCAAACCACTTATGGGTGCACCACCCATGGAGCCGCCTCGCAACATG
CCACCACCTGTCAACATGCCTCCTCGCCCACCACAGAACCCGATGATGCG
CCCACCTCCCATGATGAGACCTCCAGGACCAGGAGACATGGGTATGATGC
AACCACCTCCTCTCATGCCCCCACCTCCCGGTATGATGATGCCACCACCC
CCAGGAGGTATGATGCCTCCACCACCGGGTGGAATGATGCCGCCCAGACC
ACCTCAAATGGATGACCCAGGTATGCGAGGTCCTCCACCACAAAATATGG
ATGATGATGAACCGGCTTCGAAGAGAGCCAAATTCGATGAGTCCGACCTC
ATCCCTGAGGACGCTTTCATGCGACAAAATGCACCAAACGTCACGTTCCG
CGTACAAGTTCCGGATCTACCCGACAAATCTGACTGGCAGTGTCAAGGAC
AAACTCTTTCCATCAGTGCCATGTTGTCTGAATCGTGTGCATCGATCAAA
GCAAAGGTCAACGCAATGATCGGAATGCCTGCTGGCAAACAGAAACTGCA
ACTTGGATCGTTATTCGTGAAGGACTCGAACACATTGGCATTTTATAATT
TCACATCATCAAGTTTGGTACAACTGCAAGTCAAGGAAAGAGGTGGTCGT
AAAAAATagATGGGACCTGCGGTGCCCATTGAACAAGTTCAAACAGAAAC
TTCAGAAGATGGAAAGATCTATGAGAGATCACAACAAGATGGTGAAATGT
ATTCTAAACCTACGGTTGGTATTATTTATCCACCGCCTGAAGTCAGAAAT
ATTGTTGACAGGACTGCAAACTTTGTAGCTAGAAATGGTCCTGAATTTGA
GGAAAGGATCCGTGGAAATGAAGCTGATAATCCAAAGTTCAATTTCTTGA
ACCCTAATGACCCTTACCATGCATATTATGCTCACAAGTTAAAAGAATAC
AGAGAAACTGATATTGCAGATCTGCCGTCACTAAACGAAAAGGAACCACA
AAAAGCACCTCAAACTCAAACAAAGAAACAAGCTCCACAAGTTATAGAAA
CGATCATTCCAAAAGATCCGCCACCAGCGTATGAATTCACGGCAGATCCA
CCCACCATTTCTGCTCTTGATTTGGACATTGTCAAACTAACTGCTCAGTT
CGTTGCGAAAAATGGAAAAGGTTTTCTGACCAATCTAATGACAAGAGAAC
AGAGGAATTATCAGTTTGATTTTTTGAGACCACAACACAGTTTATTCCAA
TATTTCACCCGTTTAGTTGAACAATATACTAAGGTATTACTACCACCTGG
GGATATCACACAGAAATTGCAAAAAGACTTAAGTGACCAATGGAAGGTAT
TAGATACAGTAAAATATCGTGTAGAATGGCAACAATATCAGGATCGTGAA
AAACGGAaagttgaagatgaaaaagaaagagagagaaTTGCATTCGCATC
TATCGATTGGCATGATTTCGTTGTCGTGGAAACGGTCAATTTCAATGAAG
AAGAAACAGCCAATCTTCCACCTCCTGTGAAGAAAGATCAACTAGGAGCA
AGAATGTTACAAGAAGAACGTATTGAAAAACTGAAGGCCACGGGTGAGGA
CGCGGAACAAGTTGAAATGGACGTggaagaggaagaagaagaactGTATC
AGCCTTATCAACAAgagcaagaaaaagaaaaggctGACTCTGATATGGAT
GAAGAAAGTGACGAAGAAGAGGCTCAACCACCCGCTTTCAAACCACCTAT
GATGCCACCCCCGCCAAGTGGTCCTGTTCATATTCGAAAATATGATCCGA
AAGCTTCCAAACAACCACAACCCACACCCGGTGGTGTGCCTGAGAAGTAT
TTGATTTCACCGTTGACGGGTGAGAAGATCCCGGTTGGCTCGATGGAATC
TCACATGAAGATTGCATTGCTCGATCCACGATGGAAAGAACAGAAGGAGA
AAGCCATCGAAGAGAAGCGACAACAAGAACAAGTCTTTGCTGAGGGTGTT
CATATTGGTGATACTTTGAAACAACTTGCGGAAAGGCGTTCCGATATTTT
CGGAGTCGCTGCAGAGGAGACGCTGATTGGTCGAAAATTGGGGGAAGAGG
AGGAACAGGCGTTGAAAAAGACTCCAAAAGAAGTTTGGGACGGTCATACT
GCAAGTATCGAGCGAACGACCAAGATGGCGCACTCCAACATTACTTACGA
AGACCAAATTAAGGCAATCCATAAAGCCAAAGGTCTACTGCCATCGGAAG
ACGCTGAGCGTATTGGTCCATCGATGAAGCAACCACCGCCTAGACCTGGT
CCGCCACCACCACGACCAATGCCACCACGCCCTACTCCTCCTTCTCGGCC
AATGGACGACACTCCCGCTCCTATTGTCACTATCCGATCTGGTGATGGTC
CAGGCCCGTCTAAAAACAATCCTCAAGCACCCAAACCACTTATGGGTGCA
CCACCCATGGAGCCGCCTCGCAACATGCCACCACCTGTCAACATGCCTCC
TCGCCCACCACAGAACCCGATGATGCGCCCACCTCCCATGATGAGACCTC
CAGGACCAGGAGACATGGGTATGATGCAACCACCTCCTCTCATGCCCCCA
CCTCCCGGTATGATGATGCCACCACCCCCAGGAGGTATGATGCCTCCACC
ACCGGGTGGAATGATGCCGCCCAGACCACCTCAAATGGATGACCCAGGTA
TGCGAGGTCCTCCACCACAAAATATGGATGATGATGAACCGGCTTCGAAG
AGAGCCAAATTCGATGAGTCCGACCTCATCCCTGAGGACGCTTTCATGCG
ACAAAATGCACCAAACGTCACGTTCCGCGTACAAGTTCCGGATCTACCCG
ACAAATCTGACTGGCAGTGTCAAGGACAAACTCTTTCCATCAGTGCCATG
TTGTCTGAATCGTGTGCATCGATCAAAGCAAAGGTCAACGCAATGATCGG
AATGCCTGCTGGCAAACAGAAACTGCAACTTGGATCGTTATTCGTGAAGG
ACTCGAACACATTGGCATTTTATAATTTCACATCATCAAGTTTGGTACAA
CTGCAAGTCAAGGAAAGAGGTGGTCGTAAAAAATag
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000284XLOC_000284Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000447-proteinTCONS_00000447-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000447-exon-sc0000002-1491911889:878549..878906TCONS_00000447-exon-sc0000002-1491911889:878549..878906Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:878549..878906TCONS_00000447-exon-sc0000002-1510915933:878549..878906Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:878549..878906TCONS_00000447-exon-sc0000002-1575043694:878549..878906Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:880029..880067TCONS_00000447-exon-sc0000002-1491911889:880029..880067Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:880029..880067TCONS_00000447-exon-sc0000002-1510915933:880029..880067Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:880029..880067TCONS_00000447-exon-sc0000002-1575043694:880029..880067Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:880240..880377TCONS_00000447-exon-sc0000002-1491911889:880240..880377Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:880240..880377TCONS_00000447-exon-sc0000002-1510915933:880240..880377Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:880240..880377TCONS_00000447-exon-sc0000002-1575043694:880240..880377Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:882470..882519TCONS_00000447-exon-sc0000002-1491911889:882470..882519Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:882470..882519TCONS_00000447-exon-sc0000002-1510915933:882470..882519Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:882470..882519TCONS_00000447-exon-sc0000002-1575043694:882470..882519Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:882697..882794TCONS_00000447-exon-sc0000002-1491911889:882697..882794Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:882697..882794TCONS_00000447-exon-sc0000002-1510915933:882697..882794Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:882697..882794TCONS_00000447-exon-sc0000002-1575043694:882697..882794Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:883072..883231TCONS_00000447-exon-sc0000002-1491911889:883072..883231Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:883072..883231TCONS_00000447-exon-sc0000002-1510915933:883072..883231Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:883072..883231TCONS_00000447-exon-sc0000002-1575043694:883072..883231Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:883501..883563TCONS_00000447-exon-sc0000002-1491911889:883501..883563Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:883501..883563TCONS_00000447-exon-sc0000002-1510915933:883501..883563Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:883501..883563TCONS_00000447-exon-sc0000002-1575043694:883501..883563Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:883848..883938TCONS_00000447-exon-sc0000002-1491911889:883848..883938Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:883848..883938TCONS_00000447-exon-sc0000002-1510915933:883848..883938Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:883848..883938TCONS_00000447-exon-sc0000002-1575043694:883848..883938Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:884207..884278TCONS_00000447-exon-sc0000002-1491911889:884207..884278Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:884207..884278TCONS_00000447-exon-sc0000002-1510915933:884207..884278Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:884207..884278TCONS_00000447-exon-sc0000002-1575043694:884207..884278Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:884515..884591TCONS_00000447-exon-sc0000002-1491911889:884515..884591Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:884515..884591TCONS_00000447-exon-sc0000002-1510915933:884515..884591Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:884515..884591TCONS_00000447-exon-sc0000002-1575043694:884515..884591Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:884856..884966TCONS_00000447-exon-sc0000002-1491911889:884856..884966Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:884856..884966TCONS_00000447-exon-sc0000002-1510915933:884856..884966Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:884856..884966TCONS_00000447-exon-sc0000002-1575043694:884856..884966Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:885159..885307TCONS_00000447-exon-sc0000002-1491911889:885159..885307Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:885159..885307TCONS_00000447-exon-sc0000002-1510915933:885159..885307Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:885159..885307TCONS_00000447-exon-sc0000002-1575043694:885159..885307Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:886312..886460TCONS_00000447-exon-sc0000002-1491911889:886312..886460Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:886312..886460TCONS_00000447-exon-sc0000002-1510915933:886312..886460Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:886312..886460TCONS_00000447-exon-sc0000002-1575043694:886312..886460Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:889454..889697TCONS_00000447-exon-sc0000002-1491911889:889454..889697Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:889454..889697TCONS_00000447-exon-sc0000002-1510915933:889454..889697Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:889454..889697TCONS_00000447-exon-sc0000002-1575043694:889454..889697Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:890017..890474TCONS_00000447-exon-sc0000002-1491911889:890017..890474Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:890017..890474TCONS_00000447-exon-sc0000002-1510915933:890017..890474Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:890017..890474TCONS_00000447-exon-sc0000002-1575043694:890017..890474Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:890694..890908TCONS_00000447-exon-sc0000002-1491911889:890694..890908Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:890694..890908TCONS_00000447-exon-sc0000002-1510915933:890694..890908Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:890694..890908TCONS_00000447-exon-sc0000002-1575043694:890694..890908Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:891200..891271TCONS_00000447-exon-sc0000002-1491911889:891200..891271Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:891200..891271TCONS_00000447-exon-sc0000002-1510915933:891200..891271Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:891200..891271TCONS_00000447-exon-sc0000002-1575043694:891200..891271Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1491911889:893147..893424TCONS_00000447-exon-sc0000002-1491911889:893147..893424Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1510915933:893147..893424TCONS_00000447-exon-sc0000002-1510915933:893147..893424Clytia hemisphaericaexon
TCONS_00000447-exon-sc0000002-1575043694:893147..893424TCONS_00000447-exon-sc0000002-1575043694:893147..893424Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:878549..893424 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
68.851 58.4021 81.8767 85.6384 111.69 90.2848 69.038 77.363 39.7589 58.9415 40.0016 27.7513 33.3655 35.4287 32.7199 48.4011 51.0339 48.0143 14.2743 18.305 30.2061 32.4444 34.8091 33.8969 46.3271 49.0478 19.1944 15.4381 30.7726 30.9993
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000061Surp
IPR000626Ubiquitin_dom
IPR022030SF3A1
IPR029071Ubiquitin-rel_dom
Vocabulary: Biological Process
TermDefinition
GO:0006396RNA processing
Vocabulary: Molecular Function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006396 RNA processing
molecular_function GO:0005515 protein binding
molecular_function GO:0003723 RNA binding
Blast
BLAST of TCONS_00000447 vs. Swiss-Prot (Human)
Match: SF3A1 (Splicing factor 3A subunit 1 OS=Homo sapiens GN=SF3A1 PE=1 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 1.752e-97
Identity = 183/292 (62.67%), Postives = 227/292 (77.74%), Query Frame = 1
Query:  283 ERSQQDGEMYSKPTVGIIYPPPEVRNIVDRTANFVARNGPEFEERIRGNEADNPKFNFLNPNDPYHAYYAHKLKEYRETDI----ADLPSLNEKEXXXXXXXXXXXXXXXVI-ETIIPKDPPPAYEFTADPPTISALDLDIVKLTAQFVAKNGKGFLTNLMTREQRNYQFDFLRPQHSLFQYFTRLVEQYTKVLLPPGDITQKLQKDLSDQWKVLDTVKYRVEWQQYQXXXXXXXXXXXXXXXIAFASIDWHDXXXXXXXXXXXXXXANLPPPVKKDQLGARMLQEERIEKL 1143
            E S ++    SKP VGIIYPPPEVRNIVD+TA+FVARNGPEFE RIR NE +NPKFNFLNPNDPYHAYY HK+ E++E       A +P + +++ Q   Q   +K   QVI ETI+PK+PPP +EF ADPP+ISA DLD+VKLTAQFVA+NG+ FLT LM +EQRNYQFDFLRPQHSLF YFT+LVEQYTK+L+PP  +  KL+K+  +  +VLD V YRVEW ++Q+RE++K E+EKE+ER+A+A IDWHDFVVVETV+F   E  N PPP   ++LGAR+L +ER EK 
Sbjct:   26 EASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKF 317          

HSP 2 Score: 182.185 bits (461), Expect = 1.943e-47
Identity = 96/168 (57.14%), Postives = 126/168 (75.00%), Query Frame = 1
Query: 1336 VHIRK-YDPKASKQPQPTPGGVPEKYLISPLTGEKIPVGSMESHMKIALLDPRWKEQKEKAIEEKRQQEQVFAEGVHIGDTLKQLAERRSDIFGVAAEETLIGRKLGEEEEQALKKTPKEVWDGHTASIERTTKMAHSNITYEDQIKAIHKAKGLLPSEDA-ERIGPS 1833
            V +RK YDPKASK   P P   P++YL+SP+TGEKIP   M+ HM+I LLDPRW EQ++++I EK+  ++V+A G+ I  +LKQLAERR+DIFGV  EET IG+K+GEEE Q  K   K  WDGH+ S+ RT + A +NIT ++QI+AIHKAKGL+P +D  E+IGPS
Sbjct:  387 VIVRKDYDPKASKPLPPAPA--PDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGV--EETAIGKKIGEEEIQ--KPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPS 548          

HSP 3 Score: 124.405 bits (311), Expect = 5.965e-29
Identity = 56/118 (47.46%), Postives = 86/118 (72.88%), Query Frame = 1
Query: 2290 DDEPASKRAKFDESDLIPEDAFMRQNAPNVTFRVQVPDLPDKSDWQCQGQTLSISAMLSESCASIKAKVNAMIGMPAGKQKLQLGSLFVKDSNTLAFYNFTSSSLVQLQVKERGGRKK 2643
            +DEP SK+ K ++S L+PE+ F+R+N   V+ +VQVP++ DK++W+  GQ L  +  L++  + IK K++   GMPAGKQKLQ   +F+KDSN+LA+YN  + +++ L +KERGGRKK
Sbjct:  677 EDEPTSKKLKTEDS-LMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK 793          
The following BLAST results are available for this feature:
BLAST of TCONS_00000447 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SF3A11.752e-9762.67Splicing factor 3A subunit 1 OS=Homo sapiens GN=SF... [more]
back to top