Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000402 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000402
Unique NameTCONS_00000402
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3033

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000402 ID=TCONS_00000402|Name=TCONS_00000402|organism=Clytia hemisphaerica|type=transcript|length=3033bp
TTAAGTAGCCTTGTACTATCAATCCATATGGTATAAGAGCATCTGATcca
aatttggtgtttttttataaattcgGACATTTTTACACTGATCACTACTT
agaaatttattaaatttaGTGAAATGTATACATGTACTACATAAAAGCAG
GGAAAATTCCGGGCAGTAGAGGGTAAATATTGTCCCAAATCTTCCCAGAA
TCTTATACATATAATTTTCTTTCCATTCAAGTGaaattagaaataaaata
tataatgTCTCAATAATACAAAAACCATGTACCAGCAAGGTAGTAGTGGT
TACTATGGTGACGGTGGTGGCCAATACCATGATgaaggaaatcaaaatca
atatgGCCATAACTACAGAGACTATCGTATGAATGACCAAAGCATTAAag
gaaaaattgaacaaaaatattggaaaactAAACAGAAAGCTATTGAGAAG
TTAGGCAAAGATCAAGATGAATTTGTTATTGCTGGGGATGCTGAAGTTGA
TGCACGGTTGGAGGCATTTCAACACATCAAAATCACGTGTATGCAATTGA
TGGCAGCAATAGAATgctatcaaaataaaatatttgCTTTATCACAAGAT
GAAAATGAGATGGGTAGATTTCTAAAAGATCAAGGATCTCTTGACAAAAC
CAAAGCTGGTAAAATGATGATAGCTGTTGGTAAAGCGCAAAGTTTTGCTG
CGCAACAAAGgCTTGGAATGAGATCATCATTAGCACGTTTGTATTCAGAA
ATAGAAACATTCAGATTTCGTGCTATCCAAGATACACAATTAACAGTCAC
CAAGATGGAAACCTCTCGATCAGAATATCGTGCTCGGCTATTATGGATGG
CTGATATATCAAAAGAGCTTGACCCTGACCAATTCAAACGTTTGGATAAA
TTTCGAGATGTACAAATGCAAGTCAAactggcaaaaaaaaaatttgatca
gTTGAAGGGTGATGTCATTCAAAAGATTGATCTTTTATCAGCAAGTCGTT
GCAATCTTCTATCTGCAACACTAGAGCCCTACCAAAGCTCTATGGTCAAA
TTCTTGAACACTACTGCTAAGAGTTATAATACTGTTCATGAAGAATACAA
AGGCCATCCGTCCTACAAATTCAACattctaaaaaatatcattCCAAACA
ATGGTATTGtggatgatgaagaagatgatCTCGCCAACGATCAAGACAAC
AAATCATCCAACAAAGAGAACAGAAGGAAAAAGAAAACTGCAAAACCTGA
ACAAGCAGAAGAAGCAACAGAAGAAAAAACATCTAATGATGACGACGGTG
ATGACAAACTGATCAATTTCGATTCTTCACCTTCGGAAGATGTGGACCAA
GGTGTTGTTCCGAAGCCTACCGAAAGAGATGCAGATTTGCTTGGTGCATC
ATTAGATCAAGACTCAAGCCCTGGGTTCGGTGATTATACTGAAACTAAAG
ACAACAACGAAGGATTTGAAGATTTACTTGgcaaatttgaagaaaacaat
GTACTAGCTGACAAACCATCGCATCAACCTTCGCTGATTTCAACATCGAC
AGAAGATACTTCCGATCCTTTTTCATTCATCAGTAATTTGGATTCTGACA
GGCGTAAAAGTGATACAACACCACCAACTAAAGATTCACTACCAGAGCCT
TCAGTTGATGACCTACTCTTCGGTTCACCAAACCGTAAACTGGATGGCAC
CGAGAAAACAGATTTGGACATCCTAACTGATGTGTTATCCAACCAAAATC
TCGGTATTACTGAAACAGAACATAATAAGTCGTTCAGTGATCAATGGCAG
TCTATGTTTGGTGCTGGTGTATCTGAGGAATCAACACCATCAATGTCTGA
CCTTCTTGCTCAAGATCTGGAAAATAGTAAAAGCGATTCTACACCAAAAC
AACCTGAGAATATGGTTGATGCTAACATCAAGAGTGATCGAATGTATATG
CCATCCTTTTTATTGGAGCAAATGAGAAAAACTGATCCacaagctttgaa
aaatggtcCTCCCAAGGGTGCATTAGCTGTCAAAGACTCTGCCAAAGCCA
GTTCTGGTAAGCCTGGTAAAAGTGGAGAGAAAGGAAAAGACATGTCTGCA
TGGTTCAATCTGTTTGCTGATTTGGATCCACTTGCAAACCCGGATGATAT
AGGCGATTCTAAAGATGGCCAGAGTGAAAAACAAGCCTGCTAAAGTTTGA
ATCAAATGAATCTATTATCGTTTGCTCCTCCTTGAAATCTACTCAAAATG
TGTTTTTATcagatgttgatattttttaccAAGAAGTTATTTAAAAGCCA
AGCTGTATAATTGTCATCGTTCAAATAATGCGAATTCATCCCAAATTCCT
GTGTTAAATCTGGATATGTCCAAAGATGGAGTTGTGTAAATGCTATTATG
CTAAAGTTGTCCAAGATTTATTGAATCAGATATGCAAGCTTGTCACTTTT
ATCCTCTGTGATTGTAATCATATGATCCAAAGCTTGGCTTAAAATGACAT
AACTCATCTCAAAGGGCTACAAAGCTTTTGTTCGGTCGCTTCCTTCAGAT
TTCTTTCGATTCTAGGGTTAATTTTAGCCTCAAAATGATGGTTAGTGTAG
CGTAgcttttatactattttttGGGTTTAGTTTTATTGAATTTAGAGGGT
GTCCTTAGCTATTTTTGTTTCGAAATCGAGACaacaattatttatttttt
atttacaaactTATAGTATTATAAATTTATGCAggataaaatattatttt
gatcttttttttctcttttcttttctgtggtgaaataattttgaatttta
ctgTGAAGCTAGTAAATAATGATAAAGGTACATGAAAAAAATGGAATtgt
attttaaatgaatttgaaaagaaaggtGAAgaaattcttacatttttttg
tgtttgacCCAAAATGGCTGGTTTCCACTTTCCCTGACTTTCAAGGTATT
GAAACTTTTCATCATGGTTAACTAGTGCATAAAATAGATCCCTTCATGGA
CTACTTCATTTTGTACTTCTTGGAGTATCCTAG
Run BLAST on NCBI

protein sequence of TCONS_00000402-protein

>TCONS_00000402-protein ID=TCONS_00000402-protein|Name=TCONS_00000402-protein|organism=Clytia hemisphaerica|type=polypeptide|length=638bp
MYQQGSSGYYGDGGGQYHDEGNQNQYGHNYRDYRMNDQSIKGKIEQKYWK
TKQKAIEKLGKDQDEFVIAGDAEVDARLEAFQHIKITCMQLMAAIECYQN
KIFALSQDENEMGRFLKDQGSLDKTKAGKMMIAVGKAQSFAAQQRLGMRS
SLARLYSEIETFRFRAIQDTQLTVTKMETSRSEYRARLLWMADISKELDP
DQFKRLDKFRDVQMQVKLAKKKFDQLKGDVIQKIDLLSASRCNLLSATLE
PYQSSMVKFLNTTAKSYNTVHEEYKGHPSYKFNILKNIIPNNGIVDDEED
DLANDQDNKSSNKENRRKKKTAKPEQAEEATEEKTSNDDDGDDKLINFDS
SPSEDVDQGVVPKPTERDADLLGASLDQDSSPGFGDYTETKDNNEGFEDL
LGKFEENNVLADKPSHQPSLISTSTEDTSDPFSFISNLDSDRRKSDTTPP
TKDSLPEPSVDDLLFGSPNRKLDGTEKTDLDILTDVLSNQNLGITETEHN
KSFSDQWQSMFGAGVSEESTPSMSDLLAQDLENSKSDSTPKQPENMVDAN
IKSDRMYMPSFLLEQMRKTDPQALKNGPPKGALAVKDSAKASSGKPGKSG
EKGKDMSAWFNLFADLDPLANPDDIGDSKDGQSEKQAC
Run BLAST on NCBI

transcript from alignment at sc0000002:119386..125916+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000402 ID=TCONS_00000402|Name=TCONS_00000402|organism=Clytia hemisphaerica|type=transcript|length=6531bp|location=Sequence derived from alignment at sc0000002:119386..125916+ (Clytia hemisphaerica)
TTAAGTAGCCTTGTACTATCAATCCATATGGTATAAGAGCATCTGATcca aatttggtgtttttttataaattcgGACATTTTTACACTGATCACTACTT agaaatttattaaatttaGTGAAATGTATACATGTACTACATAAAAGCAG GGAAAATTCCGGGCAGTAGAGGGTAAATATTGTCCCAAATCTTCCCAGAA TCTTATACATATAATTTTCTTTCCATTCAAGTGaaattagaaataaaata tataatgTCTCAATAATACAAAAACCATGTACCAGCAAGGTAGTAGTGGG TAAGATATAATTTCTTTTCTCAATGAAATGTGAGCATCAATTATCGCGTA CCTATATGTGATCCAAAGGTGATACCAGGCCAAGCTCTAGAAGGGTAGAG ACATGGCAGGACTGTTTATACTAAAGATCAAAAAGGCTCTTTTTTACATG ATTCCAAAGACCAAGAATAAATGGTCTAGATACAACTTTACCAGGCATAA TGCTACAATTAATGCTAAATAATGAATGTTTATTACCTAGTTACTATGGT GACGGTGGTGGCCAATACCATGATgaaggaaatcaaaatcaatatgGCCA TAACTACAGAGACTATCGTATGAATGACCAAAGCATTAAaggaaaaattg aacaaaaatattggaaaactAAACAGAAAGCTATTGAGAAGTTAGGCAAA GATCAAGATGAATTTGTTATTGCTGGGGATGCTGAAGTTGATGCACGGTT GGAGGTAATTGGGTTTTTAGATAGAACTAATGTCATTTTTGTTCTTGAAT AGTAAGTATTGATCGTGTAAATAAGTCCTGAAAGAGTAATTATTTTTATT GCTATACTTTTAATATCATTACAACCATTGATTACTCGTTTAACAGGCTG GACTGACCCTTGACAAAACAACAAATTGATTTTGCATCACCTAATTTATT TCCTCAAATGATTGAAAATAACATCCTGTTTTTCTTCTAGGCATTTCAAC ACATCAAAATCACGTGTATGCAATTGATGGCAGCAATAGAATgctatcaa aataaaatatttggtAAGTGAAATTACTTTCTTCCTTGATCATTGTTATC CTTGTGTCTTTGATTTGAATCATCCAGTAAACATACTGATGAGGAAGGGG ATTGAGCTTAGAGAACTTGGCGAGGCTCCTGACTTGTTGTATTTATGTGC TTTCAAGCACATTTCAGGTagcttttaaaaacaaacagcAATAAAGTTTA AAAGCTACAGGGTAATACCAGTGTTAAACAATAAAAGATCTGTCTCCTCA AAATTGTTAAGTTgctttttaatttcaatattgttgaTCGTTTTCATAGC TTTATCACAAGATGAAAATGAGATGGGTAGATTTCTAAAAGATCAAGGAT CTCTTGACAAAACCAAAGCTGGTAAAATGATGATAGCTGTTGGTAAAGCG CAAAGTTTTGCTGCGCAACAAAGGTAATGATCAATGTTTATATTTGAATA AACTTTAGGAGAATTAGTAGAATTATTGGGAGTTCCAATATGAATAAACA AAAGATGGGTTAGCAGCCAATATATAGTTTGTTCAAAACTTCTTAGAATA TTGTCGCAATTTCTATAAAATGATTAAatattttcctcatttttaggCTT GGAATGAGATCATCATTAGCACGTTTGTATTCAGAAATAGAAACATTCAG ATTTCGTGCTATCCAAGATACACAATTAACAGTCACCAAGATGGAAACCT CTCGATCAGAATATCGTGCTCGGCTATTATGGATGGCTGATATATCAAAA GAGCTTGACCCTGACCAATTCAAACGTTTGGATAAATTTCGAGATGTAAC TTTCcttacttttttcttcttcacaaTTTAATAACATTTCTGTAATCAGC TGTAATATGAAATAtgttcagaaattttcaaagttcacTCAGTCTAATAA ATTCTAACCTTTGATCATTTCAGGTACAAATGCAAGTCAAactggcaaaa aaaaaatttgatcagTTGAAGGGTGATGTCATTCAAAAGATTGATCTTTT ATCAGCAAGTCGTTGCAATCTTCTATCTGCAACACTAGAGCCCTACCAAA GCTCTATGGTCAAATTCTTGAACACTACTGCTAAGAGTTATAATACTGTT CATGAAGAATACAAAGGTTGGTTGCCCTGActgttgttttttaatttatt ttgttcTAATTTCTTCTGGCTGAGACAAATATCtctctaaaatttttaaa aagtgggTTCTCCATCTtgaaattctgcaaaatttatAAAGATATTAAGA ATCTAGGCTTTTGTCTTAGAAGAAAAAATTGCGTTGACCacttttagctt aaaaaaatGTCTCAAATTAACTTGTAACTTCTTCAGATCAGAAAGATTTG TAAACGTTCCTACTGCtggattttttaagaaaaaaaagcaTTGAACCAAC CTAGAAAATTctagaaaattcataaaattaatAAGAATCTGGGCCGTTGT CTGATAggaaaaaaatttgctttgactgTCTTAAATTAACTTAACCTTCC TTTTTAAACACATTTAAACTTTTTCCTAGGCCATCCGTCCTACAAATTCA ACattctaaaaaatatcattCCAAACAATGGTATTGtggatgatgaagaa gatgatCTCGCCAACGATCAAGACAACAAATCATCCAACAAAGAGAACAG AAGGAAAAAGAAAACTGCAAAACCTGAACAAGCAGAAGAAGCAACAGAAG AAAAAACATCTAATGATGACGACGGTGGTATGTCTCTGACCAGCTTTGGT GTCGCTAAAAGTTCAACATTTAGATCCCCAAACTCAcatctttttttagt tttatctGTTTTCTTGGGACAGAATGAATTTTTGAACTGTTGAATTAGCC CAGTAGGCAGACGCTTTTTAATATAGACGATATCATATGATTATGATTAC TTTTATTAATATTGATAATTTCACATTTCACATTTTCAGATGACAAACTG ATCAATTTCGATTCTTCACCTTCGGAAGATGTGGACCAAGGTGTTGTTCC GAAGCCTACCGAAAGAGATGCAGATTTGCTTGGTGCATCATTAGATCAAG ACTCAAGCCCTGGGTTCGGTGATTATACTGAAACTAAAGACAACAACGAA GGTATAATTGTACGATCTTGTACGATAGCTATTATATTGTATAATTGTAA GTCTGACtctcttgaatttgaaaagcttAAAAATGCGGTAAAATTACATT GTATTTTTGGACATACCCcagtggggtggaggtcctataaattaacctgt gttcgttcgtccgtccgttcgtctgttaccaacttatctcaggattgaat cataggaattttttgatttttggtacaaaggtgcaaaatggtggtggtca aaatgtgacggagcccgatttcaaaaaaaaaaattggggggttaaatttg ggccaaaaaacggctaaaaacgggttttttggactttgtgaaaaattgga tcattaattttttctaatcttttgcatgaaagtagggtaccaacataggt aaaagatggctcaagcagatttttgcaaaaaaaattttttagctcaaaaa acgcaagtttatctataagaatcactattaataagcatacatcaatgttc ttagtcacattactcaattttttcagagatagatgtttttttttgctcat gagggcttacttttgaagaatatgtgtgtttagacatgaaattttggttg cttgatTTGTTTTCATAGagaaactggccaaattcgatatttttctataa gcacattatcaattacttttttaggtattagcttttctcaagattggctc tttcattctttatgaatttttgcacaaagatggataactataaaccctct aatgtgacggagcctgattttcaaaaaaaaaatgtttttgggcaattttg ggccaaaagcggctaaaaaaagggttttttggactttgtgaaatattgga tcattgttttttttagactttttgcatgaaagtaggtaaaacatggctca agcagattttcgtaaaaaaagaatttttcagctcaaaaaacgcatcttta tctataagaatcactattaacatgcatacatcaatgttcttagccaaatt actaaattttttgatgagatagatgttttcttttgctcacaaagtcttca atatgaaagaatattttcaagagtattaaattttggtttctaaacgtttt tttataagaaacaaacgactaactttaattaatagatcgtcactatttgt gttctgaatgattgtttaacgatcatgctcacgtagatatcaattatata tgtgttaaatgcataaccaggtaggtccataaaagtatcacttgtttatc aaaaaaaaatttacatgtAAAGCACTTCAATTGTAATTACAGAAGATAGT CGAAATTAACGAGTGTTTCATTTGTTCTACTTTTCTTGTGGGAATGATAA TCGCAAGTACCGTtgcatttgatattttaaagttTAAGTTCACGGTAAGA ATAATTTTAACGCTTCATTATTACTTGCAGGATTTGAAGATTTACTTGgc aaatttgaagaaaacaatGTACTAGCTGACAAACCATCGCATCAACCTTC GCTGATTTCAACATCGACAGAAGATACTTCCGATCCTTTTTCATTCATCA GTAATTTGGATTCTGACAGGCGTAAAAGTGATACAACACCACCAACTAAA GGTGATATAATTTACTGCTCAAGTTAACTTCAATTCAAGTTATTGGTCTT TGTTTAAAGTTTGCTTTAGGGTTTATGATATTAATAAATGGATAAGGAAA TAAaaggttttgatatttctttcatTGTATTAAGCCGTTCAGTAATTTTG CTTGGGAAATGTTCATTTTATAAACTCTCACAATTACTAGTGGTAGTGAG GCAAGATTACTTTGAATATAACCTGAAGTTTGCAACCAAAAGGTTGTACC CCATCAGGATAAATAACTGTCAACCATCATTTTACCATACAGAAATTTTC ATCTTATTCATAGATTCACTACCAGAGCCTTCAGTTGATGACCTACTCTT CGGTTCACCAAACCGTAAACTGGATGGCACCGAGAAAACAGATTTGGACA TCCTAACTGATGTGTTATCCAACCAAAATCTCGGTATTACTGAAACAGAA CATAATAAGTCGTTCAGTGATCAATGGCAGTCTATGTTTGGTGCTGGTGT ATCTGAGGAATCAACACCATCAATGTCTGACCTTCTTGCTCAAGATCTGG AAAATAGTAAAAGCGATTCTACACCAAAACAACCTGAGAATATGGTTGAT GCTAACATCAAGAGTGATCGAATGTATATGCCATCCTTTTTATTGGAGCA AATGAGAAAAACTGATCCacaagctttgaaaaatggtcCTCCCAAGGGTG CATTAGCTGTCAAAGACTCTGCCAAAGCCAGTTCTGGTAAGCCTGGTAAA AGTGGAGAGAAAGGAAAAGACATGTCTGCATGGTTCAATCTGTTTGCTGA TTTGGATCCACTTGCAAACCCGGATGATATAGGCGATTCTAAAGATGGCC AGAGTGAAAAACAAGCCTGCTAAAGTTTGAATCAAATGAATCTATTATCG TTTGCTCCTCCTTGAAATCTACTCAAAATGTGTTTTTATcagatgttgat attttttaccAAGAAGTTATTTAAAAGCCAAGCTGTATAATTGTCATCGT TCAAATAATGCGAATTCATCCCAAATTCCTGTGTTAAATCTGGATATGTC CAAAGATGGAGTTGTGTAAATGCTATTATGCTAAAGTTGTCCAAGATTTA TTGAATCAGATATGCAAGCTTGTCACTTTTATCCTCTGTGATTGTAATCA TATGATCCAAAGCTTGGCTTAAAATGACNTTGCAAGCTTGTCACTTTTAT CCTATGTGATTGTAATCATATGATCCAAAGCTTGGCTTAAAATGACATAA CTCATCTCAAAGGGCTACAAAGCTTTTGTTCGGTCGCTTCCTTCAGATTT CTTTCGATTCTAGGGTTAATTTTAGCCTCAAAATGATGGTTAGTGTAGCG TAgcttttatactattttttGGGTTTAGTTTTATTGAATTTAGAGGGTGT CCTTAGCTATTTTTGTTTCGAAATCGAGACaacaattatttattttttat ttacaaactTATAGTATTATAAATTTATGCAggataaaatattattttga tcttttttttctcttttcttttctgtggtgaaataattttgaattttact gTGAAGCTAGTAAATAATGATAAAGGTACATGAAAAAAATGGAATtgtat tttaaatgaatttgaaaagaaaggtGAAgaaattcttacatttttttgtg tttgacCCAAAATGGCTGGTTTCCACTTTCCCTGACTTTCAAGGTATTGA AACTTTTCATCATGGTTAACTAGTGCATAAAATAGATCCCTTCATGGACT ACTTCATTTTGTACTTCTTGGAGTATCCTAG

Coding sequence (CDS) from alignment at sc0000002:119386..125916+

>TCONS_00000402 ID=TCONS_00000402|Name=TCONS_00000402|organism=Clytia hemisphaerica|type=CDS|length=19170bp|location=Sequence derived from alignment at sc0000002:119386..125916+ (Clytia hemisphaerica)
ATGTACCAGCAAGGTAGTAGTGGTTACTATGGTGACGGTGGTGGCCAATA
CCATGATgaaggaaatcaaaatcaatatgGCCATAACTACAGAGACTATC
GTATGAATGACCAAAGCATTAAaggaaaaattgaacaaaaatattggaaa
actAAACAGAAAGCTATTGAGAAGTTAGGCAAAGATCAAGATGAATTTGT
TATTGCTGGGGATGCTGAAGTTGATGCACGGTTGGAGGCATTTCAACACA
TCAAAATCACGTGTATGCAATTGATGGCAGCAATAGAATgctatcaaaat
aaaatatttgCTTTATCACAAGATGAAAATGAGATGGGTAGATTTCTAAA
AGATCAAGGATCTCTTGACAAAACCAAAGCTGGTAAAATGATGATAGCTG
TTGGTAAAGCGCAAAGTTTTGCTGCGCAACAAAGgCTTGGAATGAGATCA
TCATTAGCACGTTTGTATTCAGAAATAGAAACATTCAGATTTCGTGCTAT
CCAAGATACACAATTAACAGTCACCAAGATGGAAACCTCTCGATCAGAAT
ATCGTGCTCGGCTATTATGGATGGCTGATATATCAAAAGAGCTTGACCCT
GACCAATTCAAACGTTTGGATAAATTTCGAGATGTACAAATGCAAGTCAA
actggcaaaaaaaaaatttgatcagTTGAAGGGTGATGTCATTCAAAAGA
TTGATCTTTTATCAGCAAGTCGTTGCAATCTTCTATCTGCAACACTAGAG
CCCTACCAAAGCTCTATGGTCAAATTCTTGAACACTACTGCTAAGAGTTA
TAATACTGTTCATGAAGAATACAAAGGCCATCCGTCCTACAAATTCAACa
ttctaaaaaatatcattCCAAACAATGGTATTGtggatgatgaagaagat
gatCTCGCCAACGATCAAGACAACAAATCATCCAACAAAGAGAACAGAAG
GAAAAAGAAAACTGCAAAACCTGAACAAGCAGAAGAAGCAACAGAAGAAA
AAACATCTAATGATGACGACGGTGATGACAAACTGATCAATTTCGATTCT
TCACCTTCGGAAGATGTGGACCAAGGTGTTGTTCCGAAGCCTACCGAAAG
AGATGCAGATTTGCTTGGTGCATCATTAGATCAAGACTCAAGCCCTGGGT
TCGGTGATTATACTGAAACTAAAGACAACAACGAAGGATTTGAAGATTTA
CTTGgcaaatttgaagaaaacaatGTACTAGCTGACAAACCATCGCATCA
ACCTTCGCTGATTTCAACATCGACAGAAGATACTTCCGATCCTTTTTCAT
TCATCAGTAATTTGGATTCTGACAGGCGTAAAAGTGATACAACACCACCA
ACTAAAGATTCACTACCAGAGCCTTCAGTTGATGACCTACTCTTCGGTTC
ACCAAACCGTAAACTGGATGGCACCGAGAAAACAGATTTGGACATCCTAA
CTGATGTGTTATCCAACCAAAATCTCGGTATTACTGAAACAGAACATAAT
AAGTCGTTCAGTGATCAATGGCAGTCTATGTTTGGTGCTGGTGTATCTGA
GGAATCAACACCATCAATGTCTGACCTTCTTGCTCAAGATCTGGAAAATA
GTAAAAGCGATTCTACACCAAAACAACCTGAGAATATGGTTGATGCTAAC
ATCAAGAGTGATCGAATGTATATGCCATCCTTTTTATTGGAGCAAATGAG
AAAAACTGATCCacaagctttgaaaaatggtcCTCCCAAGGGTGCATTAG
CTGTCAAAGACTCTGCCAAAGCCAGTTCTGGTAAGCCTGGTAAAAGTGGA
GAGAAAGGAAAAGACATGTCTGCATGGTTCAATCTGTTTGCTGATTTGGA
TCCACTTGCAAACCCGGATGATATAGGCGATTCTAAAGATGGCCAGAGTG
AAAAACAAGCCTGCTAAATGTACCAGCAAGGTAGTAGTGGTTACTATGGT
GACGGTGGTGGCCAATACCATGATgaaggaaatcaaaatcaatatgGCCA
TAACTACAGAGACTATCGTATGAATGACCAAAGCATTAAaggaaaaattg
aacaaaaatattggaaaactAAACAGAAAGCTATTGAGAAGTTAGGCAAA
GATCAAGATGAATTTGTTATTGCTGGGGATGCTGAAGTTGATGCACGGTT
GGAGGCATTTCAACACATCAAAATCACGTGTATGCAATTGATGGCAGCAA
TAGAATgctatcaaaataaaatatttgCTTTATCACAAGATGAAAATGAG
ATGGGTAGATTTCTAAAAGATCAAGGATCTCTTGACAAAACCAAAGCTGG
TAAAATGATGATAGCTGTTGGTAAAGCGCAAAGTTTTGCTGCGCAACAAA
GgCTTGGAATGAGATCATCATTAGCACGTTTGTATTCAGAAATAGAAACA
TTCAGATTTCGTGCTATCCAAGATACACAATTAACAGTCACCAAGATGGA
AACCTCTCGATCAGAATATCGTGCTCGGCTATTATGGATGGCTGATATAT
CAAAAGAGCTTGACCCTGACCAATTCAAACGTTTGGATAAATTTCGAGAT
GTACAAATGCAAGTCAAactggcaaaaaaaaaatttgatcagTTGAAGGG
TGATGTCATTCAAAAGATTGATCTTTTATCAGCAAGTCGTTGCAATCTTC
TATCTGCAACACTAGAGCCCTACCAAAGCTCTATGGTCAAATTCTTGAAC
ACTACTGCTAAGAGTTATAATACTGTTCATGAAGAATACAAAGGCCATCC
GTCCTACAAATTCAACattctaaaaaatatcattCCAAACAATGGTATTG
tggatgatgaagaagatgatCTCGCCAACGATCAAGACAACAAATCATCC
AACAAAGAGAACAGAAGGAAAAAGAAAACTGCAAAACCTGAACAAGCAGA
AGAAGCAACAGAAGAAAAAACATCTAATGATGACGACGGTGATGACAAAC
TGATCAATTTCGATTCTTCACCTTCGGAAGATGTGGACCAAGGTGTTGTT
CCGAAGCCTACCGAAAGAGATGCAGATTTGCTTGGTGCATCATTAGATCA
AGACTCAAGCCCTGGGTTCGGTGATTATACTGAAACTAAAGACAACAACG
AAGGATTTGAAGATTTACTTGgcaaatttgaagaaaacaatGTACTAGCT
GACAAACCATCGCATCAACCTTCGCTGATTTCAACATCGACAGAAGATAC
TTCCGATCCTTTTTCATTCATCAGTAATTTGGATTCTGACAGGCGTAAAA
GTGATACAACACCACCAACTAAAGATTCACTACCAGAGCCTTCAGTTGAT
GACCTACTCTTCGGTTCACCAAACCGTAAACTGGATGGCACCGAGAAAAC
AGATTTGGACATCCTAACTGATGTGTTATCCAACCAAAATCTCGGTATTA
CTGAAACAGAACATAATAAGTCGTTCAGTGATCAATGGCAGTCTATGTTT
GGTGCTGGTGTATCTGAGGAATCAACACCATCAATGTCTGACCTTCTTGC
TCAAGATCTGGAAAATAGTAAAAGCGATTCTACACCAAAACAACCTGAGA
ATATGGTTGATGCTAACATCAAGAGTGATCGAATGTATATGCCATCCTTT
TTATTGGAGCAAATGAGAAAAACTGATCCacaagctttgaaaaatggtcC
TCCCAAGGGTGCATTAGCTGTCAAAGACTCTGCCAAAGCCAGTTCTGGTA
AGCCTGGTAAAAGTGGAGAGAAAGGAAAAGACATGTCTGCATGGTTCAAT
CTGTTTGCTGATTTGGATCCACTTGCAAACCCGGATGATATAGGCGATTC
TAAAGATGGCCAGAGTGAAAAACAAGCCTGCTAAATGTACCAGCAAGGTA
GTAGTGGTTACTATGGTGACGGTGGTGGCCAATACCATGATgaaggaaat
caaaatcaatatgGCCATAACTACAGAGACTATCGTATGAATGACCAAAG
CATTAAaggaaaaattgaacaaaaatattggaaaactAAACAGAAAGCTA
TTGAGAAGTTAGGCAAAGATCAAGATGAATTTGTTATTGCTGGGGATGCT
GAAGTTGATGCACGGTTGGAGGCATTTCAACACATCAAAATCACGTGTAT
GCAATTGATGGCAGCAATAGAATgctatcaaaataaaatatttgCTTTAT
CACAAGATGAAAATGAGATGGGTAGATTTCTAAAAGATCAAGGATCTCTT
GACAAAACCAAAGCTGGTAAAATGATGATAGCTGTTGGTAAAGCGCAAAG
TTTTGCTGCGCAACAAAGgCTTGGAATGAGATCATCATTAGCACGTTTGT
ATTCAGAAATAGAAACATTCAGATTTCGTGCTATCCAAGATACACAATTA
ACAGTCACCAAGATGGAAACCTCTCGATCAGAATATCGTGCTCGGCTATT
ATGGATGGCTGATATATCAAAAGAGCTTGACCCTGACCAATTCAAACGTT
TGGATAAATTTCGAGATGTACAAATGCAAGTCAAactggcaaaaaaaaaa
tttgatcagTTGAAGGGTGATGTCATTCAAAAGATTGATCTTTTATCAGC
AAGTCGTTGCAATCTTCTATCTGCAACACTAGAGCCCTACCAAAGCTCTA
TGGTCAAATTCTTGAACACTACTGCTAAGAGTTATAATACTGTTCATGAA
GAATACAAAGGCCATCCGTCCTACAAATTCAACattctaaaaaatatcat
tCCAAACAATGGTATTGtggatgatgaagaagatgatCTCGCCAACGATC
AAGACAACAAATCATCCAACAAAGAGAACAGAAGGAAAAAGAAAACTGCA
AAACCTGAACAAGCAGAAGAAGCAACAGAAGAAAAAACATCTAATGATGA
CGACGGTGATGACAAACTGATCAATTTCGATTCTTCACCTTCGGAAGATG
TGGACCAAGGTGTTGTTCCGAAGCCTACCGAAAGAGATGCAGATTTGCTT
GGTGCATCATTAGATCAAGACTCAAGCCCTGGGTTCGGTGATTATACTGA
AACTAAAGACAACAACGAAGGATTTGAAGATTTACTTGgcaaatttgaag
aaaacaatGTACTAGCTGACAAACCATCGCATCAACCTTCGCTGATTTCA
ACATCGACAGAAGATACTTCCGATCCTTTTTCATTCATCAGTAATTTGGA
TTCTGACAGGCGTAAAAGTGATACAACACCACCAACTAAAGATTCACTAC
CAGAGCCTTCAGTTGATGACCTACTCTTCGGTTCACCAAACCGTAAACTG
GATGGCACCGAGAAAACAGATTTGGACATCCTAACTGATGTGTTATCCAA
CCAAAATCTCGGTATTACTGAAACAGAACATAATAAGTCGTTCAGTGATC
AATGGCAGTCTATGTTTGGTGCTGGTGTATCTGAGGAATCAACACCATCA
ATGTCTGACCTTCTTGCTCAAGATCTGGAAAATAGTAAAAGCGATTCTAC
ACCAAAACAACCTGAGAATATGGTTGATGCTAACATCAAGAGTGATCGAA
TGTATATGCCATCCTTTTTATTGGAGCAAATGAGAAAAACTGATCCacaa
gctttgaaaaatggtcCTCCCAAGGGTGCATTAGCTGTCAAAGACTCTGC
CAAAGCCAGTTCTGGTAAGCCTGGTAAAAGTGGAGAGAAAGGAAAAGACA
TGTCTGCATGGTTCAATCTGTTTGCTGATTTGGATCCACTTGCAAACCCG
GATGATATAGGCGATTCTAAAGATGGCCAGAGTGAAAAACAAGCCTGCTA
AATGTACCAGCAAGGTAGTAGTGGTTACTATGGTGACGGTGGTGGCCAAT
ACCATGATgaaggaaatcaaaatcaatatgGCCATAACTACAGAGACTAT
CGTATGAATGACCAAAGCATTAAaggaaaaattgaacaaaaatattggaa
aactAAACAGAAAGCTATTGAGAAGTTAGGCAAAGATCAAGATGAATTTG
TTATTGCTGGGGATGCTGAAGTTGATGCACGGTTGGAGGCATTTCAACAC
ATCAAAATCACGTGTATGCAATTGATGGCAGCAATAGAATgctatcaaaa
taaaatatttgCTTTATCACAAGATGAAAATGAGATGGGTAGATTTCTAA
AAGATCAAGGATCTCTTGACAAAACCAAAGCTGGTAAAATGATGATAGCT
GTTGGTAAAGCGCAAAGTTTTGCTGCGCAACAAAGgCTTGGAATGAGATC
ATCATTAGCACGTTTGTATTCAGAAATAGAAACATTCAGATTTCGTGCTA
TCCAAGATACACAATTAACAGTCACCAAGATGGAAACCTCTCGATCAGAA
TATCGTGCTCGGCTATTATGGATGGCTGATATATCAAAAGAGCTTGACCC
TGACCAATTCAAACGTTTGGATAAATTTCGAGATGTACAAATGCAAGTCA
AactggcaaaaaaaaaatttgatcagTTGAAGGGTGATGTCATTCAAAAG
ATTGATCTTTTATCAGCAAGTCGTTGCAATCTTCTATCTGCAACACTAGA
GCCCTACCAAAGCTCTATGGTCAAATTCTTGAACACTACTGCTAAGAGTT
ATAATACTGTTCATGAAGAATACAAAGGCCATCCGTCCTACAAATTCAAC
attctaaaaaatatcattCCAAACAATGGTATTGtggatgatgaagaaga
tgatCTCGCCAACGATCAAGACAACAAATCATCCAACAAAGAGAACAGAA
GGAAAAAGAAAACTGCAAAACCTGAACAAGCAGAAGAAGCAACAGAAGAA
AAAACATCTAATGATGACGACGGTGATGACAAACTGATCAATTTCGATTC
TTCACCTTCGGAAGATGTGGACCAAGGTGTTGTTCCGAAGCCTACCGAAA
GAGATGCAGATTTGCTTGGTGCATCATTAGATCAAGACTCAAGCCCTGGG
TTCGGTGATTATACTGAAACTAAAGACAACAACGAAGGATTTGAAGATTT
ACTTGgcaaatttgaagaaaacaatGTACTAGCTGACAAACCATCGCATC
AACCTTCGCTGATTTCAACATCGACAGAAGATACTTCCGATCCTTTTTCA
TTCATCAGTAATTTGGATTCTGACAGGCGTAAAAGTGATACAACACCACC
AACTAAAGATTCACTACCAGAGCCTTCAGTTGATGACCTACTCTTCGGTT
CACCAAACCGTAAACTGGATGGCACCGAGAAAACAGATTTGGACATCCTA
ACTGATGTGTTATCCAACCAAAATCTCGGTATTACTGAAACAGAACATAA
TAAGTCGTTCAGTGATCAATGGCAGTCTATGTTTGGTGCTGGTGTATCTG
AGGAATCAACACCATCAATGTCTGACCTTCTTGCTCAAGATCTGGAAAAT
AGTAAAAGCGATTCTACACCAAAACAACCTGAGAATATGGTTGATGCTAA
CATCAAGAGTGATCGAATGTATATGCCATCCTTTTTATTGGAGCAAATGA
GAAAAACTGATCCacaagctttgaaaaatggtcCTCCCAAGGGTGCATTA
GCTGTCAAAGACTCTGCCAAAGCCAGTTCTGGTAAGCCTGGTAAAAGTGG
AGAGAAAGGAAAAGACATGTCTGCATGGTTCAATCTGTTTGCTGATTTGG
ATCCACTTGCAAACCCGGATGATATAGGCGATTCTAAAGATGGCCAGAGT
GAAAAACAAGCCTGCTAAATGTACCAGCAAGGTAGTAGTGGTTACTATGG
TGACGGTGGTGGCCAATACCATGATgaaggaaatcaaaatcaatatgGCC
ATAACTACAGAGACTATCGTATGAATGACCAAAGCATTAAaggaaaaatt
gaacaaaaatattggaaaactAAACAGAAAGCTATTGAGAAGTTAGGCAA
AGATCAAGATGAATTTGTTATTGCTGGGGATGCTGAAGTTGATGCACGGT
TGGAGGCATTTCAACACATCAAAATCACGTGTATGCAATTGATGGCAGCA
ATAGAATgctatcaaaataaaatatttgCTTTATCACAAGATGAAAATGA
GATGGGTAGATTTCTAAAAGATCAAGGATCTCTTGACAAAACCAAAGCTG
GTAAAATGATGATAGCTGTTGGTAAAGCGCAAAGTTTTGCTGCGCAACAA
AGgCTTGGAATGAGATCATCATTAGCACGTTTGTATTCAGAAATAGAAAC
ATTCAGATTTCGTGCTATCCAAGATACACAATTAACAGTCACCAAGATGG
AAACCTCTCGATCAGAATATCGTGCTCGGCTATTATGGATGGCTGATATA
TCAAAAGAGCTTGACCCTGACCAATTCAAACGTTTGGATAAATTTCGAGA
TGTACAAATGCAAGTCAAactggcaaaaaaaaaatttgatcagTTGAAGG
GTGATGTCATTCAAAAGATTGATCTTTTATCAGCAAGTCGTTGCAATCTT
CTATCTGCAACACTAGAGCCCTACCAAAGCTCTATGGTCAAATTCTTGAA
CACTACTGCTAAGAGTTATAATACTGTTCATGAAGAATACAAAGGCCATC
CGTCCTACAAATTCAACattctaaaaaatatcattCCAAACAATGGTATT
GtggatgatgaagaagatgatCTCGCCAACGATCAAGACAACAAATCATC
CAACAAAGAGAACAGAAGGAAAAAGAAAACTGCAAAACCTGAACAAGCAG
AAGAAGCAACAGAAGAAAAAACATCTAATGATGACGACGGTGATGACAAA
CTGATCAATTTCGATTCTTCACCTTCGGAAGATGTGGACCAAGGTGTTGT
TCCGAAGCCTACCGAAAGAGATGCAGATTTGCTTGGTGCATCATTAGATC
AAGACTCAAGCCCTGGGTTCGGTGATTATACTGAAACTAAAGACAACAAC
GAAGGATTTGAAGATTTACTTGgcaaatttgaagaaaacaatGTACTAGC
TGACAAACCATCGCATCAACCTTCGCTGATTTCAACATCGACAGAAGATA
CTTCCGATCCTTTTTCATTCATCAGTAATTTGGATTCTGACAGGCGTAAA
AGTGATACAACACCACCAACTAAAGATTCACTACCAGAGCCTTCAGTTGA
TGACCTACTCTTCGGTTCACCAAACCGTAAACTGGATGGCACCGAGAAAA
CAGATTTGGACATCCTAACTGATGTGTTATCCAACCAAAATCTCGGTATT
ACTGAAACAGAACATAATAAGTCGTTCAGTGATCAATGGCAGTCTATGTT
TGGTGCTGGTGTATCTGAGGAATCAACACCATCAATGTCTGACCTTCTTG
CTCAAGATCTGGAAAATAGTAAAAGCGATTCTACACCAAAACAACCTGAG
AATATGGTTGATGCTAACATCAAGAGTGATCGAATGTATATGCCATCCTT
TTTATTGGAGCAAATGAGAAAAACTGATCCacaagctttgaaaaatggtc
CTCCCAAGGGTGCATTAGCTGTCAAAGACTCTGCCAAAGCCAGTTCTGGT
AAGCCTGGTAAAAGTGGAGAGAAAGGAAAAGACATGTCTGCATGGTTCAA
TCTGTTTGCTGATTTGGATCCACTTGCAAACCCGGATGATATAGGCGATT
CTAAAGATGGCCAGAGTGAAAAACAAGCCTGCTAAATGTACCAGCAAGGT
AGTAGTGGTTACTATGGTGACGGTGGTGGCCAATACCATGATgaaggaaa
tcaaaatcaatatgGCCATAACTACAGAGACTATCGTATGAATGACCAAA
GCATTAAaggaaaaattgaacaaaaatattggaaaactAAACAGAAAGCT
ATTGAGAAGTTAGGCAAAGATCAAGATGAATTTGTTATTGCTGGGGATGC
TGAAGTTGATGCACGGTTGGAGGCATTTCAACACATCAAAATCACGTGTA
TGCAATTGATGGCAGCAATAGAATgctatcaaaataaaatatttgCTTTA
TCACAAGATGAAAATGAGATGGGTAGATTTCTAAAAGATCAAGGATCTCT
TGACAAAACCAAAGCTGGTAAAATGATGATAGCTGTTGGTAAAGCGCAAA
GTTTTGCTGCGCAACAAAGgCTTGGAATGAGATCATCATTAGCACGTTTG
TATTCAGAAATAGAAACATTCAGATTTCGTGCTATCCAAGATACACAATT
AACAGTCACCAAGATGGAAACCTCTCGATCAGAATATCGTGCTCGGCTAT
TATGGATGGCTGATATATCAAAAGAGCTTGACCCTGACCAATTCAAACGT
TTGGATAAATTTCGAGATGTACAAATGCAAGTCAAactggcaaaaaaaaa
atttgatcagTTGAAGGGTGATGTCATTCAAAAGATTGATCTTTTATCAG
CAAGTCGTTGCAATCTTCTATCTGCAACACTAGAGCCCTACCAAAGCTCT
ATGGTCAAATTCTTGAACACTACTGCTAAGAGTTATAATACTGTTCATGA
AGAATACAAAGGCCATCCGTCCTACAAATTCAACattctaaaaaatatca
ttCCAAACAATGGTATTGtggatgatgaagaagatgatCTCGCCAACGAT
CAAGACAACAAATCATCCAACAAAGAGAACAGAAGGAAAAAGAAAACTGC
AAAACCTGAACAAGCAGAAGAAGCAACAGAAGAAAAAACATCTAATGATG
ACGACGGTGATGACAAACTGATCAATTTCGATTCTTCACCTTCGGAAGAT
GTGGACCAAGGTGTTGTTCCGAAGCCTACCGAAAGAGATGCAGATTTGCT
TGGTGCATCATTAGATCAAGACTCAAGCCCTGGGTTCGGTGATTATACTG
AAACTAAAGACAACAACGAAGGATTTGAAGATTTACTTGgcaaatttgaa
gaaaacaatGTACTAGCTGACAAACCATCGCATCAACCTTCGCTGATTTC
AACATCGACAGAAGATACTTCCGATCCTTTTTCATTCATCAGTAATTTGG
ATTCTGACAGGCGTAAAAGTGATACAACACCACCAACTAAAGATTCACTA
CCAGAGCCTTCAGTTGATGACCTACTCTTCGGTTCACCAAACCGTAAACT
GGATGGCACCGAGAAAACAGATTTGGACATCCTAACTGATGTGTTATCCA
ACCAAAATCTCGGTATTACTGAAACAGAACATAATAAGTCGTTCAGTGAT
CAATGGCAGTCTATGTTTGGTGCTGGTGTATCTGAGGAATCAACACCATC
AATGTCTGACCTTCTTGCTCAAGATCTGGAAAATAGTAAAAGCGATTCTA
CACCAAAACAACCTGAGAATATGGTTGATGCTAACATCAAGAGTGATCGA
ATGTATATGCCATCCTTTTTATTGGAGCAAATGAGAAAAACTGATCCaca
agctttgaaaaatggtcCTCCCAAGGGTGCATTAGCTGTCAAAGACTCTG
CCAAAGCCAGTTCTGGTAAGCCTGGTAAAAGTGGAGAGAAAGGAAAAGAC
ATGTCTGCATGGTTCAATCTGTTTGCTGATTTGGATCCACTTGCAAACCC
GGATGATATAGGCGATTCTAAAGATGGCCAGAGTGAAAAACAAGCCTGCT
AAATGTACCAGCAAGGTAGTAGTGGTTACTATGGTGACGGTGGTGGCCAA
TACCATGATgaaggaaatcaaaatcaatatgGCCATAACTACAGAGACTA
TCGTATGAATGACCAAAGCATTAAaggaaaaattgaacaaaaatattgga
aaactAAACAGAAAGCTATTGAGAAGTTAGGCAAAGATCAAGATGAATTT
GTTATTGCTGGGGATGCTGAAGTTGATGCACGGTTGGAGGCATTTCAACA
CATCAAAATCACGTGTATGCAATTGATGGCAGCAATAGAATgctatcaaa
ataaaatatttgCTTTATCACAAGATGAAAATGAGATGGGTAGATTTCTA
AAAGATCAAGGATCTCTTGACAAAACCAAAGCTGGTAAAATGATGATAGC
TGTTGGTAAAGCGCAAAGTTTTGCTGCGCAACAAAGgCTTGGAATGAGAT
CATCATTAGCACGTTTGTATTCAGAAATAGAAACATTCAGATTTCGTGCT
ATCCAAGATACACAATTAACAGTCACCAAGATGGAAACCTCTCGATCAGA
ATATCGTGCTCGGCTATTATGGATGGCTGATATATCAAAAGAGCTTGACC
CTGACCAATTCAAACGTTTGGATAAATTTCGAGATGTACAAATGCAAGTC
AAactggcaaaaaaaaaatttgatcagTTGAAGGGTGATGTCATTCAAAA
GATTGATCTTTTATCAGCAAGTCGTTGCAATCTTCTATCTGCAACACTAG
AGCCCTACCAAAGCTCTATGGTCAAATTCTTGAACACTACTGCTAAGAGT
TATAATACTGTTCATGAAGAATACAAAGGCCATCCGTCCTACAAATTCAA
CattctaaaaaatatcattCCAAACAATGGTATTGtggatgatgaagaag
atgatCTCGCCAACGATCAAGACAACAAATCATCCAACAAAGAGAACAGA
AGGAAAAAGAAAACTGCAAAACCTGAACAAGCAGAAGAAGCAACAGAAGA
AAAAACATCTAATGATGACGACGGTGATGACAAACTGATCAATTTCGATT
CTTCACCTTCGGAAGATGTGGACCAAGGTGTTGTTCCGAAGCCTACCGAA
AGAGATGCAGATTTGCTTGGTGCATCATTAGATCAAGACTCAAGCCCTGG
GTTCGGTGATTATACTGAAACTAAAGACAACAACGAAGGATTTGAAGATT
TACTTGgcaaatttgaagaaaacaatGTACTAGCTGACAAACCATCGCAT
CAACCTTCGCTGATTTCAACATCGACAGAAGATACTTCCGATCCTTTTTC
ATTCATCAGTAATTTGGATTCTGACAGGCGTAAAAGTGATACAACACCAC
CAACTAAAGATTCACTACCAGAGCCTTCAGTTGATGACCTACTCTTCGGT
TCACCAAACCGTAAACTGGATGGCACCGAGAAAACAGATTTGGACATCCT
AACTGATGTGTTATCCAACCAAAATCTCGGTATTACTGAAACAGAACATA
ATAAGTCGTTCAGTGATCAATGGCAGTCTATGTTTGGTGCTGGTGTATCT
GAGGAATCAACACCATCAATGTCTGACCTTCTTGCTCAAGATCTGGAAAA
TAGTAAAAGCGATTCTACACCAAAACAACCTGAGAATATGGTTGATGCTA
ACATCAAGAGTGATCGAATGTATATGCCATCCTTTTTATTGGAGCAAATG
AGAAAAACTGATCCacaagctttgaaaaatggtcCTCCCAAGGGTGCATT
AGCTGTCAAAGACTCTGCCAAAGCCAGTTCTGGTAAGCCTGGTAAAAGTG
GAGAGAAAGGAAAAGACATGTCTGCATGGTTCAATCTGTTTGCTGATTTG
GATCCACTTGCAAACCCGGATGATATAGGCGATTCTAAAGATGGCCAGAG
TGAAAAACAAGCCTGCTAAATGTACCAGCAAGGTAGTAGTGGTTACTATG
GTGACGGTGGTGGCCAATACCATGATgaaggaaatcaaaatcaatatgGC
CATAACTACAGAGACTATCGTATGAATGACCAAAGCATTAAaggaaaaat
tgaacaaaaatattggaaaactAAACAGAAAGCTATTGAGAAGTTAGGCA
AAGATCAAGATGAATTTGTTATTGCTGGGGATGCTGAAGTTGATGCACGG
TTGGAGGCATTTCAACACATCAAAATCACGTGTATGCAATTGATGGCAGC
AATAGAATgctatcaaaataaaatatttgCTTTATCACAAGATGAAAATG
AGATGGGTAGATTTCTAAAAGATCAAGGATCTCTTGACAAAACCAAAGCT
GGTAAAATGATGATAGCTGTTGGTAAAGCGCAAAGTTTTGCTGCGCAACA
AAGgCTTGGAATGAGATCATCATTAGCACGTTTGTATTCAGAAATAGAAA
CATTCAGATTTCGTGCTATCCAAGATACACAATTAACAGTCACCAAGATG
GAAACCTCTCGATCAGAATATCGTGCTCGGCTATTATGGATGGCTGATAT
ATCAAAAGAGCTTGACCCTGACCAATTCAAACGTTTGGATAAATTTCGAG
ATGTACAAATGCAAGTCAAactggcaaaaaaaaaatttgatcagTTGAAG
GGTGATGTCATTCAAAAGATTGATCTTTTATCAGCAAGTCGTTGCAATCT
TCTATCTGCAACACTAGAGCCCTACCAAAGCTCTATGGTCAAATTCTTGA
ACACTACTGCTAAGAGTTATAATACTGTTCATGAAGAATACAAAGGCCAT
CCGTCCTACAAATTCAACattctaaaaaatatcattCCAAACAATGGTAT
TGtggatgatgaagaagatgatCTCGCCAACGATCAAGACAACAAATCAT
CCAACAAAGAGAACAGAAGGAAAAAGAAAACTGCAAAACCTGAACAAGCA
GAAGAAGCAACAGAAGAAAAAACATCTAATGATGACGACGGTGATGACAA
ACTGATCAATTTCGATTCTTCACCTTCGGAAGATGTGGACCAAGGTGTTG
TTCCGAAGCCTACCGAAAGAGATGCAGATTTGCTTGGTGCATCATTAGAT
CAAGACTCAAGCCCTGGGTTCGGTGATTATACTGAAACTAAAGACAACAA
CGAAGGATTTGAAGATTTACTTGgcaaatttgaagaaaacaatGTACTAG
CTGACAAACCATCGCATCAACCTTCGCTGATTTCAACATCGACAGAAGAT
ACTTCCGATCCTTTTTCATTCATCAGTAATTTGGATTCTGACAGGCGTAA
AAGTGATACAACACCACCAACTAAAGATTCACTACCAGAGCCTTCAGTTG
ATGACCTACTCTTCGGTTCACCAAACCGTAAACTGGATGGCACCGAGAAA
ACAGATTTGGACATCCTAACTGATGTGTTATCCAACCAAAATCTCGGTAT
TACTGAAACAGAACATAATAAGTCGTTCAGTGATCAATGGCAGTCTATGT
TTGGTGCTGGTGTATCTGAGGAATCAACACCATCAATGTCTGACCTTCTT
GCTCAAGATCTGGAAAATAGTAAAAGCGATTCTACACCAAAACAACCTGA
GAATATGGTTGATGCTAACATCAAGAGTGATCGAATGTATATGCCATCCT
TTTTATTGGAGCAAATGAGAAAAACTGATCCacaagctttgaaaaatggt
cCTCCCAAGGGTGCATTAGCTGTCAAAGACTCTGCCAAAGCCAGTTCTGG
TAAGCCTGGTAAAAGTGGAGAGAAAGGAAAAGACATGTCTGCATGGTTCA
ATCTGTTTGCTGATTTGGATCCACTTGCAAACCCGGATGATATAGGCGAT
TCTAAAGATGGCCAGAGTGAAAAACAAGCCTGCTAAATGTACCAGCAAGG
TAGTAGTGGTTACTATGGTGACGGTGGTGGCCAATACCATGATgaaggaa
atcaaaatcaatatgGCCATAACTACAGAGACTATCGTATGAATGACCAA
AGCATTAAaggaaaaattgaacaaaaatattggaaaactAAACAGAAAGC
TATTGAGAAGTTAGGCAAAGATCAAGATGAATTTGTTATTGCTGGGGATG
CTGAAGTTGATGCACGGTTGGAGGCATTTCAACACATCAAAATCACGTGT
ATGCAATTGATGGCAGCAATAGAATgctatcaaaataaaatatttgCTTT
ATCACAAGATGAAAATGAGATGGGTAGATTTCTAAAAGATCAAGGATCTC
TTGACAAAACCAAAGCTGGTAAAATGATGATAGCTGTTGGTAAAGCGCAA
AGTTTTGCTGCGCAACAAAGgCTTGGAATGAGATCATCATTAGCACGTTT
GTATTCAGAAATAGAAACATTCAGATTTCGTGCTATCCAAGATACACAAT
TAACAGTCACCAAGATGGAAACCTCTCGATCAGAATATCGTGCTCGGCTA
TTATGGATGGCTGATATATCAAAAGAGCTTGACCCTGACCAATTCAAACG
TTTGGATAAATTTCGAGATGTACAAATGCAAGTCAAactggcaaaaaaaa
aatttgatcagTTGAAGGGTGATGTCATTCAAAAGATTGATCTTTTATCA
GCAAGTCGTTGCAATCTTCTATCTGCAACACTAGAGCCCTACCAAAGCTC
TATGGTCAAATTCTTGAACACTACTGCTAAGAGTTATAATACTGTTCATG
AAGAATACAAAGGCCATCCGTCCTACAAATTCAACattctaaaaaatatc
attCCAAACAATGGTATTGtggatgatgaagaagatgatCTCGCCAACGA
TCAAGACAACAAATCATCCAACAAAGAGAACAGAAGGAAAAAGAAAACTG
CAAAACCTGAACAAGCAGAAGAAGCAACAGAAGAAAAAACATCTAATGAT
GACGACGGTGATGACAAACTGATCAATTTCGATTCTTCACCTTCGGAAGA
TGTGGACCAAGGTGTTGTTCCGAAGCCTACCGAAAGAGATGCAGATTTGC
TTGGTGCATCATTAGATCAAGACTCAAGCCCTGGGTTCGGTGATTATACT
GAAACTAAAGACAACAACGAAGGATTTGAAGATTTACTTGgcaaatttga
agaaaacaatGTACTAGCTGACAAACCATCGCATCAACCTTCGCTGATTT
CAACATCGACAGAAGATACTTCCGATCCTTTTTCATTCATCAGTAATTTG
GATTCTGACAGGCGTAAAAGTGATACAACACCACCAACTAAAGATTCACT
ACCAGAGCCTTCAGTTGATGACCTACTCTTCGGTTCACCAAACCGTAAAC
TGGATGGCACCGAGAAAACAGATTTGGACATCCTAACTGATGTGTTATCC
AACCAAAATCTCGGTATTACTGAAACAGAACATAATAAGTCGTTCAGTGA
TCAATGGCAGTCTATGTTTGGTGCTGGTGTATCTGAGGAATCAACACCAT
CAATGTCTGACCTTCTTGCTCAAGATCTGGAAAATAGTAAAAGCGATTCT
ACACCAAAACAACCTGAGAATATGGTTGATGCTAACATCAAGAGTGATCG
AATGTATATGCCATCCTTTTTATTGGAGCAAATGAGAAAAACTGATCCac
aagctttgaaaaatggtcCTCCCAAGGGTGCATTAGCTGTCAAAGACTCT
GCCAAAGCCAGTTCTGGTAAGCCTGGTAAAAGTGGAGAGAAAGGAAAAGA
CATGTCTGCATGGTTCAATCTGTTTGCTGATTTGGATCCACTTGCAAACC
CGGATGATATAGGCGATTCTAAAGATGGCCAGAGTGAAAAACAAGCCTGC
TAAATGTACCAGCAAGGTAGTAGTGGTTACTATGGTGACGGTGGTGGCCA
ATACCATGATgaaggaaatcaaaatcaatatgGCCATAACTACAGAGACT
ATCGTATGAATGACCAAAGCATTAAaggaaaaattgaacaaaaatattgg
aaaactAAACAGAAAGCTATTGAGAAGTTAGGCAAAGATCAAGATGAATT
TGTTATTGCTGGGGATGCTGAAGTTGATGCACGGTTGGAGGCATTTCAAC
ACATCAAAATCACGTGTATGCAATTGATGGCAGCAATAGAATgctatcaa
aataaaatatttgCTTTATCACAAGATGAAAATGAGATGGGTAGATTTCT
AAAAGATCAAGGATCTCTTGACAAAACCAAAGCTGGTAAAATGATGATAG
CTGTTGGTAAAGCGCAAAGTTTTGCTGCGCAACAAAGgCTTGGAATGAGA
TCATCATTAGCACGTTTGTATTCAGAAATAGAAACATTCAGATTTCGTGC
TATCCAAGATACACAATTAACAGTCACCAAGATGGAAACCTCTCGATCAG
AATATCGTGCTCGGCTATTATGGATGGCTGATATATCAAAAGAGCTTGAC
CCTGACCAATTCAAACGTTTGGATAAATTTCGAGATGTACAAATGCAAGT
CAAactggcaaaaaaaaaatttgatcagTTGAAGGGTGATGTCATTCAAA
AGATTGATCTTTTATCAGCAAGTCGTTGCAATCTTCTATCTGCAACACTA
GAGCCCTACCAAAGCTCTATGGTCAAATTCTTGAACACTACTGCTAAGAG
TTATAATACTGTTCATGAAGAATACAAAGGCCATCCGTCCTACAAATTCA
ACattctaaaaaatatcattCCAAACAATGGTATTGtggatgatgaagaa
gatgatCTCGCCAACGATCAAGACAACAAATCATCCAACAAAGAGAACAG
AAGGAAAAAGAAAACTGCAAAACCTGAACAAGCAGAAGAAGCAACAGAAG
AAAAAACATCTAATGATGACGACGGTGATGACAAACTGATCAATTTCGAT
TCTTCACCTTCGGAAGATGTGGACCAAGGTGTTGTTCCGAAGCCTACCGA
AAGAGATGCAGATTTGCTTGGTGCATCATTAGATCAAGACTCAAGCCCTG
GGTTCGGTGATTATACTGAAACTAAAGACAACAACGAAGGATTTGAAGAT
TTACTTGgcaaatttgaagaaaacaatGTACTAGCTGACAAACCATCGCA
TCAACCTTCGCTGATTTCAACATCGACAGAAGATACTTCCGATCCTTTTT
CATTCATCAGTAATTTGGATTCTGACAGGCGTAAAAGTGATACAACACCA
CCAACTAAAGATTCACTACCAGAGCCTTCAGTTGATGACCTACTCTTCGG
TTCACCAAACCGTAAACTGGATGGCACCGAGAAAACAGATTTGGACATCC
TAACTGATGTGTTATCCAACCAAAATCTCGGTATTACTGAAACAGAACAT
AATAAGTCGTTCAGTGATCAATGGCAGTCTATGTTTGGTGCTGGTGTATC
TGAGGAATCAACACCATCAATGTCTGACCTTCTTGCTCAAGATCTGGAAA
ATAGTAAAAGCGATTCTACACCAAAACAACCTGAGAATATGGTTGATGCT
AACATCAAGAGTGATCGAATGTATATGCCATCCTTTTTATTGGAGCAAAT
GAGAAAAACTGATCCacaagctttgaaaaatggtcCTCCCAAGGGTGCAT
TAGCTGTCAAAGACTCTGCCAAAGCCAGTTCTGGTAAGCCTGGTAAAAGT
GGAGAGAAAGGAAAAGACATGTCTGCATGGTTCAATCTGTTTGCTGATTT
GGATCCACTTGCAAACCCGGATGATATAGGCGATTCTAAAGATGGCCAGA
GTGAAAAACAAGCCTGCTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000270XLOC_000270Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000402-proteinTCONS_00000402-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000402-exon-sc0000002-1491911889:119386..119684TCONS_00000402-exon-sc0000002-1491911889:119386..119684Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1510915933:119386..119684TCONS_00000402-exon-sc0000002-1510915933:119386..119684Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1575043694:119386..119684TCONS_00000402-exon-sc0000002-1575043694:119386..119684Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1491911889:119926..120139TCONS_00000402-exon-sc0000002-1491911889:119926..120139Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1510915933:119926..120139TCONS_00000402-exon-sc0000002-1510915933:119926..120139Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1575043694:119926..120139TCONS_00000402-exon-sc0000002-1575043694:119926..120139Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1491911889:120376..120448TCONS_00000402-exon-sc0000002-1491911889:120376..120448Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1510915933:120376..120448TCONS_00000402-exon-sc0000002-1510915933:120376..120448Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1575043694:120376..120448TCONS_00000402-exon-sc0000002-1575043694:120376..120448Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1491911889:120735..120858TCONS_00000402-exon-sc0000002-1491911889:120735..120858Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1510915933:120735..120858TCONS_00000402-exon-sc0000002-1510915933:120735..120858Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1575043694:120735..120858TCONS_00000402-exon-sc0000002-1575043694:120735..120858Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1491911889:121032..121230TCONS_00000402-exon-sc0000002-1491911889:121032..121230Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1510915933:121032..121230TCONS_00000402-exon-sc0000002-1510915933:121032..121230Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1575043694:121032..121230TCONS_00000402-exon-sc0000002-1575043694:121032..121230Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1491911889:121359..121551TCONS_00000402-exon-sc0000002-1491911889:121359..121551Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1510915933:121359..121551TCONS_00000402-exon-sc0000002-1510915933:121359..121551Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1575043694:121359..121551TCONS_00000402-exon-sc0000002-1575043694:121359..121551Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1491911889:121965..122162TCONS_00000402-exon-sc0000002-1491911889:121965..122162Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1510915933:121965..122162TCONS_00000402-exon-sc0000002-1510915933:121965..122162Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1575043694:121965..122162TCONS_00000402-exon-sc0000002-1575043694:121965..122162Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1491911889:122375..122536TCONS_00000402-exon-sc0000002-1491911889:122375..122536Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1510915933:122375..122536TCONS_00000402-exon-sc0000002-1510915933:122375..122536Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1575043694:122375..122536TCONS_00000402-exon-sc0000002-1575043694:122375..122536Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1491911889:123966..124136TCONS_00000402-exon-sc0000002-1491911889:123966..124136Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1510915933:123966..124136TCONS_00000402-exon-sc0000002-1510915933:123966..124136Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1575043694:123966..124136TCONS_00000402-exon-sc0000002-1575043694:123966..124136Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1491911889:124449..125313TCONS_00000402-exon-sc0000002-1491911889:124449..125313Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1510915933:124449..125313TCONS_00000402-exon-sc0000002-1510915933:124449..125313Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1575043694:124449..125313TCONS_00000402-exon-sc0000002-1575043694:124449..125313Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1491911889:125382..125916TCONS_00000402-exon-sc0000002-1491911889:125382..125916Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1510915933:125382..125916TCONS_00000402-exon-sc0000002-1510915933:125382..125916Clytia hemisphaericaexon
TCONS_00000402-exon-sc0000002-1575043694:125382..125916TCONS_00000402-exon-sc0000002-1575043694:125382..125916Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:119386..125916 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
67.2745 62.8346 29.9708 25.3556 110.173 80.326 116.405 124.264 65.1602 71.1782 49.6644 42.7881 37.54 30.0831 28.4633 35.0163 48.2393 46.3602 23.1303 34.0983 39.0876 39.9382 58.3235 56.9009 47.4787 51.1854 61.1878 43.8651 35.5569 40.6735
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR010504AH_dom
IPR006723Islet_autoAg_Ica1_C
IPR027267AH/BAR-dom
Vocabulary: Molecular Function
TermDefinition
GO:0019904protein domain specific binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0019904 protein domain specific binding
Blast
BLAST of TCONS_00000402 vs. Swiss-Prot (Human)
Match: ICA69 (Islet cell autoantigen 1 OS=Homo sapiens GN=ICA1 PE=1 SV=2)

HSP 1 Score: 302.753 bits (774), Expect = 2.837e-91
Identity = 141/268 (52.61%), Postives = 193/268 (72.01%), Query Frame = 1
Query:  337 GNQNQYGHNYRDYRMNDQSIKGKIEQKYWKTKQKAIEKLGKDQDEFVIAGDAEVDARLEAFQHIKITCMQLMAAIECYQNKIFALSQDENEMGRFLKDQGSLDKTKAGKMMIAVGKAQSFAAQQRLGMRSSLARLYSEIETFRFRAIQDTQLTVTKMETSRSEYRARLLWMADISKELDPDQFKRLDKFRDVQMQVKLAKKKFDQLKGDVIQKIDLLSASRCNLLSATLEPYQSSMVKFLNTTAKSYNTVHEEYKGHPSYKFNILKNI 1140
            G++  Y  + +D    D+S+  K++QKYW+TKQ  I+  GK +DE V+A DA++DA+LE F  I+ TC+ L  AI  YQ +I  LSQ+ENE+G+FL+ QG  DKT+AGKMM A GKA  F++QQRL +R+ L R + E+ETFR RAI DT LTV +ME  R+EYR  LLWM D+S+ELDPD +K+++KFR VQ QV+LAKK FD+LK DV QK+DLL ASRCNLLS  L  YQ++++ F   T+ +   +HE +KG+  Y+F  LK++
Sbjct:    3 GHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSL 270          
The following BLAST results are available for this feature:
BLAST of TCONS_00000402 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ICA692.837e-9152.61Islet cell autoantigen 1 OS=Homo sapiens GN=ICA1 P... [more]
back to top