Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000419 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000419
Unique NameTCONS_00000419
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1844

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000419 ID=TCONS_00000419|Name=TCONS_00000419|organism=Clytia hemisphaerica|type=transcript|length=1844bp
TAGTTGAATTTGGAAGTTTTCGTTGCTTATTCAGGGCGTAGTGACAAATG
AGCACAGCAACAACACAACAACAATATACACAACATTATCAACAATATTC
TTCAATACCTTCAACACATCACAAGATGGATTCAACAAATCCCAATCAAC
AAACTTCATCCATGAATAATGTACAATGTAGACCATGCCTTAATCGGTTC
TTAGAATTAAGGAATCAAGCCATCAACAGAATGACAATGGAGTATCAAAA
GATATGGACTGGCCAAGGAGTACCAGCGATTGATAGCTTAAATCATCTCG
TCTATCAAAGCTTACGACTCTCAGACCATGAATTAACAGGGACAGTCAAC
GGTAAATGTTTATATTGTGATTCACATGTTGAAACGTTAAAAAAATCCGC
ACTGGAGGTTGTTAAAACGCAATTTAATCCGTTTCTGAGGAACATGATTC
CATATAACAACGACACGAATAATCTTACGGCAGCcgaccaacaacaacaa
caaagcaTGCTGGTTGATCGCAATGTAACGACGCGCGGTGAATCAACGGA
TACTTTTAACGGATATCGAGTACCAGGGCTAAACAATACTGTTGGAGACT
CGCgttcaaatgacgtcacacttcATCAATACACTAATCTTCACCAACCA
GATATGGGCAAATCAACAACCAACCAATCAGCTCCCTCCAATACAACTAA
TCCGACCAATCAGAATTCGACACGATCAGCAATGACATCTCAGTTCTTCG
TTGAGGCAGCGAAGAAATATAATGTCCGAAAGAATcgttcatcttcatct
tcaaaaCACAAGAACAAAGAATCAAGTTCCTTGTTCCCAACCAACTTCAC
TAACATGCTGAAACAATCATCACCATCTAACCCACCCGGTCTTTTCAAAT
ATATGGGGCGTAGAGTTGATGGCAAGGTCTCTGTCATGTTACGCGTCCAA
CCTTCCATCAACGACCAATCAGATAACTCGCTCATCGAAATCGATCTTCG
TAAAAAACAAATCTCCTTCTTACAACCCAACGCCCCTTCATCAACACCCT
TAGACGCCAATCAAGCACCACCGCCCTcccaaccaaaatattttggcttC
GACAATATTTTTACACCGGAAGAACGACATGATCGAATATCATCTGGATC
TCTATTAGACGTCCTACACGCTGTTATTAACGGTGGCGACGGGGCTCTAG
TCACGTATGGAGGACCGGGAACCGGAAAAACACGGACCATGGTCGGGCAA
GATGGTAGCAGCACAACGGCCGGTATTTTACCATGCGCAATAGCATGGTT
ATACAGTTTAATAGACGATTGTAAACAACGAACGGGCGCCCGGATCTCCA
TACGGGTTTCCGCAGTCGAAGTTGTCGGACGTAACGAAGAGTTGAAAGAC
TTATTAGCAGATCAAGCATCTGGGACTGATAGTATAGACAGTCATAGTGC
GTCACCTGGTATTTATTTACGCGAAGATCCGGTAGGCGGGATAAATTTGG
AGAATGTGAGTGAACCACAAGCAGCTAACAAAGAAAAAGCGGGCTTTTAT
TTGGATGCAGCTCTGGCTTCCAGATCAGCTGAAAAAGACAATCAAGGAGT
GACGCAGAATAGCCATATGATCTTCactttccatatttatcaaTATCGCG
TGGaaaaaaatgcaagaaaaatCCCGTCAGGTTCAGTACCGCAATACTCA
GGTGGGCGATCCAGGCTACATTTGATTGATCTCAGTTACGTCAACCaaaa
tttcgaagaaaaaacatcACAGCCTAGTCAAGCACCTAGTCATGCTGCGT
TGGGTCAAATTATGATCACCATGCTTAATGGAAACAAAAAAGTC
Run BLAST on NCBI

transcript from alignment at sc0000002:173991..199422+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000419 ID=TCONS_00000419|Name=TCONS_00000419|organism=Clytia hemisphaerica|type=transcript|length=25432bp|location=Sequence derived from alignment at sc0000002:173991..199422+ (Clytia hemisphaerica)
TAGTTGAATTTGGAAGTTTTCGTTGCTTATTCAGGGCGTAGTGACAAGTA AGTAAGCTGCTTTCTTGTTTTTTATGGATCAGTTTTGAAATTCATCTGGA CTAACGCTAAGTATATTGCTTTACAGGGCAagcacacattttttataagt gTTCTTAAGTTTGAAGCCATTTAATCTACATTTGTTCTCATTTTTAGTGT TTTCTCGGTAATTTAGTAAAATGTCCTAAAAAAATTGCTtatgtttttga gttttttaacGTCTATCCAAGTTTTGTAACGTTTTTATCTTCTTAGTCTC TGAAGAAGCAATTTCTTGCCTATCCTTTCTCCTTCGAAAAGAAACGTTTT CTACTAAATGAAGTGAAGCTGTCAAGGGAAAATTTACTTTATTCAAAGAT TTACAGGGTTCTTCTTTTTgatcaaatatttttatcctGGTCCATTGTCA CGTGACAAATATTTTCAAGTATAaacaagaaaattttcaaaatataaaaa atcaaaatattataaatttcTAAAGTTTTCTTCCTTAATATGtaactatt tttttgtttccttttaaGCAAGTTTTTATAAACACTAACCACACCCTATT TCAATGCATTCTCAAGTGGAGGGGGACGTAAGATCANTAAgcaagttttt ataaaaactaaccACACCTTATTTCAATGCATTCTCAAGTGGAGGGGGAC GTAAGATCAAAGTTTTCAGAACTTCCTTTGCTACCCTATAGGATTACTTG TATGAAGGACAAAAACTTAGTAAAATGTAAATGCAAGCTGTTTAGCCGTT AGAGAGAAGagaagaacatttttcttataaaaaaagaagcacCAGTCATA AAGTTTTGTTCACACTCTCGTGTTACACACTCTACGCGCGATTCACAACG AAATCAAAAGCTCGCGGCCGCCACTCGAAAAAGAGAAATCTCCTTTTTCC CTTGTGGAAAGtctcaaaagtttttctttcttcCTTTGAGGGAAAAAATC TCATACTTTAGTGTCATATTTGGATTAGAAATTAATTTTCCATGTCCAAC AGTATGTTGCCACTTTTCTTTTAGTCTTTTAGTCATGCgtggtggtacag tcactttcggtcggggttgtggacggcgaaatatgtcgttttttatgaaa tttgtcgttctttttgtgtatttttagtaatgcaggattctttagataaa ccccctcagGAGATAATTACNTAAAACAACACAACACGCCACGcagattt ttcaactttttttcgtGTCGCTCTAgaatttttgataaatcttATGAATA AGCTCCTGAAATGAATTGGAATGAGTTCTGTATCGTGTGTCTTCAATTAT CCTACTTAAATGttaatcattattttttaattatatacTTTTTGCTATCT TTAATTAGTCTTTTAAGTGTAATTCTTATATTCGAAAAAATTGAGGAAAT AGTTGATCTTTAGTCGCTCACGCTGCCatggtttgaaatatttgtttttg ttttgtagaAGATTTTTCGGTAGAATTTGTGGTATACTGATTTTAGAGGA TGttatttttgctgaattttagAGAATACCGATCGATTCACACAACGCTG TTTCAACGTTTACTGTAACTAaaattcacaacgtccatatatatgatatt agatgaacgttgaaacaacgttatttGCCAGCTGAGAAATTTTGACGGAG AATGTTGAAAAATCACAAATAAATTTGATCGCTCTCCGATTCCGTTAGCa ttctttctggttcttttaACAACCTCCCCCCCCCTTAATAGTTTTTCCTG TTTAGATTTTAGGCCCAAACTGCAAAATTTAGTCAAATAGGAATCTTACA GCCTTTGAAGATTACAAAATATTGCATTATCTTTGACGAGGACAAAAATT TCATACATTTCATCAAtcgaaataatttttctatCAATTAACCATTTTAG GACGGTTTCAACCAAAAGTAACAGAAAACAAACATAAAAACACAAATTAa gagtaaaaaaagaaaaaaaatcaaactgtgATAAAAGCCGGTAAAGTCGC CGGCGTCTAGGCTAAGGATAGATATTTCAATGCATTTATAGAAACTTGAA CTATACCCTAATCCCTAGGTTATTGTTGATTTGGTCCAATGAATTGGTTG TTTGGACTATAGGGACCCAATTTACCCCAATTTTTCCTTGCCGCCGTCTG TTAAGcttgtttgtttatgttttgacTTGGGCGCTATTTCGAAGGACAAG TTGTTTAAAAAAACCATTCGCTTCCGCGTTTGGCTTGTGTAGAGACTTAT AACTTATAACGCACGGTTGATCTTTCAATGAAGATGCCGGGCCGCTGGTA AAGCTATGTGTATAAAAGGCTGAATAGTTGACAAGAATAACGTACTTTTT ATTCGTTGAAATGTTAGAGACCTGTTTCTGGGGATATAGCATTTTATGGC TCGAATAACGATTAGTTGTTTTGGTGGTTGATGTTTTGAGATTTACCGTA TCTGATTCTTGGCGAAATATTGGTacttatcggcgatccaaaaaatatca gcaatctgattggttaaaaagagtacaatatatcttgtattttacatgta aaaatataaattattatccatatagcggtcattaagtaagccattaaaga ttcgaacggcgggcggtattgaaaggttctatgactcaaatagtcatacc cgcgctgagaaaactaaagcgccaggcttcagagggctgaaatattaTTA ACCACCCTGGTTATAGGGCGATAAcctcatttgcggcccgctcattgaac tttattgaagtcgttgcattgaagcggtgagactaaaccgacgtcagaaa aaaacactttttgttcatttgcggcccgctcgcaaggatactcaaaactt gttgaagtcattgcattgaagcgaaaagacatggctgacgctagaaaaaa acgttgtttgaatgtccgatatggataataatagtaatagcgttaagctt tcgttcgttgttgtcattaattctgcccttgcagtttgNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNctccgc ttcgcgtcgggcccaaatgacactctcgggctaataatcaaactgcgcgg gcagaaaataacaacagcgacctcaaactgaacgctattgttatattgac gaaaagatgttgttgcattgtagcggtagaagcaatctaacgtcactttg ctacaaaagtgtcctccaacacaaaaagtgcattttttgggtcaccggta aaccagttatcagacattgtccgataactattacatatgtACTATTACAG CGGAGTCTctctaactcgaacctctataactcgattgTCTCCCTAACTAG AACAAGTTTAgtagtcccttcagttaacataAACCTTACTCGatatctcg aaatttccttaattcgaacaaatttgagCTCCCtgtgtgtgttcgagtta tgaagaatgagtacacgttttttttttttttataaggaaccttaactttg ctctgaacctggagttccttatttttacagagaatttcagtctcaaagtt ccttatcgagttccttactacataggaaattttgaactttttgNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtaaattagtccc aataaggtacattattttcaAATCCACTTATTCTCAccctgagcagttcc ttaacaattccttatttctcaaaccattttcagcctcgagttccttataa acatgttccttataaaaaaaaacaacgtgtagtAAAGTTTATAGTGACCA TGATACACTTTAAATCCTTTACGGTCTTGGATAGAGTTTAAATCTTCATT GGTTTTCAAAATGATCTCGCATTTTCTGTCGTCAAAAAGTTGACTTAAAT TTGACGAGTTGTTGAGTGTTGAAAGAAGAGAATAAACTTCGAAAAAATGT CAACAGTTTGTCAAACTCCTTGAGATATCGTGTCTTTCTAGAGAGAAAAA GTTTCGCTTTAATTTGCATGTTAAGTTGCCAATGGGCAGTCACATCATTT GAACATTAAACTtgtcaaaaacatcaaaaacccTTTTTGTATTCTTTCGT TTTTGTTCATGAAAAGGAAGTCCAAATGGACAAAATTTGTTGCGATAAAT GTTGTGCTAAATGTCAGCAGAAATAAATCATCAGTTCTAAGTATATATCT TCGGCATAGGCCAACTGCATACTAATTTCGACCTGGGCATCTCGATTTTC TATTATTGTGAACTGCATACTGTAAATTTAGATTTGTAAATCTGTAAATG TTTCTCCAAACTTTTAgatgattgaaaaatattaacccAACTTGCTCAGA AATTAGCGTGGATGGGAGACTTTGCGATGTGAGGAAGTTCGAAATGATTA TGTTCATAATGCTTTATCTTTTCATttacgttatatggacgttctTACGA ACCTTAGatagacgttgaaacaacgttgtatgccagGCAGAATAACTTGA TTATTGGACAATTTCCAAATAACAGAgaaaatttattgaataaaccGCCT TTTTCCGTACTATATCTTTTGCGGGCACCCATTTAATTCTTTAGTGCCTG ACGTGGTTTAGTGAGGGTAcctattcttttaaaaaagaatttaaattttc aataggCGGTACTTTAATATAAATGGGAACTCATTTCTTCAGAGTAATTG CTTTTTCATTAGTTAGCGTAGGTCAACAAATTAGCATGATTACAGTAATT AGAAACTTCTTATTTTTGATTCTAATACGCTAATAAGCAGCCATGTGCCT TGTGTTTTCTATGATTTCTTTATGAAGTTTCAaacttcttttataagaaa ataggaacaatttttccaaattattttactttttgctGAAAATGATTCGA TGTACGATGGAACTAAGATTTTAACCTTCTTCCTTCACTTTTTCgattct ttatttaaaaaaaatttccttaaaactTCACAATGAATATGTCAACCATG GAAAATAAcgtaatatttttgttttgatcacgtgaatAAAAAACTAAGTT TGCAACTGTTTACTAAGACAGATACATGGTAAGCCAAGCTAATCCTTACG tataaaaatgctattttcaaAAGGGTTGCACATCTCTTAATCTAGCTCAA TTAGAACTTGTTTGCAAACCTAGCCGTCATGTTTTTCAGTTAGATTCACA TTCAAATCTCTGTTAAATCTTTCTTAATTCGTTACAAGCTCAGAGAAGCT GGGTAAGGTCTCTAGTTACAATCGTGCAGCTTGTTTTTTTATCAGTGTTT TTTGATCAACCTGTAGTTAAAGTTTGTCTTGATCAAAGATGGCTTCAATG ACGGTAAACttattttttacgattttttaaaTAGTAGTAAGTTAAGAGTT TAGGTTGAGCATCTGTCTACGGCGGCGAGTAAGGTTTTGGGCTCAAACCA AGCCGAGTCATACTAAATATCGCAAAATGGTGCTTAATACCTCTCAGCTT TATAATCAGCTACTAAAGAGAAGAATCAAGGGTAAGTGAAGAAATCCAGG GATGGAGTgacaccctcccctaccttcgggtagacagctaaaGAAAAGGG GCGTCTTCGAGTCACCCTCGACTGTGGTTGCAAATTTACTTGAACGTTCA TAAAACGTTAATTGATGGGTGCTGTTTGACATTTTGTGCTTGCGAGCAAT AACCTTTGCATTCTCTTATTTCTGTCAGTTTTATATGCTCTTTTAAAGAA ATATACTTGAAGATTTAACAGGGGGGTTTCAGCTTCTTCTTTCATCAATG GTATTGCTTTTAAAAAGTAAACTTCCAATTCCATTCCATAACAGTTTGGT AAAAAACCCGACTTTTTATATACATtctaaagtatttttttgtaataatt tctattttctaccttttccaataattgtggtttttaaaaaaaattgtgtg acgTCATGATGACATCACAATAGAGAGATGGGGTgttttatcaaaacttt atcaAAGAACAAAAGATGTCGATCCTCTTTGATGTGTTTTGGAGCAAGGG GGTTTTAAGAATGATGAATTTTTCACTACTGTACGTGTGTTTTACTTCAG TGACTGGCTTTTTTATCTTATCGGAAAATTTCGGTGAAGTTTTTTTATGT GTGTATGAGatatgaaatgtttttttagtTTGGTTTTTTAAGATGTGTGG AAATGTCATTTCAAGAGTTGAGGCTTTTCTTCATAAAACCGTATTTTGGC GTATTTCTTGTTAGCGTTCGTTGGTACACGGTAATGAGTTTTGAAATGTC CGTATATTTATCTGGTACAAATGTAACAGAGGGTATCTGTTACTAGATAG CTTAAAAGCCCGTGAGGTAGCTTTTCGCATAAAGCTGTCAATCATCTTTG AGGTTGGTTTGAACCCTGCACGTGGACATTACAACTTGAAATGGAAATAT GTGCGCAATAAAGCATCATTCACAACCCTGTGTctcagacccgctgggac cccagccccactggaaaatttggtgaaaatttcgtccccggtggaaaaac tCCAAaagcactccaaaaccatccccactggatttttaaccttgaaacaa tagaattcctttccccatttggatttcaataggaatttttatccccactg agggaaaaagttccaccggggctgtgagacaggggcgtGTTTTCAAACCC ACAAATGGGATCAAGTAACTGCACTAGCTTTAATGAATATTTAAGCCATC ACTTAAAACCTTCCTTTGGATTTTATCAAAAGGAAACGAGCATTTTTGAC ATATCGAAACTTTTGGctcgagttaaaaaaacaaGAATCATTAAGTATCT GGGTTGGGTAGAAGGTGGTACTAGACAATTGGTATTTTTGGCATTGCTCT CAACTCTCATCAAACTAaccaaatgaaaataaataagcCTTTGTATTTTT ACTGCTAATTTATGAAATTTCCAGTATCGTTGCCAATTCTACCTTGACAA ACGAAAGGATATTATATTCTAAGCTTTCTATTTTGGAAAGAGTTTTGTGC GACGGTCTGTTTTTGTGTGTCTCGGGTATGTAGTTGTAAGCAtttcaaaa tttcgattttctCAATGTCATGGATGTTAtcataacgttagatgaatatT GAAAAAACGTTTTGTACCAACTGAGAAACATTTTGGTGCTCTAAAAATGG ATACGGATATTGGCAATTGATTGAAATTTAGTCATGGGTTTACATTGTTT GTGGCTTGGACGGCGGAATTTATATCAAACTTTTGTGATACAAATTCAAA GGGGACGTAAAGTCTAAGTATATGCTTCATTTTTGTCGCTTAGACTAACT AAGTCACTTGGCTCCAATGTTTTACAGAATTATCAAAATGTATTTCCTTT TCAATACATGTATATAGGTTTAATGTGCCTACGTTtccttttgacaaaat atgatgaattttaagtcaaatttaaacaaaatataGTCTTTACTAATATA AGTTTGTCATATTTGAtggtattttgaaaattttcataagcTCGCATTCT TAATGCCAGATTTTGAGTCATCTGGTATTTATCAAACTTCAGCATAATTT TTTCCATTATAGCGTATTATAAAGTTTGAGTAAGTTTGACTTGAAATCTA AATTTAGTAACATTTATGAAAATTAGAAACATTTGAGTCATTTGCGCTTC TTGTTATGTTTTAGGTCCTATAAAATTAgggtaaatatttttgaatattt ttaaaaaatattgaaactttgaaaataacaaaaagttacaaactggttta aaaaaattataagtcTATATTAACTAatgtcaaaatgttaaaaatctttt atgtCATTTCCAGTCCACTTTATAACCTAACACCCTAtatgaacattttt tatttcctgTTTTGATAAGCGAATTATTTCCGCCCGCGCGTTCAAAACAT GATAAGAGGTGACATATTTCATGAGAGTACGTCATTTAAGGTGAACAACT GTTTGTTAGAGTGACGCGAGATGAGACTTTACACTGTATCTTCTGTATGT TAccgttttatattttcttataatgatgatcaagaaatcagtcaTTTAGT TATTACTAAGAGTTTAGAGAaggtttataatattttttaagctTGGTGTA TCATCCTAGTTAAGTCAGTCAAAGTCTTTATGAACAAATTTTAAAGTGTG TGAGGTGTCTTTGTCTTAGAGTATACCTTAAAACGCAGCTTTAATTCTTT ACGACTCATATGTACACGCACGTACAAACAGAGTTAGAATAACGTTATCA AGCGCATGTATTTTGACTCTGGCATAGAGAAATCTTCTGGGTAGCAAAGC GGTATGGCAGTATCAATTTGAAGTTGAAAAACACTTGGATTTGATCATGT AGGGcacctttaaaatttttccatGTTTGAGAGAGACATTAGTGAAAATA GAGTCACGGGCTGTGATGTAACGTTTTGTAACTATCGCAGCTCATTTATC TATGTACCCATAAAGTTAGAAGTGTCGTGATATTAGTGTATTGTTTTGTT GTGTCCTTGCCTGCAAACAGACTTGTTGTTTACTGTTTGTCTggcgtttt tgtttttgttaaaaatggaGTCAGTCTCCATTTTCCATGTATCAAGTTTA AAACTAGTCTCTTGTGTTGGCTTGCTCTGTTTATTTAAGTAAACAGTCTT GATACTTTATATATAGTCTGTTTGTTGGCCCTCTTGGATTACTTTTTTGG TTGCCTGGCTTTTTATACGAAGCAGTCGTTTTATACTGAGATAGAATCAG AATTTTGCTATGAAATAAGAATTTATTGGTTATTATAGATACAGCGGAGT CACTTTAACTCgaaactctataactcgaatgtctattctaacttgaacaa gttttcttgCCTCTTCAGTTAAAAATACCCTATTACCCNAAGTCATTTAG TTATTACTAAGAGTTTAAAGAAggtttataacattttttaagctTGGTGT ATCATCCTAGTTAAGTCAGTCAAAGTCTTTATGAACAAATTTTAAAGTGT GTGAGGAGCCTTTGTCTTAAAGTATACCTTAAAACGCAGCTTTAATTCTT TACGACTTATACGCACACGCACGTACAAAAGAGTTAGAATAACGTTATCA AGTGCATGTATTTTGACTGTGGCATAGAGAAATCTTCTGGATAGCAAAGC GGTATGGCAGTATTAATCTTTGTGAAGTTTGCTAAAATTCGTACTTGAAA AACTGTTGGATTTGATCATGTAGGTcacctttaaaaaattttcatgtttG AGAGAGACATTTGTGAAAATAGAGTCACGGGCTGTGATGTAACGTTTTGT AACTATCACAGCTCATTTATCTATGTACCGATAAAGTTAGAAGTGTCATA GTACTGTACTGTTTTGTTGTGTCCTTGCCTGCAAACAGACTTGTTGTTTA CTGTTTGTCTGgcgtttttgttttgttaaaaaTGGAGTCAGTCTCCATAT TGCATGCATCAAGTTTAACTAGTCTCTTGTGTTGGCTTGCTCTGTTTATT AAAGTAAACAGTCTTGACTTTATATATAGTCTGTTTGTTGGCTTTTTTAG ATTACTTTTTTGGCTGCCTGACTTTTTATACGAAGTAGTCGTTTTATACT GAGATAGAATCAGAATTTTGCTATGAAATAAGGATTTATTGGTTAATATA GATTCAGTAGAGTCTTTATTACTCGAACCTCTCTAACTTGAATTTCTCTT TAACCCGAACAAGTTTTCCTGTCTCTTCAGTTAAAAATACCCTATAACTG TTACTCcatatttctaaatttccttaactcgaacaaatctgTGTTCCCCA TGCTTGCTCGAGTTACAGAGGCTCCACTGTACTTTCAATACTGTATTTTT TTGTCTCTCTGACTATATGTCACGACTCAGTTTGGGTTTAAACAACGATA GCAACGACCACCATTAATCTTTCAACATTTTGATTTCGTTTCAGATGAGC ACAGCAACAACACAACAACAATATACACAACATTATCAACAATATTCTTC AATACCTTCAACACATCACAAGATGGATTCAACAAATCCCAATCAACAAA CTTCATCCATGAATAATGTACAATGTAGACCATGCCTTAATCGGTTCTTA GAATTAAGGAATCAAGCCATCAACAGAATGACAATGGAGTATCAAAAGAT ATGGACTGGCCAAGGAGTACCAGCGGtaagatttatttatttatcctTCA TTTACCTAGCTGgaacaaaacgttgtttcaacgttcgttTAACTTTGTAT GATTCCTATGGGCGTTAGATGGGCGTGAGTTTGATGATTTACGCAAGTAT GTTCCTTTGTTATAGGTTTCAGTTGAAAATTGGTTCTAGATTAAGGAATT TTTTGTGGTTTTGACAGTGTTGAAAATAAATAGACTCTTTTCTCTCGCTA CCCCAATTTCTACAAAGGGCTCTAAATTATGGTTCCTTAAAATTAAGTGG GATGTACGTTCCAGTTTAGTATGGCAAGATTCGGATATGTTTTTGTAGAG AATTCGAACTGAAAGAGATTTATTTATTATGTAGTCCTTGTAATTCACTA TAGTAATTGTTTGGTTTTAGTCTGGATTGTGATAGTGCAAAGTCGATTTT TGGTTTCACATTCTAGCTATAGAAATTGATAGTTACAGAGAATTCTCTat ataactcgaatatctccttaactcaaacaagttttaagaccctttcagtt aacaatgccctaTAAACCTCCATATCTCGAAATTCCCTTAACAAATTTGT CTTCCCCGTGcctgttcgagttatggaggctcCATTGTAGTTATTAAATA AGGTCACGAGCCGTTTTGACGTTAAACAAGTGCAAGAGagaaaaaaacga agaaaaaccTTTGATAGTTTTGTGTtacttttataatattttttggcAGG ATTTGTTCTATCTTGTTTGAAGTAGTGTTTCAAAAATCCTAAGTAGAGTT TACCCTAAAAAGTGTCACTGCTGATTGAAAGAAAATATCTGTTTCAAGTT CTTATCCTCAAGCCTGTTGTAATGAAAGCATTTTTTAAGATGAAACCAAA ATTCAGTTTCAGTCCTTTATAAACTGCAACTCTTGCAGAggacgcaattt tttttttcgaattatggAGTACTTGAGACCCCATGGAGTAGTAGAAAGTA ATAGGTTTGTGGCTTGAGGAGTTagtaagcccgggggggggtactagggt tggcgaatgaggggtatgtgcggatgggacctccgaaaaccgacccttaa agagactgatctttgctgaaaaggtgacccttagagagactttttgaaat tttttttaaaaagtcataccctggaaattaaaaaatttcctaaaaatcct gaattttccgaccctcagagagactaatttaaaactttctgatttttcgg acccttagagagactttgaaaggtgaaaaaaccgacccttaccgtctgca catacccatcatccatttttgcctaagtacccccccccctggggtaAGAG ACCGTGCTCGGTTTACGAAGTGATTCGAACTATAGAGAATCTGTTGTATT CGGGTTAACGCCAATAAAAGTAAAGCTCttccaacctcgtccccgtgtat tccaggctttatatACGTTACTGATAGACGCCAGACAATGCCAATGTATT ATCTGGCGCTATCAATaggcatcaaaaagctgatgatACACAGGGAACGG GGTTGAAGCTCTCCttcaaacaaatcaaattggATAATACCTAATATGGT TTAATAATTTTATTAACCGTTACAGGTCTATTTTCTCAAAGATTCTGTCA CTTCTTTCCTTAATTCTTTGaggtttactttttttaaacattttttacaa aacgGTGATTTTTAACCAGACTATCCTTCCCGTCTGACCACTGAAGATTA ACATTTTTCATAGCCATTATAAAGATTTAAAGAATGAAATTCTGAAATTC TGATCTTAAGATCGCATATAAATGTTGGGATGAAAGTTTCGTTTGCAGAT TGAAGGTTAATTAATCATTGACTATGTTTATTTGGCTCTACCATAAATCT TTAGGCTCAGATTAAAACTATTATTTAACTCAAATCCACGAGTGTGTTGA TCTTTTCAGCCAAGGAATAACTATTTATGTCTACTTTTAGACTAAAAGGA GATTGACTGCTTTAATCAAGTAATATGTAGTAGTCTTTAGTCACAAGGAT TATAACAGACACAGTGTGTACCAAGCCTTATTTGTTTTTAACGCTTCATT TACATTAGGATCTTTAATTTAGGATTCTGTTTACATGTTAAATGAAAGTT TATATCtatgagatttttttattttctcaggGACTACTTTTTATTGTTTC ACGTCTGTAGTTTTGTTTTAAACGATTGAtagatcaatttttttgttcta aATGTAGAAAATATATGAAAACAGAAAAGTATTAAATAGAGGGACATCAT GCTGGGTCAAAGGAGACTTTGGCGTCGTAAAGGCTAAAGTATCAAGTTTG ATTCGCTGTAAGGAGTATCTGTGAATCAAATCTCTCAAAAGTATATAGAG CGTATTTTGATGAGAAGGAAGGAAATTTTTCTCTAgagacgaaaaaaaat tacaaaattcgTTTTATAACCGTCATATTTCTATCGGAGTTGAGTATAAA TTCGGCGCGCAACGACAAGGACTTCCATGTATTTTTTACGGTTTTCGAAT GTTGCAGGAAATTGACAGGAATGACAAATTTGTTCTGGCTATAGAGAGGT TTATTAAAAAGAGTTTTGTGAGCTTAAAACGGGAGATTTGAGTTTTGCTA GGACGAGTAAGTGTAAAGTACTTTCATTTTTGGCGGCTTATATTAGTGGG GCGTACGTGATTGTTAACCcgaaacaccgaaacaccgaacAAGAAAAAGG GCtaataccgtcacaccgtcaaacCGGCATGCTCCTCTTAATACCCGGTT CCGTCTGGAATCCAAAGTGTTGTTGAAATTTTGTGTCAGCTGTGAGGTAT TTTTCTGAgtggtacacgctttttttgaataagaatacactttataagaa aatggccaaaaaatcaagataatgctaagaatatcaccatcatggaattt ggctactcaagctaagaataccatttttagagcattttcgattataaatt gccaattaccccaaAGTAAGGCTCACTACTTTCACGAacatgccatttta tgcttgagacgtatgtactaaatgataaatctagtctgaattaggatcct aacctaagaatgttgtaagaatattttatgatgattttccctaaaaagct aagaatattcatgatgaaatggatttacaccattcttatgcAAAAAAGCG TGTAGGTAACCTGTCACAGACAATGGACATGGTGTATGGAATGGTTATCA GTGTGGCGTATCAGGCACTAAGAGTAGAAAGATTGACCTTTTCACACTCT TGCTACTAATTTTAGACCATAGGATAGACTTGAGTTTATTTTGAATGGGA TAGCCATGCGGTAAAACACAACTCAAAgaccaaatcaaaacattccaaaa GTGAACATATTTGTGTGTAGAGTATAGAGAGCCCCTATTTTTCTCCTTTG ACAACGCTCTCTCTCTCTCCCTCTTGTATTTTATTTCATCGCGACAGTTA CGTGTTTATGTTAAAAGAATTTCGTTTAGTGTTGGACTGGAGTTTGTTGT CATTTTTGAGTGTTCTGTTAGTTTCTTACAGGTTGGCCGAACTAACTTTA CAACCATTAGAAGAAAATTTCGTTTCGTTTTTCATAGGCTAGAAGAGTCG TTCATTATTCATGTAATACAGTATAGTGTATgtgtgttatatgataatac gataattgttgCTGGATAATATCAGTTTAAATTAACTATAGTCTACAATT ATTTTCTGCTTATTCTATGTATAACTTAATCGTCTAGCATGCACTACGGC AGCATACTAAATGAATACATAGGGTTCAATTCTGAGACTGTTTTTTAAAG AATTCAATGGTTTTGTTTAAAGGTGCAGTTTATTTTCGAAATCTTCTCTC AAAATTTTAGTACGCTCTGGTAGATAGGAAGGTTTTTAAAATCTGATCTT GAGATTGTCATTATATGTACCTACAAACCGTCTAGATTTATTTTAAAGGA TCTAAGCTTGACTCACACTATTGACTATGAAACAAGTTGTAATAGTGGGA CGGTACCTAGGAAATGCATTAGCTTCCGATATTATGGTTTAATAAATAAA TGACTTGCTTCaacttgcattttttttttgatNCAGACgcagtaggattt tttcaagccagttgggataaaaataacggactgaaactcgatggggattg gtattccaatattttttatggctggggatttcaattcttttgtttccaag tcagaaaattcagtagggatggGAAAGATAGCATAATATCTATATCTTGT AGTGAAGTTTGgttcatttgattattttcggtggagacaaaaattggaga ataattttctacgggggacgatattttggccaattcttTTAGTGGGAAGT GTTAagtgagtctgtgagaaggggtgttttTAGCTGTACTATCAATGACT ACAGTACTTTCATAATCACTGGAGCTCGTATaaaacgtcataaaaatgtt catataatgttagatgaaTTTGGAAACAACCTTGATTGTTAATTGGGAGC TTTGCAGAAAGCGAAACATCTCCATAACGCTAAAAGTTGGCTTTGCTATG GACACTTTTGCAAGCTATTGACTAGATTATGGAGAATTTGACATCATAAG CTGACAGTATTTACCAAACTTGATGGAGTTATCGCCAAACTTTGAAATCA TGCTGTCATTAAAGTTTACTGTTTGCATTTAAATGTACAATAGTGAAAAG AATAgtaaaaatctggtaaaataaATATGTTTTAGGCctagaagtttttt ttataagagcatccaaatttttccaaagccttgggatgttcttaaccttt tgagttttttgtctaaaaatgttcttaaaacgattttgtgagtgtttctg tgcaatttcctaaaaaattggTTGCCATAGATTCCAGtaatatgttctta acttgttcttaatattttggtcatcgatgcagtgtgttcttatatagctt gttcttataaagaaacgttcttataaagaaacgttcttataaagaaacgt gtAGTAGATAACCTCAGAGAAAGCCAACAGTTCCAAACAAATCAGCAACA AACACATAATAGGAGGGGCTGAATTGAATAATAGAGAAAAGCTAATAAGG TAACAAGCATAACATATAACATTATGACAAGATAATAGGGAATTTNATTT CGTTTttcatagactggagtcgtttatttTTCGTAGTAATACAGTGGTGT ATTGGTGTTAtttgataatacgataattgttgCTGGATAATATCAGTTTA AATTAACTATAGTCTACAATTATTTTCTGCTTATTCTATGTATCGTCTAG CATGCACTACGGCAGCATACTAAATGAATACATAGGGCTCAATTCTGAGA CTGTTTTTTAAAGAATTCAATGGTTTTGTTTAAAGGTGCAGTTTATTTTC GAAATCTTCTCTCAAAATTTTAGTACGCTCTGGTAGATAGGAAGGTTTTT AAAATCTGATCTAGAGATTGTCATTATTTGTACCTACAAACCGTCTAGAT TTATTTTAAAGGATCTAAGCTTGACTATTGACTATGAAACAAGTTGTAAT AGTGGGACGGTACCTAGGAAATGCATTAGCTTCCGATATTATGGTTTCAT AAATTGACATTTCATGACTTGCTTCAACTTGCATTTTTTGATGAATTGGA TTCAATGCCCTGGTAAATGTAGATAATGTTGCAACATTAAGTGTCCCTAT ATTTTTGGTACGGAAAAGGTTCTTGTCTGGTCTACTAATAAAGCAGAGCT AGCTTATCATTTTAAGTTTATTTACTTATGAGAGGGAGTTTGTGAGAGTA GCTAGCTGGCAAAAAATATCGCTTCAATTTTAAAATAGTTTTATATGGAC GTTGGAttggccccggggggggggggNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAAAAGCTTTTT AGTGTTTACTTGTTGACATTTACTCAGTTAAATAGTGAAGTACTCACAGC GAGAGAGATGTGGTACTAAATGTGAAAGAggatttcttgattttcttgat ttcttcATATACGACTTATGCATATAACTCacgcaaaaaaagatttttct ctttttattttgGCTTGGAGAGGACTTGCATGTTCGCTGATCCTCGaaga ttaatttttttgtgttttttaatttttgaaccTGTCACTGTTCTTGCATT TAGTTATTAGTTGTAGTTAGTCATGCAAAAAAGTTAATCTTGCTGATATA GTGTCTTGAGGTGCAGGCTGGTTTAGGCAGTTgtattgaagtttttacaa gatgctcacataattggttaaagtttttgtttgaatagttaacgaccaat cctatgacaaaaattcttgtaaaatgttcaacttgacccGATTTAGGCTA CAAAagccaaaaaaaagtttgttccATCCAGATGTTTATTTTTGGTCTTT GGTGGAATTTGTGTGTAGATAGAACTTCACTAACGTATGCAATGCTGCAA CCTACAAATCTTTTCCCTTTTGCTTAGTTTTCTTAAGCTTTTGGAAATAG CTGGGTGTCTCAGCTCTATTTACTCTTGTTATATCTTTATCAAGTAATTA CCTTGGGATCATTTACAtagacactttgttttgaacTTGTTTAATATGCC TAGCAGACTTGTGTATGTCTGTAAAGCCttttggtctttttttttaatta aaggtACACTTGACTTTATGTCATATTGCTAAATTTGGTCTCTGAGATCG ATTGAGAGACTAAAGgggttaaaataaaaaaaggatttttcttTCCCCCT TTTTTGTTGTATGTTTGTTTGTGAATGTTTTGTAGTTTGAAGGACATTAG TATAGGTATGTGATTTTTTATCATATTGTTTTTTGGAAGTCagttcattt tgtttttgttgtttgacGAATGTTCATACTAATTGTGGAAGTTTGAAGTG CCATTATTTATTgcaattttataaaaagactGGATTCAAATTTGTGCAAG ATTGATTTTGGTTCGGCGTGTCTTTTTTAAATACAATGGATTCTCCATAA CTCTAACATGCCCGGGAATCACAAATTTGTTTAAGTTGACGAGATTTCGA TTTACGGAGTAAGGTTTACAAGCCATTGTAAACTGAAGGATACTTGTTCG AGATAAGGAGTTGTGAgtaatagaagttcgagttaaagagactccactgt attttaTTATGTCCGACTGATGTTTTTGAAATatccaaatttgaaaattg atgcaatttcacttttatctaTGTTAATCTGGTAACGTTGCTCATCAAAA CAATTGCATCATTCAAATTTTAGGAGTTCGATGCCAAATACCAAGTATAA ACCATGCAACTCTTTACTGTGACGGACACACTCCATGTAATATATTTCCC CTTTCTCTCTTATCTTTTTAGATTGATAGCTTAAATCATCTCGTCTATCA AAGCTTACGACTCTCAGACCATGAATTAACAGGGACAGTCAACGGTAAAT GTTTATATTGTGATTCACATGTTGAAACGTTAAAAAAATCCGCACTGGAG GTTGTTAAAACGCAATTTAATCCGTTTCTGAGGAACATGATTCCATATAA CAACGACACGAATAATCTTACGGCAGCcgaccaacaacaacaacaaagca TGCTGGTTGATCGCAATGTAACGACGCGCGGTGAATCAACGGATACTTTT AACGGATATCGAGTACCAGGTAAGGAGGTTTCGTATTATTTTCGTAATAT TTTGTATCTTTTGAACCTTGCTCTTGACCTTACTCAATACACGCCTTTTG CAGGAATTTCGTATTTAATAAGTCCGATATTTACCcaagtttttatgaaa aaacaatttacGTTTCAATCTCTAGGGCTAAACAATACTGTTGGAGACTC GCgttcaaatgacgtcacacttcATCAATACACTAATCTTCACCAACCAG ATATGGGCAAATCAACAACCAACCAATCAGCTCCCTCCAATACAACTAAT CCGACCAATCAGAATTCGACACGATCAGCAATGACATCTCAGTTCTTCGT TGAGTAAGTGTATGAGCATTATCATTTCTTAGTGAATCTATTTCAGATTA TCTGTTTATCCAATAAAAGTGCTCAATGCTAACAATGATAACAGAGCTGT ATGCTTTCACTGAATTTCACTGAAGGTTACCATCTGTATGGCCTGAACCT TTATGATATTTACTTAACTCGTTTCCATTACTCAAACTAGTATCTTGCAA CCAAAAACCAACTCATAGGTTACTGGTATATTTTAACTAACCCTAATTCC TTTAATACCTTTTGTAAGGGGGACGACTCAAAGACACTTTTCAACTTGAT CTTCTTTGATCTACATTTAGAATTGTAGGAATAAGTCTTAAGACCGCAGT CGGAGGTAACCCGAAGACCCCAATTTCAATAGTCttctacctgaaggtag gggaggaTGCCACCCTTTcttcctggattgctccacCTTTCCTTGTTCAT TCTCTTTAACTGCTGAACACTAATCGTAGATgaatcaagtaccattttgc tGAGTCCGGGTGGgagttgaacccacaaccttgcgcaccttagctgaatg ctctaccactgcactactgTACCTGATATCAAAAGACTTACGATTTATTT ATTCCGTTCTCTTTTATTATCACAGGGCAGCGAAGAAATATAATGTCCGA AAGAATcgttcatcttcatcttcaaaaCACAAGAACAAAGAATCAAGTTC CTTGTTCCCAACCAACTTCACTAACATGCTGAAACAATCATCACCATCTA ACCCACCCGGTCTTTTCAAATATATGGGGCGTAGAGTTGATGGCAAGGTT TGTAGATTAAAAATATCGAACCTAGATGCGTACTAGTAGATAAAGGGCAG TTTTTTCAATCTTAGTTCATCATTTGGGCTGTCTTGAATCTGAAATGAGA TTGCACTTCATTTAAACACCAGCTGTTCAAAAAATACCAAGCTAATAAAA ATATCCATATtatttaaatttgtatttttaacCGTTTTTACCTTCTTCGT TTCCAGGTCTCTGTCATGTTACGCGTCCAACCTTCCATCAACGACCAATC AGATAACTCGCTCATCGAAATCGATCTTCGTAAAAAACAAATCTCCTTCT TACAACCCAACGCCCCTTCATCAACACCCTTAGACGCCAATCAAGCACCA CCGCCCTcccaaccaaaatattttggcttCGACAATATTTTTACACCGGA AGAACGACATGATCGAATATCATCTGGATCTCTATTAGACGTCCTACACG CTGTTATTAACGGTGGCGACGGGGCTCTAGTCACGTATGGAGGACCGGGA ACCGGAAAAACACGGACCATGGTCGGGCAAGATGGTAGCAGCACAACGGC CGGTATTTTACCATGCGCAATAGCATGGTTATACAGTTTAATAGACGATT GTAAACAACGAACGGGCGCCCGGATCTCCATACGGGTTTCCGCAGTCGAA GTTGTCGGACGTAACGAAGAGTTGAAAGACTTATTAGCAGATCAAGCATC TGGGACTGATAGTATAGACAGTCATAGTGCGTCACCTGGTATTTATTTAC GCGAAGATCCGGTAGGCGGGATAAATTTGGAGAATGTGAGTGAACCACAA GCAGCTAACAAAGAAAAAGCGGGCTTTTATTTGGATGCAGCTCTGGCTTC CAGATCAGCTGGTAAGTTCATTGGATAACTTCTGACgtgaaacaaaattt ttatcaaCGTCGATCATATAACGTTGGATAAACGTTTCTAGGGTGTGATT CTCCCCTAGGGAGATGACGGAATTTCTAATGGGGGATTTCTAATAATAGG AAGCAAATCATTGAGATCTGTAGTATCTTTCATATATTATATGTGTGATT GGTTCGAGATTATTATTAGTGTTGAAATTCCTTATTGATGCTGGGAGGAG TTTCAACCATCTTCAAGTTATTACTATTCATCTGATTCTAATTTTCGTTT TATTTATATAGAAAAAGACAATCAAGGAGTGACGCAGAATAGCCATATGA TCTTCactttccatatttatcaaTATCGCGTGGaaaaaaatgcaagaaaa atCCCGTCAGGTAAGTTGTTTCGTTTGGTATTTTGTCCTGctttttgatt ggttgattttccTTAGAATGAAAGGTTTAAAGTTTGCCtttccaatttct ttttcactatCGGGCTCGTAATATTGACAAACACGTATTGAATTTTGGTC CCGATTAATTTTACTTGTTACTTTTCCTCAACGTATATTACAAATTCAAA CGTACATTTCAAAAGTACATATTATAAAGAAACTAGGTCATCAGCGTTGC TCGTGGACCATAATCCCTGTAATCCCAAAGTGAATTTAGAATATAATTGG TTAAGTAGTAGACGACAGACGTCTTGAAACAAACTTGTAACCTTAACTTT CATTCAAGTGCCtctttaaagattaaagaaaaATACGCGAAAATATCGCG CGCTTAAGCTCTTGAAATTACAAGTGTTTTTCTAAACTAAGAAATTTGCG TTCACTATTTGTGTTTATTTGAGTCATTGACAAACTTTTTGGCTGTGTTT ATTGAAAGTAGTCACTAACTGACATGTCACTATTTCCTTTCATAAAGAAC ATGAACAAATAAAGTCCCCTTGTTTTTGACCAGCACACCAAACATAGTGA ATGTCAGTCAACCCTTCTTGAATGTTTGTTAAAACGATAACTTTAAACAT CCTGTTGTGTGTCCGTTAGCCATGTTACTTTCTATCACTTTCTCTCTCCG TCATTTTGAATTTGGTATCCTAGCTAGCACCATATTTGTACGTAAATATC TCTTCTGCGTGAATACAAAACGAGCGCTGTATTAATCTTTACCCTCCAAC TCCTAAGTTTGTTTAACGTAAATTTGATTTTGGCATTATAGTAATCAGGA TGATCAGGGGTAACgaaaaaacaaattgtaaacgATCAGAGCCTCCGATT TCaaatatcgcaaaaaaaaatgaatgttATAATTATTCTATGTCcttcag taaagaaaaataattgagAATATCATGAGAATAGTTATAGCCTGAAAATC AAGAATACCGAAAAATAACAACTGCACCAAACCAGTTTGGATTCTATAAT CGCTTATACTCACTCACACTTTTTAGTTTTTCACTCATATCCTAAATTGA CTTCAATCCTAACAATTCCACATTCTTTTTTCATTAGGTTCAGTACCGCA ATACTCAGGTGGGCGATCCAGGCTACATTTGATTGATCTCAGTTACGTCA ACCaaaatttcgaagaaaaaacatcACAGCCTAGTCAAGCACCTAGTCAT GCTGCGTTGGGTCAAATTATGATCACCATGCTTAATGGAAACAAAAAAGT CACGTTGTTCAAAGACAGTAAAATCTCACGACTTTTACGTGACTCTATTG GTAACCAAACGTGCCGAACAACCGTGATAGCTCACGTTTCTGCGGAAGAG AAAAGCGCACGAAAAACACTTCAAACGCTGAATATCACGCAGAAAATTCA ACGCAAACGTAGAAAAAGAAATAAGGTACGTAATGACGTAGTAGCGTAAG TACGTGGATAATCTTCAATCATCAAGGGAGACCCTTTAACTGAACTTAGT ACAAtaaagtctctataactcgataGCCCAcaagaaacacaaatttgttc gagttatatgGAAGTTTAAAGTAAAACAAACAGGTTTTATAAGGAATGCG GTATGTTTACCTAAAGGGNGCCTGAAAATCAAGAATACCGAAAAATAACA ACTGCACCAAACCAGTTTGGATTCTATAATCGCTTATACTCACTCACGCT TTTTTGTTTTCCACTCATATCCAAAATTGACTTTAGTCCTAACCATTCCA CAATATTTATTTCACTAGGTTCAGTACCGCAATACTCAGGTGGGCGATCC AGGCTACATTTGATTGATCTCAGTTACGTCAACCaaaatttcgaagaaaa aacatcACAGCCTAGTCAAGCACCTAGTCATGCTGCGTTGGGTCAAATTA TGATCACCATGCTTAATGGAAACAAAAAAGTC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000272XLOC_000272Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000419-exon-sc0000002-1491911889:173991..174037TCONS_00000419-exon-sc0000002-1491911889:173991..174037Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1510915933:173991..174037TCONS_00000419-exon-sc0000002-1510915933:173991..174037Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1575043694:173991..174037TCONS_00000419-exon-sc0000002-1575043694:173991..174037Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1491911889:184135..184365TCONS_00000419-exon-sc0000002-1491911889:184135..184365Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1510915933:184135..184365TCONS_00000419-exon-sc0000002-1510915933:184135..184365Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1575043694:184135..184365TCONS_00000419-exon-sc0000002-1575043694:184135..184365Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1491911889:194762..195059TCONS_00000419-exon-sc0000002-1491911889:194762..195059Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1510915933:194762..195059TCONS_00000419-exon-sc0000002-1510915933:194762..195059Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1575043694:194762..195059TCONS_00000419-exon-sc0000002-1575043694:194762..195059Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1491911889:195216..195393TCONS_00000419-exon-sc0000002-1491911889:195216..195393Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1510915933:195216..195393TCONS_00000419-exon-sc0000002-1510915933:195216..195393Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1575043694:195216..195393TCONS_00000419-exon-sc0000002-1575043694:195216..195393Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1491911889:196016..196187TCONS_00000419-exon-sc0000002-1491911889:196016..196187Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1510915933:196016..196187TCONS_00000419-exon-sc0000002-1510915933:196016..196187Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1575043694:196016..196187TCONS_00000419-exon-sc0000002-1575043694:196016..196187Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1491911889:196397..197051TCONS_00000419-exon-sc0000002-1491911889:196397..197051Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1510915933:196397..197051TCONS_00000419-exon-sc0000002-1510915933:196397..197051Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1575043694:196397..197051TCONS_00000419-exon-sc0000002-1575043694:196397..197051Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1491911889:197352..197450TCONS_00000419-exon-sc0000002-1491911889:197352..197450Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1510915933:197352..197450TCONS_00000419-exon-sc0000002-1510915933:197352..197450Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1575043694:197352..197450TCONS_00000419-exon-sc0000002-1575043694:197352..197450Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1491911889:198578..198662TCONS_00000419-exon-sc0000002-1491911889:198578..198662Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1510915933:198578..198662TCONS_00000419-exon-sc0000002-1510915933:198578..198662Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1575043694:198578..198662TCONS_00000419-exon-sc0000002-1575043694:198578..198662Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1491911889:199344..199422TCONS_00000419-exon-sc0000002-1491911889:199344..199422Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1510915933:199344..199422TCONS_00000419-exon-sc0000002-1510915933:199344..199422Clytia hemisphaericaexon
TCONS_00000419-exon-sc0000002-1575043694:199344..199422TCONS_00000419-exon-sc0000002-1575043694:199344..199422Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:173991..199422 +
Expression
No biomaterial libraries express this feature.
Blast
BLAST of TCONS_00000419 vs. Swiss-Prot (Human)
Match: KI26B (Kinesin-like protein KIF26B OS=Homo sapiens GN=KIF26B PE=2 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.048e-67
Identity = 148/384 (38.54%), Postives = 227/384 (59.11%), Query Frame = 3
Query:  729 AMTSQFFVEAAXXXXXXXXXXXXXXXXXXXXXXXLFPTNFTNMLKQSSPSNPPGLFKYMGRRVD----GKVSVMLRVQPSI-NDQSDNS-LIEIDLRKKQISFLQP---NAPSSTPLDANQAPPPSQPKYFGFDNIFTPEERHDRISSGSLLDVLHAVINGGDGALVTYGGPGTGKTRTMVGQDGSSTTAGILPCAIAWLYSLIDDCKQRTGARISIRVSAVEVVGRNEELKDLLADQASGTDSIDSHSASPGIYLREDPVGGINLENVSEPQAANKEKAGFYLDAALASRSAEKD--NQGVTQNSHMIFTFHIYQYRVEKNARKIPSGSVPQYSGGRSRLHLIDL-SYVNQNFEEKTSQPSQAPSHAALGQIMITMLNGNKKV 1844
            ++ + FF  AA+K N+   +        +     LF T+F+ +L+ S P  PP L + + +  D    GKV VMLR+  ++  D S++S  +++D RKKQI+   P      ++     NQ PP    K F FD +F  +     + +G++ +V+ +V+NG DG +  +G    GK+ TM+G+D S    GI+PCAI+WL+ LI++ K++TGAR S+RVSAVEV G+ E L+DLL++ A+G+        SPG+YL EDP+ G  L+N SE +A   EKA F+LDAA+ASR + +   ++   +NSH+ FT HIYQYR+EK+ +          SGGRSRLHLIDL S V    + +        S +ALG +++ ++NG+K +
Sbjct:  381 SVAASFFARAAQKLNLSSKKKKHRPSTSSAAEPPLFATSFSGILQTSPPPAPPCLLRAVNKVKDTPGLGKVKVMLRICSTLARDTSESSSFLKVDPRKKQITLYDPLTCGGQNAFQKRGNQVPP----KMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGARFSVRVSAVEVWGKEENLRDLLSEVATGS---LQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSHQQDCDEDDHRNSHVFFTLHIYQYRMEKSGKG-------GMSGGRSRLHLIDLGSCVKALSKNREGGSGLCLSLSALGNVILALVNGSKHI 750          
The following BLAST results are available for this feature:
BLAST of TCONS_00000419 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KI26B1.048e-6738.54Kinesin-like protein KIF26B OS=Homo sapiens GN=KIF... [more]
back to top