Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000442 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000442
Unique NameTCONS_00000442
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length895

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000442 ID=TCONS_00000442|Name=TCONS_00000442|organism=Clytia hemisphaerica|type=transcript|length=895bp
NTCGTATGGTGATCGAATCAAGTTTATTCAACAGCCTGATTTAGGCCCAG
TTCATGGAGTACCTAACAACATGCATCGTTTTATGGGTTATTATAAGATT
TCTCGACATTTTCAGTTTGCACTTGGTAAAGTTTTTGAAATGACGGATAG
TGATAGTGTAATTATTGTGGAAGATGATATAGAAATAgCTCCTGatttct
ttgattattttttggcAACTCGGAAACTTTTAGAAGTTGACAACACTTTG
TTTTGTGTATCTGCTTGGAATGATAATGGGAAAGAAGACTCCGTTGATCC
ATCTGCTATTGATGTTTTGTACAGGTCTGACTTCTTTCCTGGACTTGGCT
GGATGATGACTCGTAAACTTTGGAATGAGATTGGGCCTAACTGGCCTAAA
GGTTTTTGGGATGATTGGATGAGAGATCCTAAACAACGTAAAGATAGATC
ATGTATAAGACCAGAGATATCACGTACAAAAACCTTTGGACGTATTGGAG
TCAGTCAAGGGCAGTTTTATGATCAATATTTAAAGTTTATCAGACTGAAT
AATCAAGCTTTTCCATTTCGTGATTACGATTTGAGTTATTTGACGAAATC
AAAATATGATGAAGAATTTTTAGAGAAGGTTTATACAACACCTGAAGTGG
ATTCACAACAAGCTACATCAAAAGGAGCATCAGATGTCCGTATTACTTAC
AACAATCACTATGAATTCGAAAACTTTGCAAGGCGTTTTGGATTAATGTC
AGATTTCAAAGCTGGAGTACCTAGAACAGCATATCATGGTGTAGTCACTT
TCTTTCGTGGCGGACATCGCATCTATATAGCTCCGCCCAAAAATTGGAAA
GGCTACAGAGAGCATTAATATTACTTCTATTTTAATCTAGAATTT
Run BLAST on NCBI

transcript from alignment at sc0000002:731124..732637+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000442 ID=TCONS_00000442|Name=TCONS_00000442|organism=Clytia hemisphaerica|type=transcript|length=1514bp|location=Sequence derived from alignment at sc0000002:731124..732637+ (Clytia hemisphaerica)
NTCGTATGGTGATCGAATCAAGTTTATTCAACAGCCTGATTTAGGCCCAG TTCATGGAGTACCTAACAACATGCATCGTTTTATGGGTTATTATAAGATT TCTCGACATTTTCAGTTTGCACTTGGTAAAGTTTTTGAAATGACGGATAG TGATAGTGTAATTATTGTGGAAGATGATATAGAAATAggtatattttttt tactttttacatatCTTTTCGAAATCTTTCTAGTTGAGAATTATTAATGC TACATAAAGAgactagtttgagtaaagaaaacgatttaatACAATTCACT GAAGATTTCCATCCtggatggcatgaaactttgagtatgaaattaactta aatagttttctttactcaaactagtatAAAGCTCTGTTATCATTAACATT GAGCACTGCTATTGGTTTTGGCTTACACAAAGTAGTGCTTCACAAGAGAT GTATTTTCATGGGTTTTTGTTACAATTTCAGAGAATTTACTCTTTCCTGT TGGGTtgggtggaggatatataatttttgaagtGATCTACCagtaaatat tttaatttttcatcgcCTGGACACGTGCCTTACCTTTGGACAAGCATCGA CCTCTGAGACACTAAAATGAAATCCATGGAGCATTAATTCATCTAATCGA TAAGGcaatttgataaatttgttcTATGCTATATCTTCCATCACCTAATG ACGATccattttggtttttaaaatgTGGATTTTGAAGATGTGTAACTGTT TGTCCAAAATAAATTGTTCATATTTATATAAAAtccatcatttttttctt cttatagCTCCTGatttctttgattattttttggcAACTCGGAAACTTTT AGAAGTTGACAACACTTTGTTTTGTGTATCTGCTTGGAATGATAATGGGA AAGAAGACTCCGTTGATCCATCTGCTATTGATGTTTTGTACAGGTCTGAC TTCTTTCCTGGACTTGGCTGGATGATGACTCGTAAACTTTGGAATGAGAT TGGGCCTAACTGGCCTAAAGGTTTTTGGGATGATTGGATGAGAGATCCTA AACAACGTAAAGATAGATCATGTATAAGACCAGAGATATCACGTACAAAA ACCTTTGGACGTATTGGAGTCAGTCAAGGGCAGTTTTATGATCAATATTT AAAGTTTATCAGACTGAATAATCAAGCTTTTCCATTTCGTGATTACGATT TGAGTTATTTGACGAAATCAAAATATGATGAAGAATTTTTAGAGAAGGTT TATACAACACCTGAAGTGGATTCACAACAAGCTACATCAAAAGGAGCATC AGATGTCCGTATTACTTACAACAATCACTATGAATTCGAAAACTTTGCAA GGCGTTTTGGATTAATGTCAGATTTCAAAGCTGGAGTACCTAGAACAGCA TATCATGGTGTAGTCACTTTCTTTCGTGGCGGACATCGCATCTATATAGC TCCGCCCAAAAATTGGAAAGGCTACAGAGAGCATTAATATTACTTCTATT TTAATCTAGAATTT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000282XLOC_000282Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000442-exon-sc0000002-1491911889:731124..731311TCONS_00000442-exon-sc0000002-1491911889:731124..731311Clytia hemisphaericaexon
TCONS_00000442-exon-sc0000002-1510915933:731124..731311TCONS_00000442-exon-sc0000002-1510915933:731124..731311Clytia hemisphaericaexon
TCONS_00000442-exon-sc0000002-1575043694:731124..731311TCONS_00000442-exon-sc0000002-1575043694:731124..731311Clytia hemisphaericaexon
TCONS_00000442-exon-sc0000002-1491911889:731931..732637TCONS_00000442-exon-sc0000002-1491911889:731931..732637Clytia hemisphaericaexon
TCONS_00000442-exon-sc0000002-1510915933:731931..732637TCONS_00000442-exon-sc0000002-1510915933:731931..732637Clytia hemisphaericaexon
TCONS_00000442-exon-sc0000002-1575043694:731931..732637TCONS_00000442-exon-sc0000002-1575043694:731931..732637Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:731124..732637 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.853533 1.53169 1.2702e-05 0.906948 3.36004 0.594527 1.27575 0 5.19261 5.6647 5.55166 3.10819 2.41966 4.46893 3.8734 3.38835 3.33153 4.04585 0.507721 2.50558 2.25114 2.17522 3.24129 4.69122 6.51688 0 2.44953 2.87666 4.46064 4.11379
Blast
BLAST of TCONS_00000442 vs. Swiss-Prot (Human)
Match: MGAT1 (Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Homo sapiens GN=MGAT1 PE=1 SV=2)

HSP 1 Score: 296.975 bits (759), Expect = 3.854e-97
Identity = 153/288 (53.12%), Postives = 204/288 (70.83%), Query Frame = 2
Query:    2 SYGDRIKFIQQPDLGPVHGVPNNMHRFMGYYKISRHFQFALGKVFEMTXXXXXXXXXXXXXXAPDFFDYFLATRKLLEVDNTLFCVSAWNDNGKEDSVDPSAIDVLYRSDFFPGLGWMMTRKLWNEIGPNWPKGFWDDWMRDPKQRKDRSCIRPEISRTKTFGRIGVSQGQFYDQYLKFIRLNNQAFPFRDYDLSYLTKSKYDEEFLEKVYTTPEVDSQQATS---KGASDVRITYNNHYEFENFARRFGLMSDFKAGVPRTAYHGVVTFFRGGHRIYIAPPKNWKGY 856
            SYG  +  I+QPDL  +  VP +  +F GYYKI+RH+++ALG+VF      + ++VEDD+E+APDFF+YF AT  LL+ D +L+CVSAWNDNGKE  VD S  ++LYR+DFFPGLGW++  +LW E+ P WPK FWDDWMR P+QR+ R+CIRPEISRT TFGR GVS GQF+DQ+LKFI+LN Q   F   DLSYL +  YD +FL +VY  P++  ++  +   K   +VR+ Y     F+ FA+  G+M D K+GVPR  Y G+VTF   G R+++APP  W+GY
Sbjct:  154 SYGSAVTHIRQPDLSSI-AVPPDHRKFQGYYKIARHYRWALGQVFRQFRFPAAVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSAWNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQGRACIRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVHFTQLDLSYLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPLTWEGY 440          
The following BLAST results are available for this feature:
BLAST of TCONS_00000442 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MGAT13.854e-9753.13Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglu... [more]
back to top