Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000370 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000370
Unique NameTCONS_00000370
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1297

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000370 ID=TCONS_00000370|Name=TCONS_00000370|organism=Clytia hemisphaerica|type=transcript|length=1297bp
TACCTTCAAAGCCTCATCAACTGCTCTGTATATCATTAATTTTATCATAA
TgtttaattcccatttatttcTAGGAATCAATTTAAAATAAAGATAACTA
aaagagaaacaaaaaaaaacttaaaaaaatgtcAGCTCAGGCTCTCAAAG
AACTTCATCAGATGGTGTTACATATACAAGAGGATCGAACCAGGAGTGCT
GACAATTTATccaatataaacaaaacacaTGAAAAAATGCGACATGAAAC
ACGAGTCACTGCTTATTTCAAAAGCAAATTGAAAAGTTTATATAAAACAG
CTATCTCAGATGCTAAAACAGAATCAGAGTTAATACAACAAGCCATGGAG
AAAATAAACGAGATTAAACGttcacaaaatcaaaaacacaGTCAATCTTC
AGAAAAAAGTTCATCGCAATCGTCAACTAAAAGTACTGGTGGTGGTGGTG
AGGAACGTAGAAAAGGTATGCGACGTGGAGTCCTGATGTCTATGTTACAA
CAGAATGCGGTCAACCTCCCTGTATGGGATAGCATAATGGATGAAACCCC
TCCACCTTTATGTGGATGTTTACCAGCAGATAATACCTACATATGTCAAC
CAGGTGACCACGTGGCTGCACGTGTTAAGTACCCAGAGGAAGAGGAACAA
TACATATTAGCTGAAGTTGTGTCTTATAATAATGCTACGGGTAAATATGA
TGTGGAGGATATTGATTATTCTGAAGAAGAGGGTAAAAATGAGAAAGAAC
GACATACGTTGAGTCGTAGACGTATTTTCCCTCTACCGCTACACAAAGCT
GACCCTCAAGTCAATCCTGAAGCATTATTCCAAGCCAAACAAACTGTTCT
GGCGCTTTATCCACAAACAACGTGTTTCTATAAAGCAATGATACATAGCA
TACCGAAAACTAAGGAGATGGATTACACTGTTTTGTTTGAAGATACATCT
TATGCTGATGGTTATTCACCGCCGTTGAGTGTTCCCCAACGTTACGTTGT
ACCGTGTAAAAATAAACGTTGAACGGTAATGGCATTCATAGAAATACAAC
TGCAGTAGCGTAGGCAAGAGGGGCGCAagatttgtgtaggagagcagatt
tttatgacacggtaattatctttttatattatgaatagataattactgtg
tcataaaagtCTGCTCACCTAAACAAATTtcgcgcccctcctgtctacgc
tactgctgCTGTCATTAAGAAAAGTTGAGGaggatactttaatgggataa
attttcgcggggattaattttcgcggatttcgcggatttgggtgtca
Run BLAST on NCBI

protein sequence of TCONS_00000370-protein

>TCONS_00000370-protein ID=TCONS_00000370-protein|Name=TCONS_00000370-protein|organism=Clytia hemisphaerica|type=polypeptide|length=297bp
MSAQALKELHQMVLHIQEDRTRSADNLSNINKTHEKMRHETRVTAYFKSK
LKSLYKTAISDAKTESELIQQAMEKINEIKRSQNQKHSQSSEKSSSQSST
KSTGGGGEERRKGMRRGVLMSMLQQNAVNLPVWDSIMDETPPPLCGCLPA
DNTYICQPGDHVAARVKYPEEEEQYILAEVVSYNNATGKYDVEDIDYSEE
EGKNEKERHTLSRRRIFPLPLHKADPQVNPEALFQAKQTVLALYPQTTCF
YKAMIHSIPKTKEMDYTVLFEDTSYADGYSPPLSVPQRYVVPCKNKR
Run BLAST on NCBI

transcript from alignment at sc0000001:2180996..2182292

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000370 ID=TCONS_00000370|Name=TCONS_00000370|organism=Clytia hemisphaerica|type=transcript|length=1297bp|location=Sequence derived from alignment at sc0000001:2180996..2182292 (Clytia hemisphaerica)
tgacacccaaatccgcgaaatccgcgaaaattaatccccgcgaaaattta tcccattaaagtatcctCCTCAACTTTTCTTAATGACAGcagcagtagcg tagacaggaggggcgcgaAATTTGTTTAGGTGAGCAGacttttatgacac agtaattatctattcataatataaaaagataattaccgtgtcataaaaat ctgctctcctacacaaatctTGCGCCCCTCTTGCCTACGCTACTGCAGTT GTATTTCTATGAATGCCATTACCGTTCAACGTTTATTTTTACACGGTACA ACGTAACGTTGGGGAACACTCAACGGCGGTGAATAACCATCAGCATAAGA TGTATCTTCAAACAAAACAGTGTAATCCATCTCCTTAGTTTTCGGTATGC TATGTATCATTGCTTTATAGAAACACGTTGTTTGTGGATAAAGCGCCAGA ACAGTTTGTTTGGCTTGGAATAATGCTTCAGGATTGACTTGAGGGTCAGC TTTGTGTAGCGGTAGAGGGAAAATACGTCTACGACTCAACGTATGTCGTT CTTTCTCATTTTTACCCTCTTCTTCAGAATAATCAATATCCTCCACATCA TATTTACCCGTAGCATTATTATAAGACACAACTTCAGCTAATATGTATTG TTCCTCTTCCTCTGGGTACTTAACACGTGCAGCCACGTGGTCACCTGGTT GACATATGTAGGTATTATCTGCTGGTAAACATCCACATAAAGGTGGAGGG GTTTCATCCATTATGCTATCCCATACAGGGAGGTTGACCGCATTCTGTTG TAACATAGACATCAGGACTCCACGTCGCATACCTTTTCTACGTTCCTCAC CACCACCACCAGTACTTTTAGTTGACGATTGCGATGAACTTTTTTCTGAA GATTGACtgtgtttttgattttgtgaaCGTTTAATCTCGTTTATTTTCTC CATGGCTTGTTGTATTAACTCTGATTCTGTTTTAGCATCTGAGATAGCTG TTTTATATAAACTTTTCAATTTGCTTTTGAAATAAGCAGTGACTCGTGTT TCATGTCGCATTTTTTCAtgtgttttgtttatattggATAAATTGTCAGC ACTCCTGGTTCGATCCTCTTGTATATGTAACACCATCTGATGAAGTTCTT TGAGAGCCTGAGCTgacatttttttaagtttttttttgtttctctttTAG TTATCTTTATTTTAAATTGATTCCTAgaaataaatgggaattaaacATTA TGATAAAATTAATGATATACAGAGCAGTTGATGAGGCTTTGAAGGTA

Coding sequence (CDS) from alignment at sc0000001:2180996..2182292

>TCONS_00000370 ID=TCONS_00000370|Name=TCONS_00000370|organism=Clytia hemisphaerica|type=CDS|length=894bp|location=Sequence derived from alignment at sc0000001:2180996..2182292 (Clytia hemisphaerica)
TCAACGTTTATTTTTACACGGTACAACGTAACGTTGGGGAACACTCAACG
GCGGTGAATAACCATCAGCATAAGATGTATCTTCAAACAAAACAGTGTAA
TCCATCTCCTTAGTTTTCGGTATGCTATGTATCATTGCTTTATAGAAACA
CGTTGTTTGTGGATAAAGCGCCAGAACAGTTTGTTTGGCTTGGAATAATG
CTTCAGGATTGACTTGAGGGTCAGCTTTGTGTAGCGGTAGAGGGAAAATA
CGTCTACGACTCAACGTATGTCGTTCTTTCTCATTTTTACCCTCTTCTTC
AGAATAATCAATATCCTCCACATCATATTTACCCGTAGCATTATTATAAG
ACACAACTTCAGCTAATATGTATTGTTCCTCTTCCTCTGGGTACTTAACA
CGTGCAGCCACGTGGTCACCTGGTTGACATATGTAGGTATTATCTGCTGG
TAAACATCCACATAAAGGTGGAGGGGTTTCATCCATTATGCTATCCCATA
CAGGGAGGTTGACCGCATTCTGTTGTAACATAGACATCAGGACTCCACGT
CGCATACCTTTTCTACGTTCCTCACCACCACCACCAGTACTTTTAGTTGA
CGATTGCGATGAACTTTTTTCTGAAGATTGACtgtgtttttgattttgtg
aaCGTTTAATCTCGTTTATTTTCTCCATGGCTTGTTGTATTAACTCTGAT
TCTGTTTTAGCATCTGAGATAGCTGTTTTATATAAACTTTTCAATTTGCT
TTTGAAATAAGCAGTGACTCGTGTTTCATGTCGCATTTTTTCAtgtgttt
tgtttatattggATAAATTGTCAGCACTCCTGGTTCGATCCTCTTGTATA
TGTAACACCATCTGATGAAGTTCTTTGAGAGCCTGAGCTgacat
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000244XLOC_000244Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000370-proteinTCONS_00000370-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000370-exon-sc0000001-1491911889:2180996..2182292TCONS_00000370-exon-sc0000001-1491911889:2180996..2182292Clytia hemisphaericaexon
TCONS_00000370-exon-sc0000001-1510915933:2180996..2182292TCONS_00000370-exon-sc0000001-1510915933:2180996..2182292Clytia hemisphaericaexon
TCONS_00000370-exon-sc0000001-1575043694:2180996..2182292TCONS_00000370-exon-sc0000001-1575043694:2180996..2182292Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2180996..2182292 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
34.9842 31.2086 12.8083 11.2487 15.9439 12.46 12.1803 13.6603 6.78942 8.43776 12.2702 4.69983 3.9475 4.8931 6.26063 8.44415 8.4781 9.40713 3.90128 5.50085 7.13283 6.04993 35.9147 28.6548 7.40559 7.76126 13.9377 11.7628 18.365 21.7516
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR010750SGF29_tudor-like_dom
Blast
BLAST of TCONS_00000370 vs. Swiss-Prot (Human)
Match: SGF29 (SAGA-associated factor 29 OS=Homo sapiens GN=SGF29 PE=1 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 3.961e-104
Identity = 156/292 (53.42%), Postives = 209/292 (71.58%), Query Frame = 3
Query:  135 AQALKELHQMVLHIQEDRTRSADNLSNINKTHEKMRHETRVTAYFKSKLKSLYKTAISDAKTESELIQQAMEKINEIKRSQNQKHXXXXXXXXXXXXXXXXXXXXXXXXXXMRRGVLMSMLQQNAVNLPVWDSIMDETPPPLCGCLPADNTYICQPGDHVAARVKYPEEEEQYILAEVVSYNNATGKYDVEDIDYSEEEGKNEKERHTLSRRRIFPLPLHKADPQVNPEALFQAKQTVLALYPQTTCFYKAMIHSIPKTKEMDYTVLFEDTSYADGYSPPLSVPQRYVVPCK 1010
            A+ L ELHQ++   QE+R+RS  NL NI KTHE+M+ E +++ Y+++KL+ LY TA +DA+ E  ++++A++KI EIK    ++   +        S              MRRGVLM++LQQ+A+ LP+W     + PPPLCG +PA   Y+ +PGD VAARVK  + +EQ+ILAEVVSY++AT KY+V+DID   EEGK   ERHTLSRRR+ PLP  KA+P+ +PEALFQ +Q VLALYPQTTCFY+A+IH+ P+  + DY+VLFEDTSYADGYSPPL+V QRYVV CK
Sbjct:   11 AELLTELHQLIKQTQEERSRSEHNLVNIQKTHERMQTENKISPYYRTKLRGLYTTAKADAEAECNILRKALDKIAEIKSLLEERRIAAKIAGLYNDSEPPRKT--------MRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDID---EEGK---ERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACK 288          
The following BLAST results are available for this feature:
BLAST of TCONS_00000370 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SGF293.961e-10453.42SAGA-associated factor 29 OS=Homo sapiens GN=SGF29... [more]
back to top