|
|
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00000304-protein ID=TCONS_00000304-protein|Name=TCONS_00000304-protein|organism=Clytia hemisphaerica|type=polypeptide|length=243bp
KVPSMRSFTNILVCNAAFADLLITLVPNVHEVIDIVYYQGDWVLGGFMCS
FLYMCIYLSVAATVLTLVFIXYMCIYLSVAATVLTLIFITIDRYFSVTMP
YKKFMKLSDLPKVVGVIWSAAFCFSSPTVFIQKVIPFDGRMICIERWDSP
FDVKESPKHYTIILFMFLYALPLTLMGLMYWAIARKLSKQYRALTKRLNE
QGVETTSVRESTPRRDGYSPVTSENRNKVLADNLNRSIREDEL Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
This polypeptide derives from the following transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
| Term | Definition |
|---|
| GO:0007186 | G-protein coupled receptor signaling pathway |
Vocabulary: Molecular Function
| Term | Definition |
|---|
| GO:0004930 | G-protein coupled receptor activity |
Vocabulary: Cellular Component
| Term | Definition |
|---|
| GO:0016021 | integral component of membrane |
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
| Category |
Term Accession |
Term Name |
| biological_process |
GO:0007186 |
G-protein coupled receptor signaling pathway |
| cellular_component |
GO:0016021 |
integral component of membrane |
| molecular_function |
GO:0004930 |
G-protein coupled receptor activity |
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR000276 | G protein-coupled receptor, rhodopsin-like | PRINTS | PR00237 | GPCRRHODOPSN | coord: 109..130
score: 19.11
coord: 9..30
score: 29.54
coord: 75..97
score: 29.64
coord: 161..184
score: 23.51 |
| IPR000276 | G protein-coupled receptor, rhodopsin-like | PFAM | PF00001 | 7tm_1 | coord: 72..210
e-value: 7.0E-17
score: 61.4
coord: 4..70
e-value: 2.0E-7
score: 30.5 |
| IPR000276 | G protein-coupled receptor, rhodopsin-like | PROSITE | PS00237 | G_PROTEIN_RECEP_F1_1 | coord: 81..97 |
| None | No IPR available | GENE3D | 1.20.1070.10 | | coord: 1..71
e-value: 6.4E-11
score: 41.2 |
| None | No IPR available | GENE3D | 1.20.1070.10 | | coord: 72..231
e-value: 2.8E-22
score: 78.6 |
| None | No IPR available | SUPERFAMILY | 81321 | Family A G protein-coupled receptor-like | coord: 3..72 |
| None | No IPR available | SUPERFAMILY | 81321 | Family A G protein-coupled receptor-like | coord: 70..195 |
| IPR017452 | GPCR, rhodopsin-like, 7TM | PROSITE | PS50262 | G_PROTEIN_RECEP_F1_2 | coord: 1..243
score: 17.824 |
Blast
The following BLAST results are available for this feature:
|
