Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000260 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000260
Unique NameTCONS_00000260
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2875

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000260 ID=TCONS_00000260|Name=TCONS_00000260|organism=Clytia hemisphaerica|type=transcript|length=2875bp
GCAGGACTCGTCCTCCGAGAACGCCCTCGCTCGTAACCAGTGTCCATAAA
TTTTACGTGTCTTCTTCATGAAAGTTCAGTGGGGCTCAACGATAATATAA
TATGTATATTTCCTGCCGCGGCAGACCAAGCTTACATCTTGTCAAAAATA
AGTTGCATAATCGTAGTATGAGCTAGCTGAAATCGACTGaattcattttt
ccaagaaacaaaatggcgtcgGTGCTTCGAGCTGCTTCCCGAACTTTATC
ACATTCAAAAGtcattttgaagaacaaaaCGTCGCTCTATAGTCtgaaag
gaaatatttcaaccaCATCAAAGCTTCTAGTTGCAGGAATTGATGAtgat
ttgtttgatttgacAGAAGAACAAAAGGAGTTTCGTCAAACTGTTCATGA
CTTTTGCACCAAAGAACTTGGTCCTCACGCAGACCAAATTGACAAAGATA
ATGGATGGAGTGATCTAAGggacTTTTGGAAGAAGCTTGGTGAAATGGGT
CTTCACGGCATTACAGTTCCTGAAGCAGACGGAGGTCTCGGCCTGGGTTA
TTTTGAACATCTGATTGCCATGGAAGAGATGTCTCGTCAATCGGCTGCTC
TCGCTCTTAGCTATGGTGCACACTCTAATCTCTGTATCAACCAAATCGCT
CGTAACGGTAACGAAGACCAAAAGGCAAAATATCTTCCTAAGCTGATCAG
TGGAGAGCATTTCGGCTCCTTAGCTATGAGTGAAACAGGATCAGGATCGG
ATGTTGTTtccatgaaaatgaaagcagAGAAACAAGGAGATTATTACATC
TTGAATGGTAATAAATTCTGGATCACAAACGCCCCTGATGCGGATACTCT
AGTCGTGTACGCTCGAACTGATTCTTCAGGCAAACCTGAGCATGGAGTCA
CTACCTTTTTGATCGAGCGGGGAATGGAAGGTTTCTCTACTATGCCCAAA
CTTGACAAACTTGGCATGCGTGGTTCAAATACAGCTGaattgtttttcga
agattgcAAAGTTCCTGCTTCAAACATTATGGGTGAACTTAACAAAGGAA
TCTACGTTTTGTTCAGTGGATTGGATATCGAACGCCTTTTACTGTCAGGT
GGCCCGCTCGGTATTATGCAAGCCGTCATTGATCTAGCTTTCCCGTACGC
GCACATGCGCAAACAATTTAACCGACCAATCGGTAGCTTTCAATTGCTCC
AAGGCAAGATGGCAGACATGTATGTTGAACTTTCCGCTTGCCGTGCGTAC
GTTTATTCTGTCGCGCGTGCACTCGATAAAGGTCATCTCATCAGTAAAGA
TTGTGCGGGAAGTATCTTATATTCAGCCGAGAAATGCACACAAATGGCTC
TCGAGGGAATTCAAATTCTCGGAGGAAACGGATATATTAATGACTATCCG
TCCGGAAGGTATTTGAGGGACGCCAAGTTGTATGAAATTGGTGCTGGAAC
ACAAGAAATCCGGAGATGGTTGATCGGGCGTCGCTTGAACGAAGAATATT
CGgaataatattttttatttttttctgtctttgtcttttaagtcattttt
ctatttAAGTCACGTGCCAAACATCAGGCCCAAGCTAATGAGTCTTCTAA
AGttgactctctttaattcgatcttcaagtgaccaaaacttttttcgaat
taaagaaaaattcgaattacatagagtaatttaaaccattTTCCAGCTGA
GGAGACCAATTTtttggttcgaattatagaaagattttaaTACTGACCGA
ATTCttctgtatttcaaaatgaaacgaTGACTCTTCAGCTAAACGTATTC
GAATCCCACTTTTACTCGAAGAAAATTCTCCTTAGCTCCTTAaagattga
attagagagattAAGCCGtataaatttgaccaaatttacTATGTTCTTTT
TACTTGAAGTGCGATATCATGTGGCTCTTCTGTTTTTCTGTGTTCTCTGA
TTTCCTTTTCTATACaatacgtcacttccaaccaatcagTTGTTGTTGAA
GTGATGTCATGTTAGACATTGCAGGCGTCCATATCATGGAGAAGAAACGT
ATGATTAAGTCGAAAGATTTCCTCTAAGACAATCAAAATAGGTCACTTGT
TCTCAGTCCTCTGTGTTACACAAGTGGACCCTTTGTTATGTTTTAACTTG
ACTTGATTGGCAAGTACTAGCTGgattaaaatgaatgaaaacagTAGTCA
GCCATTAGGCTTGCATGGTGCTATTGCTGTAAGTCAAAAAGCCACTGATA
TAAAATTACGGCGCCGATATTAACGTTCACAAAGTTGCCGGCGACCGAct
gatcaaaacaaagatggtagacAAGCTACCAGTGTGGACAGGACACCCTT
CCAGAAAAATACATTCAGATAAAAAgctaattttgaaaacttcttAATTT
CTTACCGCTGAATAACTGTTGGCTTAAGTAATTTTCCATATACTCCTGGT
TAGACTAGCCTAAAGCCAGATAGGATCCAATTTCGCCAGATATcgtcatc
attttttatttgaacttttttatttaaaatattaTACTTAATATTTTATT
TGGTCCCAACAAAATGTACTTCGCgtattaaaatttttagaatgaaaatg
acattttaatgaatTGATTTTGTCTTGATATCGAAGCATATACTTTATTA
ATCCGATTGATTTTCATAAATTCGCCAGAgtatataattttcaaaatttg
atttttaaaacacCATTATCTAAATTTGTGCGTATTGTGCtattgttatt
tttcaacaaCGGCGAAAGAATGATTTTTAAGGATTTTCCACATCCAGTTT
TCTCAGCTGCGCCCCTGAGAACAAAATATTATCTCTCACTCTCTATGTTT
TACTTCTACTAGCGTAGCATACTAC
Run BLAST on NCBI

protein sequence of TCONS_00000260-protein

>TCONS_00000260-protein ID=TCONS_00000260-protein|Name=TCONS_00000260-protein|organism=Clytia hemisphaerica|type=polypeptide|length=431bp
MASVLRAASRTLSHSKVILKNKTSLYSLKGNISTTSKLLVAGIDDDLFDL
TEEQKEFRQTVHDFCTKELGPHADQIDKDNGWSDLRDFWKKLGEMGLHGI
TVPEADGGLGLGYFEHLIAMEEMSRQSAALALSYGAHSNLCINQIARNGN
EDQKAKYLPKLISGEHFGSLAMSETGSGSDVVSMKMKAEKQGDYYILNGN
KFWITNAPDADTLVVYARTDSSGKPEHGVTTFLIERGMEGFSTMPKLDKL
GMRGSNTAELFFEDCKVPASNIMGELNKGIYVLFSGLDIERLLLSGGPLG
IMQAVIDLAFPYAHMRKQFNRPIGSFQLLQGKMADMYVELSACRAYVYSV
ARALDKGHLISKDCAGSILYSAEKCTQMALEGIQILGGNGYINDYPSGRY
LRDAKLYEIGAGTQEIRRWLIGRRLNEEYSE
Run BLAST on NCBI

transcript from alignment at sc0000001:2476843..2490300-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000260 ID=TCONS_00000260|Name=TCONS_00000260|organism=Clytia hemisphaerica|type=transcript|length=13458bp|location=Sequence derived from alignment at sc0000001:2476843..2490300- (Clytia hemisphaerica)
GCAGGACTCGTCCTCCGAGAACGCCCTCGCTCGTAACCAGTGTCCATAAA TTTTACGTGTCTTCTTCATGAAAGTTCAGTGGGGCTCAACGATAATATAA TATGTATATTTCCTGCCGCGGCAGACCAAGCTTACATCTTGTCAAAAATA AGTTGCATAATCGTAGTATGAGCTAGCTGAAATCGACTGAATTCATTTTT CCAAGAAACAAAATGGCGTCGGTGCTTCGAGCTGCTTCCCGAACTTTATC ACATTCAAAAGTCATTTTGAAGAACAAAACGTCGCTCTATAGTCTGAAAG GAAATATTTCAACCACATCAAAGCTTCTAGTTGCAGGAATTGATGATGAT TTGTTTGATTTGACAGAAGAACAAAAGGAGTTTCGTCAAACTGTTCATGA CTTTTGCACCAAAGAACTTGGTCCTCACGCAGACCAAATTGACAAAGATA ATGGATGGAGTGATCTAAGGTAAATATAGTTTATGAAAATGTTAGATTTT AAAAACTTGTTTATATTCTCCATTGCAAAAACCTTATTGTGAGATGTTCA TTCATCATTAAAACTACCCTTTATTAGAAACGTACCGTGAAAAAGGGTAA CTTGCATCATTGGAGGCTAACATGCATAGCCCTCAATTGAAAGACCCAGC TGGTCATTAAAATACAAAAATAAATCAAAACAAAAATGGTAGAGTAGAGC TGCGAGCGGAGCTGCGTAGTTGTATTTTAATGACCAGCCAGGTCATTCAT TTGAGGGCTATGCATGTTAGCCTCCATTGATGCAAGTTACCCTTTTTCAC GGTAGTCGTCTAAAAAAACGGCTATTCTTTTTTGGAATCAACCTTACAAT CTAGTTTTTATATTTATAAAAACTAGATTGCTGACGTATGGAAAGGAATG TCGGCGTGACTGATCCTTTTGTTTCGACAGTTATATCAAAATGCCTCGAA AATGTCAATATGAAAATTGCTGCGTAATCAGAGAACTTATGTCTCGCTCA TTATAAAAAGGCAGAGACAAACTTTCAATAATTGGATTGTAACATTGAGT TAAGTCCCTATTGTTAAGTCACCAGGGGGTAAATAAAACAGACCTTGATA CATTTATCGTTCGTTTCAACTTGACGATTCGTTTAAAACTCAGCCTCCTA AATATTTACAGTGTGGCTCGAATCTCTCAGATCCTTGGTTAGAAAAAGCT ATACCTGTTTACTTTTTTCTTGCCAGATTCAACAAGCCATCAACCAANNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNAAGCTAAAAAGGTTACGGGTTTTGG GCAATCGAGGCAAAAATCAGCAAAAAGCTGGTGTTTTCCGTAAATCTGAG AATCGCGATAAGATCCTCACTGATTTAGGGTAGGTAAAATATGTACAAAG AAATTCATACTTTTCCAACCCGGCCAAACTTTAAAAAAAGAAGCGAACAA TAAAATATAATTACCCTTTCCAAATAAACCTCTTCGGTGGCGAGCGTAGT CTACTCTGATGTACTGTAATTGTAAAATTTATGTGATGGGAGTTTGGCAT AGTAATGAAATGTTGTTTGGGGAATTACTCTGTTCTCTGGAATTTCGATT GCATTTATTCAGGTTGATTTTTTATGACTTCTAATGGTAGTTTTTCTAAC GAGTTTGATTACTCTGTTCTCACACTTATGTCNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTCTCACACTTATGT CTTTTTTTTTCGTGTCCTTTTCCGTGATTACTTTTATTTATATTTTTAAA GACAGGTAAGAAGGCATATTGATGTAACTGTTCGATAATAACATCAAAGC GGGAACTAATTTTCTTCTCGTTTCTTTCTTTCCTTTTTCTTTCTAATAAA TTCAAGCTTTCCCTCACACCCTCCAAGCGTGGTTAGGGGTCACTCTAGCC TGGATATCCAGCCCGTAAACTTTTTTTTGATTTTGATATTTCTTATGTTT ACAGTCTGGTTTATCTAGATTGTCTGCATTCTCATCTGAGGATGATTATG CGGATATTCTGATTGGTTGGTCCAAGCGAATCAGAGATCTGAATGGTGGC GCGCGTATAAGAAATTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTAGATGTTCTGGT TGTTTTCTTTTCAATTACTTGCTTAGATATTCTTGTTTTAATCTTCTTAA TGACTTGGTTGCATCGTGTAAAGAACTAAAAAGGTATATTTTTATTTTGC TTCAATTCTTCTTTTCTGTTTGCCAATTTCGTATTGCTGTTTTGGGTTGG ATATTTTGAAAAAAATTTTCTCCAAAATTTACTTTGCACTTTGTCTAACA GACTTTCCACCACACTGTCTATATTTTATGGTCAAGGCTGCCATTCTAAA TTGATTTATCACTGCTGGGGTACCATCTTGAAATTATACATGTCATTATG TGCATATATTTATTTGCAGCCATGGGATTCATGCAGGAGAATCTGTCAAC GGGGGTTCACCTGATTTCTAGGTGAACCAAGCTCTATAATTTTAGAACTT TGTCTGGCTGAGGTAAAACTTATTTTTTCTAAAATTTTGAGCTTGGATAT CCAGGCTAGGGTCACTCACATATCGATGTTTTCTGCAACTAACGTCGTTG TGACGCGAGGGGGTAGGGGGGTCAGAGCCTATGACGCTAAGAAATTTCAA CAGAATATCGATTTTCAAACCTGTAACATTTTGTATTCCATCCTTCGCTA CACCTGCCATCTTAATTCAAACGCATAAAATATAACAGAGATGATATCCG ATACCCTTCCGTTACATTTGTAGGAATATGTTATTATCTCCCTAATCATA AAAACAGAGATACCGCAATAAAAAATAGATGGGCCGTATTTTGATATACA AGGGCCGCGCTGACGGACCGTCTACATAAATATGACAAAACAACGAGCCG TTTGTCTGGGGACAAACAAATGTTAAAGTCATAAGTCAAAACCACTTGTT TTAAAACCGTGCGAAACGAAGCACAAAAATCAATGTGGCTGGAATATCAT TATCTGTAATAGAGAAGAAAAATTACTTTCATCGTTTTTTGGTATATTTA TATAAATGACGCTAAGAAAGGGGGGTGGGGGGGTTCTTCAGATAGCGTCA CAATGACGTTAGTTGCAGGAAAAATCGTTACCATAAAAACTCTTTCACAA GCTCCTAAGACTTTCAAAACTACTAAAAACCACATCAAAACATCAGCCAC ATGTATTTGGGCGATTTGCACTAAATCTGTACCGTCCCGTCCGAAATCAT TTTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNC CTGTCCGAAATCATAACTTTTCAAATATGTTTCAATTTGTAATAAAATGA ATGTTTAACATTCAGGAAGTTATTAGCAAGACCTAGTGGTAAGAAAAATG TTTAAACAGGCCAATTAAAGTAAGTTTTTATACCTTTATTTTAACCTTGA AAATAGGAATTGATTTCGGACGGGACAATTTTCCTGTAAAAATAGGTATT GTATTAAAACCACTACCGGAACAAAAAGAGTGGAAGATTCTCAAGTATTT TCTATTTGGAATAGTTGTATATTTACTTGTATACTTACTGATAATATGCA GAAGGAAAAAGTTTAGCAAAACTTGAAATAAAACAGATTTTTATGAAAAT GATTTCGGACGGGACAGGAAAAATTTAGTGCAAATCACCCTGAAAAAAGA TGAAAAGGTGATACTATGATAATTTGAGGAAAGCCTTTATAGGAACAATT TCAGGCTGTTCTACAGCTTCCTTACTTCCTCAATACATTTTTCTGATGTA TTCTAGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNTAAATAACATGTATTACTTTTTTGTAATTTAATGCGTTATG TATTGATGTTATGTTATGTATATGTTATGATCTTATTATCTTTTTTCCGG TCTGCACTTTAGTGACCTGTGACCTGTTGACCTGTGACCTGTGACCTGCG CTTCGAACTAGCCGCATTTTGTTTTGAAATGAATCTATGTTTTCAGTTTC ATTTGTTTTCCTTTTTTCTGCAGAGTCAGCTTTTCCATAAATTATGCCCG CGCCTCGAAAATATCAAAATGCGCGCGAAAGTACTGCTAAGTAATACGCC GAAAGCTGGCCAATCAGGCCGAACCTGCATTGCAGGGAAAAATGTCCCTG CAGGCAAGTTACCTGCGCCAAGCGTTAAACCAACAGCAAAAATATCATAA ACTAGACTGAAAAAAGTTTAACGCTTGGATTCCCAGGCTAATGACAACCA TGCAAGAAAGATAAGCAAACAGTTGGATCAAGTGTCAAACATTTTGACCC GGAAATCAATTATCATTCTGTCTTTAAAGTATAAAACGAGAATGATTCTG AAGGAAGTTATTTGACGATTCTCTTACAAAGAATCGCTCGCTCACTCGCT GGCTGAAAGTGAAAGTGAAAGTAGTGAAACTGAAACTGAAACTGAAACTG TCAGTCACCAAACGAAGGCGCAAACGCCTATCTGTTCTTCTATATAACAG CCTTGAATAATCCCTTGTGGTAAAAAAAAGATTGAAGAAAAAACAACTTA AAAAAGTTCTTATTAAGTGATGCTATCATATAGCTTATCTAAACCTTACA CAGAGAGGAGGTAATATATGCTAGTTACTTGTTTGATTGACCTTCATTAT AATAGAAAGAGAATTAAAAAAGGAATTTGAAGAATTGAAATAATTGACAT CCAGCGGGATCAAACTCAGAAACCCATGCTTATGAGACAGACGCTCTAAC CGGTTGAGCTAACCACGCTTGGAAGGTGTGAGGGAAAGCTTGAATTTATG AGAAAGAGAAGGAAAGAAAGAAACGAGAAGAAAATTAGTTCCTGCTTTGA TGTTATTATCGAAACAAAGGGATCAGTCACGCCGACATTCTTTTCCACAT GTCAGCAAACTAGATTGTAAGGTTGATTCTAAAAAAGAATAGCCGTTTTT TAGACGACTACGTTTAGACCTTTTTGCCTTGCCTTTCCATGCCATCCACC ATCTTCGTGAATTGTATGCAAAAGAATGGTGCTGAATTTGCCTTGGTTAG ATTTCTTACTCTCGACTAAATTGTCATGATGCAAGGCTGGTTGCAAGTAC CGTATATTCTAGCCTGGCGGTTTAGTGGAAATACCTCCATTTAAAGTCTA TTAAGGTTCACAATAATGACTTTCTTTTTATGGAAACCAAACAAGTAAGA ACAAGTCATTAAAACGAAAAGTCAGCGCTCCGTTGTTGTGACATGGGTAA TTACAGTAATTTTCACAGTTTCTTGTAAATTCTACGTCATTTTTTAAACC TCTTAGTATGGACAACGTGTCATTCCACAGTAGACCTAACACTTCATACA AAAATTACGGGAAACGCATATTTGGACTTTGTACCCTATGCTGCACGCAA GCACTTAAGCTAAAGCGGGAATATCAAATAAAGCATCTTCTGAAAATTTC ATTCTTCCCCATAAACAAAGAAGCTTTTGTTTTCTGATAGTCTTTTTAAT CTGCCATGAAGTGTTATATATAAAATTCCTTATAGAAAGACACATTCTCC TAGGAAGAGGCTTCAAAAAAATGACGTAGAAAAAAGTGTTAAAAAGTATG TCATTTTATCTTAACAATTTTGTAAACTACGTCACAACCACAGAGCGCTG ACTTTTAGTTTTATGACTTGTTCTCACTCATTTGGTTTCTGGTTTTGTTT TGGTAATGAAACTGATAAAAAGAAAGTTGTTATTGTGAACTTTGAACATG CTTTTTAAAAATCGAGGTTCTTCCACTTAATTCATAATTGAAGTTGTTGA CAGACTTTCTGAATTTTGGAAGCCCAGAGGCAAACATACATAATCAATTT ACCAAAAAAACTCTTTCACAACGAGCTCTAAAGACTTTCAAACCTACTAA AACCACATTAAAACACCAGCCACCCACATGTATTTAGACTCCCAGTCAAC AGCCATTTTATTTCTAGATGAATCTATGTTTTCATTTTCATTTGTTTTCC TTTTTTCTACATAGTCAGCTTTTTCCATAAATTATTCGCAAAATGATCAA AATGCGCGCGAAAGTACTGCTAAGTAATACGCCGAAAGCTGACCAATCAG GCCAAACCTGCATTGCAGGGAAAAATCTCCCTGCAGGCGAGTTAGTTACC TGGGCCAACATTAAACAAGCAGCAAAAATATCATAAACTAGACTGTGAAA AAAGTTTAACACTTGGATTCCCCAGGCTACGTAGATTTGTCTTCTATCGA AATCCTTTAATCTCAACATAAGCACAACTCTATGCACATACTGAATTTGG ACGATCTTCTATGTGATGTTTTTTCGCAAACTTTATTCCGCATTGGGTAC AAAATCCAAAAATTGCGTTTCCTGTAAATTTTATATGAAGAGATAGGGCT ATACTGCCTATCTCCTATAACTAATTAGCATGCTTTCCACAAAGATATAA AAATCATAACAACTTTTTGCATGCAAGGAATTTTCTGCCCTGCCGCCCTG TCTCGACAATCTAAATGAAAAATAGTGAGTTGTATGTGCCTTAGTGCCTA GAGTGTGTGCTTACCATAAAAAATAAGGAAGGGAAACCAGGTCAGGTCCT AAGCGTGCAAATCATTTTGATCACACATACACTTGTTAGATAAGAGGAAT GCCAAGAATTTCATAAAAGGTTCACAAACGTCTTGAATATTTTGCACATC CGGTGTCAAAATTAAAATTAGATTGGGACATCAGATTTTTTTGTTTTCAC CTGTTTGGATTTGCCTGATATGAAATGGATATTTTTTGGTAAAAATACGA TAATTAAGTTCCTGCAAAATGCAATGTTTTTAAACAAAATTTTCACCCTG AAAATCAGTTCCACAAAAATTAGTTCCATTGAGTTTATCTTGGATGAAAA ATTAGTATCAGCTGGATTTACAAAAACATTTTTCAACCCCTGATCCAACT AGCATCAAATGCAAAGTGTTCTTTTCAAATAAATATGCTCTGAAACAATG CAAGATCCTATCCAAATTTCTTCTTATAAGTGATATTGAGCCACCAGAGA ACTTGTACAGGAAAAATGAAAAGAAATTATAGGAGCCACTTTTGAAATAT ATTTACCCAAAATTAACATTCTTTCGGTAAAATTTCCTTGAGAGTTACTT TGAGCAAAGTTTTTGGAGAAAGGACGCTATTAAGATTGTTAAGAAGCTGC TTTTCTAGAAATTTACCAACCATTGTATCAACAATTCATGTTTAGTTTGT GTCCTAATTAATAGTTTCAGAGCTGAGAAGGGGTACCTAAAAACTCATTC TAAAATAATGCAGAAATTCGGGTCCACTTTATGGGGGTCATGGAGCGTGG AAAAATTCGGGGGGGGGAGGGACACTCAAGGTAAACAACCTACCGTATCA ACAACCTACCGGGTCCTTTTTCCAATCTTCCCAAAGTGCACTGTAAAGGT CGAAATGAGCAAAGATGAGAAAAAGTGCTCTCTAAATGTGTAAAACCTGA CCATATTTGTATCAAAATGGTCTAAAATCTTCAAGAAAGTACACCGATAG CACAAGGGTCAATTTTTGCCCCCAAATTTACTCAAATTTGACTAAGGGTC CGATTTCAAAGGCCTAATTTTGAACCGCAGTAGGTCGTTTTTGAATCGAT TTTGAATCACTGTGAAAATGATTGACATATTGAATTTAAATATCCAATTA GGATATCATAATTTAATGGATATAATACTAACAGAAATAAACACTAAACA CGAGAAATCTGACTATTAATGGCAAAGTTGATTTCTAAATTATGAACTAA AATGCCCTAAATTTTAGCTAACCTAAGTTTCAACCATTTATCAAAAATAT TTAATATAACACTAGTCCAGAAAATTCTTGCATTCTTTTGTTTTTTTTTC AGGGACTTTTGGAAGAAGCTTGGTGAAATGGGTCTTCACGGCATTACAGT TCCTGAAGCAGACGGAGGTCTCGGCCTGGGTTATTTTGAACATCTGATTG CCATGGAAGAGATGTCTCGTCAATCGGCTGCTCTCGCTCTTAGCTATGGT GCACACTCTAATCTCTGTATCAACCAAATCGCTCGTAACGGTAACGAAGA CCAAAAGGCAAAATATCTTCCTAAGCTGATCAGTGGAGAGCATTTCGGCT CCTTAGCTATGAGTGAAACAGGATCAGGATCGGATGTTGTTTCCATGAAA ATGAAAGCAGAGAAACAAGGAGATTATTACATCTTGAATGGTAATAAATT CTGGATCACAAACGCCCCTGATGCGGATACTCTAGTCGTGTACGCTCGAA CTGATTCTTCAGGCAAACCTGAGCATGGAGTCACTACCTTTTTGATCGAG CGGGGAATGGAAGGTTTCTCTACTATGCCCAAACTTGACAAACTTGGCAT GCGTGGTTCAAATACAGCTGAATTGTTTTTCGAAGATTGCAAAGTTCCTG CTTCAAACATTATGGGTGAACTTAACAAAGGAATCTACGTTTTGTTCAGT GGATTGGATATCGAACGCCTTTTACTGTCAGGTGGCCCGCTCGGTATTAT GCAAGCCGTCATTGATCTAGCTTTCCCGTACGCGCACATGCGCAAACAAT TTAACCGACCAATCGGTAGCTTTCAATTGCTCCAAGGCAAGATGGCAGAC ATGTATGTTGAACTTTCCGCTTGCCGTGCGTACGTTTATTCTGTCGCGCG TGCACTCGATAAAGGTCATCTCATCAGTAAAGATTGTGCGGGAAGTATCT TATATTCAGCCGAGAAATGCACACAAATGGCTCTCGAGGGAATTCAAATT CTCGGAGGAAACGGATATATTAATGACTATCCGTCCGGAAGGTATTTGAG GGACGCCAAGTTGTATGAAATTGGTGCTGGAACACAAGAAATCCGGAGAT GGTTGATCGGGCGTCGCTTGAACGAAGAATATTCGGAATAATATTTTTTA TTTTTTTCTGTCTTTGTCTTTTAAGTCATTTTTCTATTTAAGTCACGTGC CAAACATCAGGCCCAAGCTAATGAGTCTTCTAAAGTTGACTCTCTTTAAT TCGATCTTCAAGTGACCAAAACTTTTTTCGAATTAAAGAAAAATTCGAAT TACATAGAGTAATTTAAACCATTTTCCAGCTGAGGAGACCAATTTTTTGG TTCGAATTATAGAAAGATTTTAATACTGACCGAATTCTTCTGTATTTCAA AATGAAACGATGACTCTTCAGCTAAACGTATTCGAATCCCACTTTTACTC GAAGAAAATTCTCCTTAGCTCCTTAAAGATTGAATTAGAGAGATTAAGCC GTATAAATTTGACCAAATTTACTATGTTCTTTTTACTTGAAGTGCGATAT CATGTGGCTCTTCTGTTTTTCTGTGTTCTCTGATTTCCTTTTCTATACAA TACGTCACTTCCAACCAATCAGTTGTTGTTGAAGTGATGTCATGTTAGAC ATTGCAGGCGTCCATATCATGGAGAAGAAACGTATGATTAAGTCGAAAGA TTTCCTCTAAGACAATCAAAATAGGTCACTTGTTCTCAGTCCTCTGTGTT ACACAAGTGGACCCTTTGTTATGTTTTAACTTGACTTGATTGGCAAGTAC TAGCTGGATTAAAATGAATGAAAACAGTAGTCAGCCATTAGGCTTGCATG GTGCTATTGCTGTAAGTCAAAAAGCCACTGATATAAAATTACGGCGCCGA TATTAACGTTCACAAAGTTGCCGGCGACCGACTGATCAAAACAAAGATGG TAGACAAGCTACCAGTGTGGACAGGACACCCTTCCAGAAAAATACATTCA GATAAAAAGCTAATTTTGAAAACTTCTTAATTTCTTACCGCTGAATAACT GTTGGCTTAAGTAATTTTCCATATACTCCTGGTTAGACTAGCCTAAAGCC AGATAGGATCCAATTTCGCCAGATATCGTCATCATTTTTTATTTGAACTT TTTTATTTAAAATATTATACTTAATATTTTATTTGGTCCCAACAAAATGT ACTTCGCGTATTAAAATTTTTAGAATGAAAATGACATTTTAATGAATTGA TTTTGTCTTGATATCGAAGCATATACTTTATTAATCCGATTGATTTTCAT AAATTCGCCAGAGTATATAATTTTCAAAATTTGATTTTTAAAACACCATT ATCTAAATTTGTGCGTATTGTGCTATTGTTATTTTTCAACAACGGCGAAA GAATGATTTTTAAGGATTTTCCACATCCAGTTTTCTCAGCTGCGCCCCTG AGAACAAAATATTATCTCTCACTCTCTATGTTTTACTTCTACTAGCGTAG CATACTAC

Coding sequence (CDS) from alignment at sc0000001:2476843..2490300-

>TCONS_00000260 ID=TCONS_00000260|Name=TCONS_00000260|organism=Clytia hemisphaerica|type=CDS|length=2592bp|location=Sequence derived from alignment at sc0000001:2476843..2490300- (Clytia hemisphaerica)
GGACTTTTGGAAGAAGCTTGGTGAAATGGGTCTTCACGGCATTACAGTTC
CTGAAGCAGACGGAGGTCTCGGCCTGGGTTATTTTGAACATCTGATTGCC
ATGGAAGAGATGTCTCGTCAATCGGCTGCTCTCGCTCTTAGCTATGGTGC
ACACTCTAATCTCTGTATCAACCAAATCGCTCGTAACGGTAACGAAGACC
AAAAGGCAAAATATCTTCCTAAGCTGATCAGTGGAGAGCATTTCGGCTCC
TTAGCTATGAGTGAAACAGGATCAGGATCGGATGTTGTTTCCATGAAAAT
GAAAGCAGAGAAACAAGGAGATTATTACATCTTGAATGGTAATAAATTCT
GGATCACAAACGCCCCTGATGCGGATACTCTAGTCGTGTACGCTCGAACT
GATTCTTCAGGCAAACCTGAGCATGGAGTCACTACCTTTTTGATCGAGCG
GGGAATGGAAGGTTTCTCTACTATGCCCAAACTTGACAAACTTGGCATGC
GTGGTTCAAATACAGCTGAATTGTTTTTCGAAGATTGCAAAGTTCCTGCT
TCAAACATTATGGGTGAACTTAACAAAGGAATCTACGTTTTGTTCAGTGG
ATTGGATATCGAACGCCTTTTACTGTCAGGTGGCCCGCTCGGTATTATGC
AAGCCGTCATTGATCTAGCTTTCCCGTACGCGCACATGCGCAAACAATTT
AACCGACCAATCGGTAGCTTTCAATTGCTCCAAGGCAAGATGGCAGACAT
GTATGTTGAACTTTCCGCTTGCCGTGCGTACGTTTATTCTGTCGCGCGTG
CACTCGATAAAGGTCATCTCATCAGTAAAGATTGTGCGGGAAGTATCTTA
TATTCAGCCGAGAAATGCACACAAATGGCTCTCGAGGGAATTCAAATTCT
CGGAGGAAACGGATATATTAATGACTATCCGTCCGGAAGGTATTTGAGGG
ACGCCAAGTTGTATGAAATTGGTGCTGGAACACAAGAAATCCGGAGATGG
TTGATCGGGCGTCGCTTGAACGAAGAATATTCGGAATAAATGGCGTCGGT
GCTTCGAGCTGCTTCCCGAACTTTATCACATTCAAAAGTCATTTTGAAGA
ACAAAACGTCGCTCTATAGTCTGAAAGGAAATATTTCAACCACATCAAAG
CTTCTAGTTGCAGGAATTGATGATGATTTGTTTGATTTGACAGAAGAACA
AAAGGAGTTTCGTCAAACTGTTCATGACTTTTGCACCAAAGAACTTGGTC
CTCACGCAGACCAAATTGACAAAGATAATGGATGGAGTGATCTAAGGGAC
TTTTGGAAGAAGCTTGGTGAAATGGGTCTTCACGGCATTACAGTTCCTGA
AGCAGACGGAGGTCTCGGCCTGGGTTATTTTGAACATCTGATTGCCATGG
AAGAGATGTCTCGTCAATCGGCTGCTCTCGCTCTTAGCTATGGTGCACAC
TCTAATCTCTGTATCAACCAAATCGCTCGTAACGGTAACGAAGACCAAAA
GGCAAAATATCTTCCTAAGCTGATCAGTGGAGAGCATTTCGGCTCCTTAG
CTATGAGTGAAACAGGATCAGGATCGGATGTTGTTTCCATGAAAATGAAA
GCAGAGAAACAAGGAGATTATTACATCTTGAATGGTAATAAATTCTGGAT
CACAAACGCCCCTGATGCGGATACTCTAGTCGTGTACGCTCGAACTGATT
CTTCAGGCAAACCTGAGCATGGAGTCACTACCTTTTTGATCGAGCGGGGA
ATGGAAGGTTTCTCTACTATGCCCAAACTTGACAAACTTGGCATGCGTGG
TTCAAATACAGCTGAATTGTTTTTCGAAGATTGCAAAGTTCCTGCTTCAA
ACATTATGGGTGAACTTAACAAAGGAATCTACGTTTTGTTCAGTGGATTG
GATATCGAACGCCTTTTACTGTCAGGTGGCCCGCTCGGTATTATGCAAGC
CGTCATTGATCTAGCTTTCCCGTACGCGCACATGCGCAAACAATTTAACC
GACCAATCGGTAGCTTTCAATTGCTCCAAGGCAAGATGGCAGACATGTAT
GTTGAACTTTCCGCTTGCCGTGCGTACGTTTATTCTGTCGCGCGTGCACT
CGATAAAGGTCATCTCATCAGTAAAGATTGTGCGGGAAGTATCTTATATT
CAGCCGAGAAATGCACACAAATGGCTCTCGAGGGAATTCAAATTCTCGGA
GGAAACGGATATATTAATGACTATCCGTCCGGAAGGTATTTGAGGGACGC
CAAGTTGTATGAAATTGGTGCTGGAACACAAGAAATCCGGAGATGGTTGA
TCGGGCGTCGCTTGAACGAAGAATATTCGGAATAAATGGCGTCGGTGCTT
CGAGCTGCTTCCCGAACTTTATCACATTCAAAAGTCATTTTGAAGAACAA
AACGTCGCTCTATAGTCTGAAAGGAAATATTTCAACCACATCAAAGCTTC
TAGTTGCAGGAATTGATGATGATTTGTTTGATTTGACAGAAGAACAAAAG
GAGTTTCGTCAAACTGTTCATGACTTTTGCACCAAAGAACTTGGTCCTCA
CGCAGACCAAATTGACAAAGATAATGGATGGAGTGATCTAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000141XLOC_000141Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000260-proteinTCONS_00000260-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000260-exon-sc0000001-1575043694:2489832..2490300TCONS_00000260-exon-sc0000001-1575043694:2489832..2490300Clytia hemisphaericaexon
TCONS_00000260-exon-sc0000001-1575043694:2476843..2479248TCONS_00000260-exon-sc0000001-1575043694:2476843..2479248Clytia hemisphaericaexon
TCONS_00000260-exon-sc0000001-1510915933:2489832..2490300TCONS_00000260-exon-sc0000001-1510915933:2489832..2490300Clytia hemisphaericaexon
TCONS_00000260-exon-sc0000001-1510915933:2476843..2479248TCONS_00000260-exon-sc0000001-1510915933:2476843..2479248Clytia hemisphaericaexon
TCONS_00000260-exon-sc0000001-1491911889:2489832..2490300TCONS_00000260-exon-sc0000001-1491911889:2489832..2490300Clytia hemisphaericaexon
TCONS_00000260-exon-sc0000001-1491911889:2476843..2479248TCONS_00000260-exon-sc0000001-1491911889:2476843..2479248Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2476843..2490300 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
79.7783 79.2239 75.6233 80.0295 64.2463 49.9316 54.5086 59.888 46.4706 45.0185 48.8729 51.058 42.6874 48.7502 36.3615 39.8405 56.4628 53.9816 23.944 24.0103 44.299 43.7925 58.5581 57.1782 45.649 50.6103 35.3266 34.0757 33.8387 33.2122
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013786AcylCoA_DH/ox_N
IPR009075AcylCo_DH/oxidase_C
IPR006091Acyl-CoA_Oxase/DH_cen-dom
IPR006089Acyl-CoA_DH_CS
IPR034183IVD
IPR009100AcylCoA_DH/oxidase_NM_dom
Vocabulary: Molecular Function
TermDefinition
GO:0050660flavin adenine dinucleotide binding
GO:0016627oxidoreductase activity, acting on the CH-CH group of donors
GO:0003995acyl-CoA dehydrogenase activity
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
GO:0008152metabolic process
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008152 metabolic process
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0003995 acyl-CoA dehydrogenase activity
molecular_function GO:0050660 flavin adenine dinucleotide binding
molecular_function GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors
Blast
BLAST of TCONS_00000260 vs. Swiss-Prot (Human)
Match: IVD (Isovaleryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=IVD PE=1 SV=1)

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 257/400 (64.25%), Postives = 317/400 (79.25%), Query Frame = 3
Query:  294 LKGNISTTSKLLVAGIDDDLFDLTEEQKEFRQTVHDFCTKELGPHADQIDKDNGWSDLRDFWKKLGEMGLHGITVPEADGGLGLGYFEHLIAMEEMSRQSAALALSYGAHSNLCINQIARNGNEDQKAKYLPKLISGEHFGSLAMSETGSGSDVVSMKMKAEKQGDYYILNGNKFWITNAPDADTLVVYARTDSSGKP-EHGVTTFLIERGMEGFSTMPKLDKLGMRGSNTAELFFEDCKVPASNIMGELNKGIYVLFSGLDIERLLLSGGPLGIMQAVIDLAFPYAHMRKQFNRPIGSFQLLQGKMADMYVELSACRAYVYSVARALDKGHLISKDCAGSILYSAEKCTQMALEGIQILGGNGYINDYPSGRYLRDAKLYEIGAGTQEIRRWLIGRRLN 1490
            L G +S  +  L+  +DD +  L+EEQ++ RQT+  F  + L P A +ID+ N + +LR+FWK+LG +G+ GIT P   GG GLGY EH++ MEE+SR S A+ LSYGAHSNLCINQ+ RNGNE QK KYLPKLISGE+ G+LAMSE  +GSDVVSMK+KAEK+G++YILNGNKFWITN PDAD L+VYA+TD +  P   G+T F++E+GM GFST  KLDKLGMRGSNT EL FEDCK+PA+NI+G  NKG+YVL SGLD+ERL+L+GGPLG+MQAV+D   PY H+R+ F + IG FQL+QGKMADMY  L ACR YVY+VA+A D+GH  +KDCAG ILYSAE  TQ+AL+GIQ  GGNGYIND+P GR+LRDAKLYEIGAGT E+RR +IGR  N
Sbjct:   21 LAGFVSQRAHSLLP-VDDAINGLSEEQRQLRQTMAKFLQEHLAPKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISRASGAVGLSYGAHSNLCINQLVRNGNEAQKEKYLPKLISGEYIGALAMSEPNAGSDVVSMKLKAEKKGNHYILNGNKFWITNGPDADVLIVYAKTDLAAVPASRGITAFIVEKGMPGFSTSKKLDKLGMRGSNTCELIFEDCKIPAANILGHENKGVYVLMSGLDLERLVLAGGPLGLMQAVLDHTIPYLHVREAFGQKIGHFQLMQGKMADMYTRLMACRQYVYNVAKACDEGHCTAKDCAGVILYSAECATQVALDGIQCFGGNGYINDFPMGRFLRDAKLYEIGAGTSEVRRLVIGRAFN 419          
The following BLAST results are available for this feature:
BLAST of TCONS_00000260 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
IVD0.000e+064.25Isovaleryl-CoA dehydrogenase, mitochondrial OS=Hom... [more]
back to top