Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000304 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000304
Unique NameTCONS_00000304
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length732

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000304 ID=TCONS_00000304|Name=TCONS_00000304|organism=Clytia hemisphaerica|type=transcript|length=732bp
CAAAGTTCCGAGCATGCGTAGTTTCACCAATATTCTTGTTTGTAACGCTG
CTTTTGCTGATTTGCTAATCACTTTAGTGCCCAATGTTCACGAGGTGATT
GATATCGTGTATTATCAAGGAGACTGGGTCCTAGGTGGTTTCATGTGTTC
GTTTTTGTACATGTGTATCTATTTATCGGTAGCAGCGACTGTTTTAACAC
TCGTTTTTATCNTATACATGTGTATCTATTTATCGGTAGCAGCGACTGTT
TTAACACTCATTTTTATTACCATTGATCGTTATTTCTCGGTGACCATGCC
CTATAAGAAATTCATGAAATTGTCGGATTTACCGAAAGTTGTCGGCGTGA
TTTGGTCGGCCGCGTTTTGTTTCTCGTCACCGactgtttttatacaaaaa
gtaATCCCCTTTGATGGACGAATGATTTGTATTGAAAGATGGGATTCACC
TTTTGATGTCAAGGAATCACCTAAACATTATACTATCATTCTATTTATGT
TTTTGTACGCACTACCCTTAACTTTAATGGGGTTGATGTATTGGGCCATC
GCTCGTAAATTATCGAAACAATATCGGGCGTTAACCAAACGACTTAACGA
ACAAGGTGTGGAAACTACTTCTGTTAGGGAATCAACTCCCAGACGTGACG
GGTATTCCCCGGTAACAAGTGAAAATAGAAATAAGGTACTGGCTGATAAT
TTAAACAGGAGCATTAGGGAAGACGAATTAAA
Run BLAST on NCBI

protein sequence of TCONS_00000304-protein

>TCONS_00000304-protein ID=TCONS_00000304-protein|Name=TCONS_00000304-protein|organism=Clytia hemisphaerica|type=polypeptide|length=243bp
KVPSMRSFTNILVCNAAFADLLITLVPNVHEVIDIVYYQGDWVLGGFMCS
FLYMCIYLSVAATVLTLVFIXYMCIYLSVAATVLTLIFITIDRYFSVTMP
YKKFMKLSDLPKVVGVIWSAAFCFSSPTVFIQKVIPFDGRMICIERWDSP
FDVKESPKHYTIILFMFLYALPLTLMGLMYWAIARKLSKQYRALTKRLNE
QGVETTSVRESTPRRDGYSPVTSENRNKVLADNLNRSIREDEL
Run BLAST on NCBI

transcript from alignment at sc0000001:964050..964781

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000304 ID=TCONS_00000304|Name=TCONS_00000304|organism=Clytia hemisphaerica|type=transcript|length=732bp|location=Sequence derived from alignment at sc0000001:964050..964781 (Clytia hemisphaerica)
TTTAATTCGTCTTCCCTAATGCTCCTGTTTAAATTATCAGCCAGTACCTT ATTTCTATTTTCACTTGTTACCGGGGAATACCCGTCACGTCTGGGAGTTG ATTCCCTAACAGAAGTAGTTTCCACACCTTGTTCGTTAAGTCGTTTGGTT AACGCCCGATATTGTTTCGATAATTTACGAGCGATGGCCCAATACATCAA CCCCATTAAAGTTAAGGGTAGTGCGTACAAAAACATAAATAGAATGATAG TATAATGTTTAGGTGATTCCTTGACATCAAAAGGTGAATCCCATCTTTCA ATACAAATCATTCGTCCATCAAAGGGGATtactttttgtataaaaacagt CGGTGACGAGAAACAAAACGCGGCCGACCAAATCACGCCGACAACTTTCG GTAAATCCGACAATTTCATGAATTTCTTATAGGGCATGGTCACCGAGAAA TAACGATCAATGGTAATAAAAATGAGTGTTAAAACAGTCGCTGCTACCGA TAAATAGATACACATGTATANGATAAAAACGAGTGTTAAAACAGTCGCTG CTACCGATAAATAGATACACATGTACAAAAACGAACACATGAAACCACCT AGGACCCAGTCTCCTTGATAATACACGATATCAATCACCTCGTGAACATT GGGCACTAAAGTGATTAGCAAATCAGCAAAAGCAGCGTTACAAACAAGAA TATTGGTGAAACTACGCATGCTCGGAACTTTG

Coding sequence (CDS) from alignment at sc0000001:964050..964781

>TCONS_00000304 ID=TCONS_00000304|Name=TCONS_00000304|organism=Clytia hemisphaerica|type=CDS|length=729bp|location=Sequence derived from alignment at sc0000001:964050..964781 (Clytia hemisphaerica)
TAATTCGTCTTCCCTAATGCTCCTGTTTAAATTATCAGCCAGTACCTTAT
TTCTATTTTCACTTGTTACCGGGGAATACCCGTCACGTCTGGGAGTTGAT
TCCCTAACAGAAGTAGTTTCCACACCTTGTTCGTTAAGTCGTTTGGTTAA
CGCCCGATATTGTTTCGATAATTTACGAGCGATGGCCCAATACATCAACC
CCATTAAAGTTAAGGGTAGTGCGTACAAAAACATAAATAGAATGATAGTA
TAATGTTTAGGTGATTCCTTGACATCAAAAGGTGAATCCCATCTTTCAAT
ACAAATCATTCGTCCATCAAAGGGGATtactttttgtataaaaacagtCG
GTGACGAGAAACAAAACGCGGCCGACCAAATCACGCCGACAACTTTCGGT
AAATCCGACAATTTCATGAATTTCTTATAGGGCATGGTCACCGAGAAATA
ACGATCAATGGTAATAAAAATGAGTGTTAAAACAGTCGCTGCTACCGATA
AATAGATACACATGTATANGATAAAAACGAGTGTTAAAACAGTCGCTGCT
ACCGATAAATAGATACACATGTACAAAAACGAACACATGAAACCACCTAG
GACCCAGTCTCCTTGATAATACACGATATCAATCACCTCGTGAACATTGG
GCACTAAAGTGATTAGCAAATCAGCAAAAGCAGCGTTACAAACAAGAATA
TTGGTGAAACTACGCATGCTCGGAACTTT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000178XLOC_000178Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000304-proteinTCONS_00000304-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000304-exon-sc0000001-1491911889:964050..964781TCONS_00000304-exon-sc0000001-1491911889:964050..964781Clytia hemisphaericaexon
TCONS_00000304-exon-sc0000001-1510915933:964050..964781TCONS_00000304-exon-sc0000001-1510915933:964050..964781Clytia hemisphaericaexon
TCONS_00000304-exon-sc0000001-1575043694:964050..964781TCONS_00000304-exon-sc0000001-1575043694:964050..964781Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:964050..964781 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.13567 0.19845 0.230419 0.225429 0.182959 0 0.174425 0.65318 0.34298 0.212418 0.137452 0.361422 1.12787 0.890195 0.038519 0.206684 0.254618 0.52195 2.37964 1.96191 0.459108 0.479864 0.622227 0.424271 0.582652 0.260002 0.186031 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: Biological Process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: Molecular Function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007186 G-protein coupled receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004930 G-protein coupled receptor activity
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000304 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top