Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000238 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000238
Unique NameTCONS_00000238
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3357

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000238 ID=TCONS_00000238|Name=TCONS_00000238|organism=Clytia hemisphaerica|type=transcript|length=3357bp
AGGATAAAATGAAAAAGACGGTTCAAACAAAGTCCGTGATATCACCACAA
ATACGACACAACCCAAGTGGGCCATTCACACTGCAGATGATAAAGAGTGG
AAAAGTGATTTTAGTGCAAATAACAACTTGGTTTTAAGTCCAACAGAAAA
TGGTGACGGTACCCAATCTTCTGGATTTCCAAAAGCTTCTTTATTAAAAT
ACGAAATCAGGCATTTAACCAATTTAAAACAAATTGAAGGTCCTGAACAA
TTTTTATCTAAGAATACGAAAAATCCATCGGTCCCGATTACCGAGCAACG
AGAAAACGAAAAAGCCGACGGTAAAAGCGACTCGGAAGACGAGAATATGA
CCGAACGTTTACGATCAACTCGGTATTCGAGTAGTAGAAACTCGGATGAT
TTACTCGGCCGTTCTTCTTACCGTTCAACCCGAACTTCTTACTCAGATGA
CATTGGTGGATTAACACGTGGTACTAGCGCAGGCAGTAGCCGATACCGTA
GAAGCGTACTAGACGACCCGCTCGATACGTACAGAAGTAGCCGTAGCTCG
AGACGCTTAGATGATTATACACCAACGACTGATTATTCAACGACGTCATC
TTCCAGATACGACCGTCCATACCGTAGTACCACGTCTGCAGACGAAACTC
GCTCTTATCGGACAACGTCTCGCCGTACACTTGATGATCCGGTTATAGAA
TCACCGAGACGTTCTCGACGATCAAAAGTGAACGGTATTGACACAGCGAT
AACGACGACATCTGTTACAGCCACGGTAGATGGAGACTGTAATAAGtgta
aagaaaaacaagaaagaatAATCCAAttagaaaatgataaaaataaagag
tttgaaaaatgtaaagaaaagGATTTAAGAATTGAGGAACTAGAAAAACA
ATGCTCTAGGGACTCTGAAAAACGGAAGGAAAAGGATGAACGAATTCGAG
ATTtaattaaagaattaaaaaatgtttccgAAGACGTTAAATCGAAACAA
GAACTGGTTAAAGANAAGATTTAATTAAAGAGTTAAAAAATCTTTCCGAA
GACGTTAAATCGAAACAAGAACTGGTTAAAGACCTCGAAAGCGAGTTAAA
AACGCAACGTACCAATTACGATCAGAAATTAAACGATTTACAAAGTTTGG
AAAGCGAGTTTGTCGAACAGGAAGAAATTCAAATCCGAATGGAAAAAGAT
TTAAATGATCGTGAGGAACGAATAGAACAGTTAGAACATGAAATTCAAGT
CGAAAGAGACACGATAAAATCGAAAGAAGATTTAATCGAAGAATTAACGA
TTCAACTCGAAGAGCTTAAGGAAACTTTGGAAATGAAAGAGGAGAAGATA
TTGGAattggaaaaagattttgagAACGCAAGTGTTGCTCTTATGAACGG
TATCAAACAAATGGAACAACAACCTCGATCTGGTGAAGATATACACGAAC
TGGAGGCTCAATTACAAGATAGTTTAGATGAGCGCGATGGTTTTATGAAA
GAGATTAAGAAACTCGAACGAGAgctaaagaaaatcaataatagCCTGGA
GGAAGAGAAAAATCAGACACGCAGGCTAGGAATTAAACTTGAGGACGCAA
ATTACGAGATCGGGAGATTAAGACAGGAACTTATCAACTCGCAACTGGAG
AACGAAAAAATAGTGGAAGAAAACGAAGATTTAGCTGTGGATAACGAGGA
TTTGATCAAAGAGCGAGATGAGATTATACAAATTTACGAGGAATTGTATC
GAGAGAGTGAACGATTAAAACACGAGGTCAAAATTTGGAAGACTGTGTTC
GATAACAATAAAGATAACATTGATGAGGATGAAATGCGAGAAGCGATGAG
CGAAGGTGACGCACTTGAGGAGAATGGGAAGGAGTCTTCAGATGAAGAGg
agCTGATAGAACTCGAAGAAGACCAATCATTGCTTGTTCCTCCACGTGAT
GATATTCGAATCAAAGTCACAGATGTCTCAAAAGCTTTCGaacaaagtga
agaaatttcaaGAGGTAAATTTGGTAAAGTATACAAGATGGTAGCCCGAG
CTACGGGTGACACCTACGCAGCAAAATACATCAAAGTCACACCCAAACTT
CGCGAAGACGTTCTGAACACGATTGACATTATGAAGAAAATACATCATGT
TCGGTTGATGAATTTGTTTGATGTTTACGATCTGGGATCACAGATTGTCA
TGATTCTAGAATATGTTGGCGGAGGTATGTTATTTGAACGTATCGTGGAA
AAGAATTCACTTACAGAAGCGGAATGTGCTTTATACATCAAACAAGTCTT
GCAGGGATTACATCATCTTCATCTACAAAATATCGCACATCTTGAGTTGA
AGCCTGAGAATATTATTTGCGTGAACCGTAGCAACATGGACATCAAAATC
ATTGACTTTGGATTGGCTAAACAATTGTCACATGACAAACCAATCAAGAT
TACCGCTGGGTCGCCGGAATTTGTGGcaCCGGAAATTTTGTCATTCGATC
CTGTTTCCCTGAATAGCGATTTATGgAGTGTTGGTGTTATTACGTACATT
CTATTGTCGGGTATTTCACCATTCATTGGAGATGATGACAACGATACATT
GATGAATGTTTCCTGTGGTGAATACGAATATGATGACCAAGCGTTCGGTC
AAATCACCAATGATGCGAAATCCTTCATCGATAAACTGCTTGTCTCGAAT
CCTAAGAAAAGGGGAAATGTTGGTCGCTGCTTGCAACATCCTTGGATAAA
TtccaaCTGGCAATCCAAACAAAGTAAAATCAACCTTGGCAACTTGAAGA
CGTTCTTGAAGAAACACAAAGAAAAGGTTAACGTCAGTGCTAGAGGTGCC
ATCCGTCGGTTCAGTTCATTTGGAGTGGGCGGTCACGCCCATGGTTTATT
GGGTGGACGAGGTGGCTCTCCCGTCAGTGTCGGTAGCAGCCGATCGCCTT
CAAAACATTTATTGGTACCGAACGCCCTTCAATCATGCGTGataaatgaa
gatgaagaagaagaggaagaagCAGATGAGAATCAAAACATCCGGAATAT
CAATGATTCTTTACGGAGTGGCCCGATTTTTACTGTAACAAAGGAAGCGG
AAAGGCCCCCTTCCGGTGATTATGGTGAAGCATTACCGGATTTCAATACG
GATACACCAGACGGGTTGAGAAATTATTTACAGCAAATGATTAATACTGG
GTTATTACCGGGCCGTTCTGGACCACCGGACATGTCTGAACAGTTTAGTG
ATGAAGATCATTGAAGGAATAAGAGGTCGGATGATAAAGTAGATTTCCAG
ACAGCGCGAAACGTTCAAACAAGGTATATCAAACGTTCCTAACGTCTTTT
AACGTTA
Run BLAST on NCBI

transcript from alignment at sc0000001:2079465..2092531-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000238 ID=TCONS_00000238|Name=TCONS_00000238|organism=Clytia hemisphaerica|type=transcript|length=13067bp|location=Sequence derived from alignment at sc0000001:2079465..2092531- (Clytia hemisphaerica)
AGGATAAAATGGTAAATCGATAAGATATTTTTAGAAACATTTTCTTAAAT GTACCTACTGCTGATCTGATATATTCCCATTTGTCCACTATTTCTCTCAG TTTGAACCACAAATGATTTTGTAGTTAAGAGATGCTGGCTAAATCGATCT GTCTAGTTAAGGTGCAGTCCGCAGTGCTGATGAGTCCCAATAAGGACAAA ATGCATATACTGCTCTGCTACTCAATCTCCTGAATTAATATATTTGGACA GAAATTCTTATTTCTTCACGCATGCATGAGAGGACGGCTGGTTGTAGGTG CAGATATGTGATTCAATGCTGATTGAACCTCAAATTTGAACATTTGAAAA GACTGTCTTATGGGTGGGGATCGCAGAGTGGTGGATCTCAGGGGGTTCAA AACATAAGACGAGGAGTCTTTCATTTCCTTACAAGGAAGATGGATAAAGA AACACTCTGTATATCTTTCAGTGGGTGTAGAAACCATTTCCCTAGGATAG GCTTAATAGCTTGTTGGTTGCTACATATATGTCAATTTTATACAATCATA TTTTTCTGTTTACACGTTTATTTTTTTATAAGAACATCCAATATTTTTTA AGCTTTTGAATTTTCTTAACTTTTGACTTTTAAGCGTAAAAATTTTCTTA ACATGTTCTTTGTGTTCGCCATTTTTTGAGTATTTTTGTCCATTTTTTTT TCGGGAGTCTGCAAAGCCTCAAAATGTTCTTAACTTTCTTAATATTTTGG TCATCAAAGCCTTATGTTCTTATGTAGTTTGTTTTTATATATAAAAAACG TGTATTCATGAAGAGTTTGGAACTTTCCTCAAAACCTTTTACTTCTTGTC GTTATAGAAAAAGACGGTTCAAACAAAGTCCGTGATATCACCACAAATAC GACACAACCCAAGTGGGCCATTCACACTGCAGATGATAAAGAGTGGAAAA GTGATTTTAGTGCAAATAACAACTTGGTTTTAAGTCCAACAGAAAATGGT GACGGTACCCAATCTTCTGGATTTCCAAAAGCTTCTTTATTAAAATACGA AATCAGGCATTTAACCAATTTAAAACAAATTGAAGGTCCTGAACAATTTT TATCTAAGAATACGAAAAATCCATCGGTCCCGATTACCGAGCAACGAGAA AACGAAAAAGCCGACGGTAAAAGCGACTCGGAAGACGAGAATATGACCGA ACGTTTACGATCAACTCGGTATTCGAGTAGTAGAAACTCGGATGATTTAC TCGGCCGTTCTTCTTACCGTTCAACCCGAACTTCTTACTCAGATGACATT GGTGGATTAACACGTGGTACTAGCGCAGGCAGTAGCCGATACCGTAGAAG CGTACTAGACGACCCGCTCGATACGTACAGAAGTAGCCGTAGCTCGAGAC GCTTAGATGATTATACACCAACGACTGATTATTCAACGACGTCATCTTCC AGATACGACCGTCCATACCGTAGTACCACGTCTGCAGACGAAACTCGCTC TTATCGGACAACGTCTCGCCGTACACTTGATGATCCGGTTATAGAATCAC CGAGACGTTCTCGACGATCAAAAGTGAACGGTATTGACACAGCGATAACG ACGACATCTGTTACAGCCACGGTAGATGGAGACTGTAATAAGTGTAAAGA AAAACAAGAAAGAATAATCCAATTAGAAAATGATAAAAATAAAGAGTTTG AAAAATGTAAAGAAAAGGATTTAAGAATTGAGGAACTAGAAAAACAATGC TCTAGGGACTCTGAAAAACGGAAGGAAAAGGATGAACGAATTCGAGATTT AATTAAAGAATTAAAAAATGTTTCCGAAGACGTTAAATCGAAACAAGAAC TGGTTAAAGANAAGATTTAATTAAAGAGTTAAAAAATCTTTCCGAAGACG TTAAATCGAAACAAGAACTGGTTAAAGACCTCGAAAGCGAGTTAAAAACG CAACGTACCAATTACGATCAGAAATTAAACGATTTACAAAGTTTGGAAAG CGAGTTTGTCGAACAGGAAGAAATTCAAATCCGAATGGAAAAAGATTTAA ATGATCGTGAGGAACGAATAGAACAGTTAGAACATGAAATTCAAGTCGAA AGAGACACGATAAAATCGAAAGAAGATTTAATCGAAGAATTAACGATTCA ACTCGAAGAGCTTAAGGAAACTTTGGAAATGAAAGAGGAGAAGATATTGG AATTGGAAAAAGATTTTGAGAACGCAAGTGTTGCTCTTATGAACGGTATC AAACAAATGGAACAACAACCTCGATCTGGTGAAGATATACACGAACTGGA GGCTCAATTACAAGATAGTTTAGATGAGCGCGATGGTTTTATGAAAGAGA TTAAGAAACTCGAACGAGAGCTAAAGAAAATCAATAATAGCCTGGAGGAA GAGAAAAATCAGACACGCAGGCTAGGAATTAAACTTGAGGACGCAAATTA CGAGATCGGGAGATTAAGACAGGAACTTATCAACTCGCAACTGGAGAACG AAAAAATAGTGGAAGAAAACGAAGATTTAGCTGTGGATAACGAGGATTTG ATCAAAGAGCGAGATGAGATTATACAAATTTACGAGGAATTGTATCGAGA GAGTGAACGATTAAAACACGAGGTCAAAATTTGGAAGACTGTGTTCGATA ACAATAAAGATAACATTGATGAGGATGAAATGCGAGAAGCGATGAGCGAA GGTGACGCACTTGAGGAGAATGGGAAGGAGTCTTCAGATGAAGAGGTAAG GAGAATTTGGTATTTGATCTTCCATCTTACGCTTCTATCCATCCTGGATC CTAGTACCCCTCGTGGTTCTTTCAAAAGGGGGAAGGGGAGCTTACTTGAT TTATCGATAAAGAAATAGAACAGGAGTTTTCCAACTAACCGGGCTTACCT GTTATACTCGGGTATAATCGGAATCCCAGTTAAAACATTGCAATGGTGCA TCTCATGAATTACTGCCGAAAACGGGTTCACTTATATTCATGATATGCAC CATTGCAATGTCTTCAACGGATACAACAGCTGATTGGTTGAAAGTGACGT ATTGACTGATTTTACGTCACTTACAGCCAATCAGCTTTTGGGTCCTCAAT GTAATGTCAGAAGACAATGCAATGGTGCATATCATGATTACTACACTTGA AGCTCTCTAATTCGACGTACTAAGTCGCCATTGACTTAGCTACCGTAGTA CAGTGGTAGAGCATCTGGCTACGGTTCGCAAGGTTGCGGGTTCAACCCCC AGCCGGGTCATACCAAAGATTCCCAAAATGGTACTTGATGCCTCTCTGCT TGATGCTCAGCAACTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNTAGCTATCGAAAGAGGAGCCTTCGGGTCGCCTCCGA CTGCGGTCGCAGACTTACTTACTTAAGTCGCCATCAACAAGTAGGTTACT CTCCCAGCAGCAACTGTAGTACTACTTTACTACTAACCAGCGTATTCTTT TTATTTTCAGGAGCTGATAGAACTCGAAGAAGGTAAGTGATTCTGTATTT TTTTCCTATCAAAAAAGAATATTGACCCTTAAAGAGAAAAAAGGATTTCT TAGGTGTAAAAACTGTACTCTTACCGCTCATAGATACCCAGCAGCAATCT TTCCTATATATCTAAATTCTTGATATGCGAACGTATCTTTTCTAACGTAA ACACCCGAAAAAAGCAGGGATTTGACCCCTGTTTGTTACTAAAAATAGAA ACAAAGTGGAAAAAATTCGGCCTTTTTGGGGGCTTTCCTTAGAAAATATG AAGATTAACTCTTTAATCTAACAGGGACATATTTGTTTACTTCTAGACCA ATCATTGCTTGTTCCTCCACGTGATGATATTCGAATCAAAGTCACAGATG TCTCAAAAGCTTTCGAACAAAGTGAAGAAATTTCAAGGTCTGTTTAATCT TGCAAATTGATGTCATTTTTTAATATTTTCAATTAGTTTTAGCCAATGAA CGGAGAACCGTAATTATCATCAAAATTTTTATCAACGCTTCTTGGCATGT TCTGAGCATAGACATAGTTCGTTTCGTGTTTTTCAATTTTTGAATTAGCA CATAAATTTATTGATATTTGCTTTAGATAGATAGAGATGATATTTTACGT GGATAGCCCAGTAATCTAGGACTTTTAGACAATCTTTCGATTGTTTTCAC GGGGTCCACGGCCAGCCGGCTCGGCTATCTATGAACTGAACGTTGGAAGG AGCGGGGATTTGAACCACGAATCCCTGGTTTGAAACGCTGACGCCTTTGA CCACTTGGCCATCGCTAATTTTACTCACTGATTGTGAGTTGCAATATATT GACAACAAAAAGGATCTTCTTGAAAGAAATTACATAGGTTAGGACGATAG TACATTTTCTCCATCCCGGACATGGGAATTTCGATTCCTCCCGAGAAGTT TTAGAAATATTTTCTACAAGCTGTCAGTTACATTTATTTCATTTTAAATC TTTCAGAGGTAAATTTGGTAAAGTATACAAGATGGTAGCCCGAGCTACGG GTGACACCTACGCAGCAAAATACATCAAAGTCACACCCAAACTTCGCGAA GACGTTCTGAACACGATTGACATTATGAAGAAAATACATCATGTTCGGTT GATGAATTTGTTTGATGTTTACGATCTGGGATCACAGATTGTCATGATTC TAGAATAGTAAGTTTTCCTATTTCAAAAATTAACTTTTTTGGCCATTGTC GTGTTTTAGGCCAATAAAAAGAGGCGATTTATAAGACGCGGGATTTTCAC GACCAACTAAAGTCTCTAGGCCAAACAACAAACTTTTTCTATCTTTAAAG ATTTCTAAATATCGTACACGAAAATCCTTTGCCTATGAACTTACATCCGA AAATGGTCATGTTTTCGTGTATATTAGAGCCCCCTCTTTTCCCAGCTGCC ACACAGAATGTCATAACACGTCGTTAGATGACATTAAAATAAGGTTTAAT ACAAAAAAAGGATCCTATTTATTGAAAGTCTTCTTCTCCAAACATGTTCG TGACCAATCAACAATTTACGTAAGACCTGCATTGTGGTGGGCAACAGCAT CCTAGGGTATATCAGGGAAGCAATAGAGATTTCTAACATTATGTAAGCAA ACCTTCGAATCTTTAGAGGCAATCCCTTACGCAACTCGAACGTTTGCTAC CGGTTTTTGTCAGTAAGGGCAAATTTTTAACAGTTTTTCTCTGGCTTAAA TTTTCCACGGCTGGGGTTTTACCGTAGAAAATATTACGTCATAAATTTTT TCACTGTTTTTCTATTCAGTGTTGGCGGAGGTATGTTATTTGAACGTATC GTGGAAAAGAATTCACTTACAGAAGCGGAATGTGCTTTATACATCAAACA AGTCTTGCAGGGATTACATCATCTTCATCTACAAAATATCGCACATCTTG AGTTGAAGGTATGACCAATTTTTATTACTTCAAAAATTCTTCATTGTTCG CAATCTTAGGTTTATCTTCCACAAAAATGGTATATCTAGTATTGCAACTT TTCAAACCCGTCTAGTCTGGGTGTAGCCTGTCCTGTCAGTAAAAAAAACT AGCACATCTGGTATTGAAGACAAGGTTGAAGGTATCACCGATTTTGTATT TCCTTTGAAAAAATTTCATTTCTTAATTCAATCTCTCACAATTGATGACA TATGCACGATGTCTCAACTTTTGAAATCAGTCTAGTTAAGATAAAAATGA ACTCCGTCTTGTTAGTAAGAGGGGTTTTGTTCAAATGACCCAACCACAAA ATACTGAAATGCCGGTAGTTTTTTCTTGAAAAGGTTCCTCAAATACACCG ATCAAAAATGTTATGATGAGTTTCGGAATACCAGAAAATCGGCCTTTTGA TACCGAAATACCGGTCATTTTTTCGTCAAACAACGAAATATACCGGCCAA TACTGGATTTTTTTCAATGGAAGATATCTAAAAATTTTTTCCATTTTAAC CGTATAGCCTGAGAATATTATTTGCGTGAACCGTAGCAACATGGACATCA AAATCATTGACTTTGGATTGGCTAAACAATTGTCACATGACAAACCAATC AAGATTACCGCTGGGTCGCCGGAATTTGTGGGTAAGTTATGTGAAAATGA AATCCATTTTTTTCCTTCGTCTTTCTTTTCTTCAGCGTTTGGGTAATCAA ATAACAGATAATCCATTCTGGGCATACCACGCTCCGTTCTAAAGAAATAT GATGAATGTAACGATCCTACCTTGTTGATCAGCCAAAACAATCAAAACCG CGTAGCCTTTTGCTTGAAAGCGAAAGCGAAAGTGACCGCGTAGCCTTTTG CATGAAAGCGAATGCGAAAGCGAATGGGTGTTAATGTTTATACGAACGAA GTTTGTTTTGGTGTGATTGTTTTGCTTTAGCACCGCTTCTAAAAGCTCAT TAATATTCATCCAAAATCTGGATTAAAAAGATCAAAGTGCTAGCCTGGGC AGAATCTCTTACAGTACTATGACTTTTAGAGTGAATACGTGCCAGCGTGG AGTAATCAGATTCTGATCGGAGATAAGCGTTTGGGATGGGTGTGCATGCA CAATGGGAATAACCGAAATAGAAACATTGTCATCATTCATAAAAAATTTT TTCTTTACAATTATAGCAACTAAACAGAAAAAACAAAACCGTCCTTTAAT AATTTTCATTCGAAAAGATTAACTCTACTGGATTAGATAGATCAAGACTA CCCCCGGGCAAAAACCTCCATAACCCCGGTAGCCGAAAATGGGTNTTCAC TTATTTTCTAATCGTTGAACCGAAAATAACTTTATTTATTTACTGCACCT TCAGATAAACACACGGAAAGACAGAAAAATTTGAGAAATTTTGATATTTT TTGAGACAGGTTTTGACCACTTTTATTTAGCTTAGTAATTCATCGTTTCA AGTGTGTAGACTAAAAGCATGCGAGAAGCCTAAATGGAAACTACGTTTAA AGTAAGCAAAATTAAAAGCCACCGAAAAAAAAAATGCCTTCTATAAACCT AAGTTCCTCGAAGTATATAATAAATTCTCTAAATCTTCCGATATGTATCT GTTTTTGACCCCGACTGATTTCCATCTGCCGTGTTTCATTATCAACCGAN NNNNNNNNNTGCCTTCTATAAACCTAAGTTCCTCGAAGTATATAATAAAT TCTCTAAATCTTCCGATATGTATCTGTTTTTGACCCCGACTGATTTCCAT CTGCCGTGTTTCAATATCAACCGATCCGGAACACCAAGATTTGCAGCTGC AAACGCTCCGCCCGAGGGCAAACTATGAACACCATATTGCTTTTGGTCCA AACCTATGTCTTTTATCACCTTCTTGATATCGTCACGTACCGAACTGTAA GAAATTGGCTGATCTTTATTCCATAGACGATTGTTTCGTTTGGATTTAGT TACTCCTCTAAAAATAAAATTCTCAGAATAATTTTTTATGTTTGCCAATT CGAGGTACCTTTCCAAACCTTTTACCGGACACAGGTTTGAATTAAGTCTC GCAATGTAAACCCAGTGGCCCTGTCTGTATATGTCAGTTTTACTGCTTTG GATAAAAATTGTAGCATGATCATGAAGGAATTTTATATCTGATCTTCTAA GCTTTTGGCATTCATCGAACCGTAGAAAAGCTGAAAAGGATAGCAAGCAT ATCGCTAAAGTCCTTGAATTTTTGAGGCTAGAACCAACGTCTAATTTTTC AAAAATTTCTCTCAAATCTTCGACTACAAAATTTGTCTTCTTCTTTGGTG TATACGCCAATAACCGTTTAAAGGCTTCCAATAGGTGCTTTACAATTGTA GAATTCCCGATCAAATACCCCGAAATAGCATGAAAATGTTTTATGGCGCA ATAAGACGCTTCCAAGACTTTCCCGATTGAAATTGGGACATCAGAAATAA GATTAAATGTTGCTCTTGAGTAGGTAAAGGGTTCACTTCCTGGAAACTAC GACTCCATTCTTCCCATTTTTGGAAATAAAACTGATACTTAGCCACGGTG TTATTGCTTCTGGAATTCAAAAGAATTCCTGGTAATTGCTCAGAGAGACT CTTTAGTGCTGGATCCTGGACATCAAAATAGTTTCCTAATACGGTTTCTG AATCTGAGCTAAAAAGTAAAATTTTTTGTTAATTTTCTGCATTGAGAAGA AAAAAACATTTATTTTTACCGAACACACGTTGATTGTCACACTTGTAATT TTAAAGCTAGAATTGGGATTTCTAATTTTTCATTTCCCATCAGAGAACCT TGGAATCATCCTTTTGTGATTAATGCGACTTGATTTGCAAAATATCTACA ATCCTTGACAAAAGGCTTAAAAGAGCTATTATCCCTGATCAGAAAGGTCC AAAAGGCTGCCGATGGCCAGAACGGTATTATTAAAGTCCCTGTTGTTCCA GGTTTGGCTNTGCCGATGGCCAGAAGGGTATTATTAAAGTCCCTGTTGTT CCAGGTTTGGCTGCTAGGAGATGTTTAATACACTTTGTTATTAAATAAAT AGGTGGCACCATTAGAGCATTTTCCCCAGACCAATCAAAACTGAATGCGT CTACTTTGAATGAAAATGGACAAAAGTATTTTGAGCAAAAACGTGCCCAT TTAGTGTTAGAATTATCAGCAAAAAGATCTACAGAAAAAGGTCCCCAGAG TCTATTTAAAAAGGAAAAGAATTCTTTTGAAATTTCCCAGTCATCATAGT CAATACTCTTACTTACTGTGTCCGCATCTCCATTTAATTTTCTAGCGATC CACGTAATTTTTAGAAAAATTCCTTTTGCCTTACACAAGTTATAAATTGT ATTTGCTAAAAATTGTAGTTTTTCCTTATTACTTCCAACTTTAACAATTC TTGCAGCGGCAATGTTGTCTGTGTGCCAGAGAACATTGTTCCCTTGTAGT TTTGAATTGAAAGCATGCAGCGTAAAAGCTATTGCTAATAATTCCCTGAA TGTTGAACTCTCGCCTTGTTCATGAGGCCATAAATTTCTGAAACTTATAT CATTATCCGAGATTGCTCCTATTCCTTTGTCNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCTTGGTGTTTC AGTTGTGATCGTTGATGCACTAGATTGCTTGAGCTTTTTCTCTCCAAATA ATAAGCTTGAAAATGTTTCCATTTTTCCCACATACAATATACAAGAGAGT TAGAACGACGTGTGATTAGTTTTAAAATGTCTACCATTTTTATTGCACGC GAGAACAAGAATTTCAAATTGTTAATTTACAGAACGATAGCAAAGGCTAT TATCTTTCGGATGCCGTAAATAAATTCACATATGTTAAGCTTTATTATGT TCTTTTCTTTTAGCACCGGAAATTTTGTCATTCGATCCTGTTTCCCTGAA TAGCGATTTATGGTAAATATTTCTCGTACCCCGAATTTCGAAGAGCAGAA ACATTTAAGACCTTCTTGATTGATTGATAAATTTATGCTGGTTCGACCCT TTCTAAACCTGATAAACCTGCTTATTGTCTGAAACTTCATCTAAATTTCA CACATTCACGTAAACTTTTCTTTCAAATTTTACGCATCTATCTAGGTAAA TAAGAAATCCCATTCGGGCAAATCTCAGATACCCCTTAGCAACGCCGAAT TAACAAATATCCAAATATTTTATCTTTTTAGGAGTGTTGGTGTTATTACG TACATTCTGTAAGTATTTTAATAAGCTTTCGTGTTTTAGTTAAAATTATT CAGCGAAATCTAAAATCTTTTAACTGTTTAAGGAGAAGAGCTAAAACTTA CCAAAAGACTGCAATCTTTTACGACGCAAGATGTCACGATGAAAATATTT TTCCTGTTTTTTTAAGAAATTGAACAGTCGACTTATGACAGGCTAGCTCT AAAGCTCTAAAACAGTATCTAATAACATAAAAAGTTGTATTATTTTCGGC TCTATTCACATACTGAATTTCAAAGATATGTGACGTTTTTTGCAAACTTT TGCGAGACTTTAGCTTAAGTGCTTGCGTGCAACATTGGGTACAAAGTCCA AATATGCGTTTCCCGTAAATTTTATATGAAAAGTTATGGCTATTCTGTAT GGAGGCTAAACTATAAATGTTCTAAATTATCAACTCTCCTTTCCTCCTAC AACTCCGCATTGTCGAGTGCCTGATTCAATGACAACCACCTTCCCAGCAG ACACACAACGTTGTTTCAACGCTAATCTAACGTTCATAAAACGTTAGGTT AACTTTAGGAATAGCTTTATGTGCCATCTGGATTAGCTATCTTTACAACT CAATCGCTTGCTTTATCCCCTAGACGTTCGAGTTATGGACACTTGACTGT AATCATTTTTAACCAAATTATTTTTTTTCAGATTGTCGGATATTCACCGA CATAGATAGTGAGTTTATGTTTTTGAGACTGGACTGTAATCATTTTTAAA CAGAACATTTTTTCCTTTACTCTCTATTCAGATTGTCGGGTATTTCACCA TTCATTGGAGATGATGACAACGATACATTGATGAATGTTTCCTGTGGTGA ATACGAATATGATGACCAAGCGTTCGGTCAAATCACCAATGATGCGAAAT CCTTCATCGATAAACTGCTTGTCTCGAATCCTAAGTAAGTGCAGTCTCTT TCTTATTCGATGCTCTAGGGACCAAGAATTTTATTCGAATTAGAGAAAGT TTCAAATTACACACATTTTATACTATTTCCCACATATTTTTGTTCGAATT ATAGAAAATTGACAGCAATACAATGCCACTAAGGTTTTTTTATATCCTAC AGATTTCTATATTTGTAGAGAAAAGCTCGAAAATCATCCATCAAATTTCG CTTTCCTTTAAGTATTCAAGTCAATTTGAATGGCTTTAGTCTGTTGATAT TCTCTAAAGAGTTTATAATTCTTCGTGCTAATAACTGTGGTTTACAATAG GCTAACTAACGTTAAAAATTTGGTTATGCTTCTATTTTCAGGAAAAGGGG AAATGTTGGTCGCTGCTTGCAACATCCTTGGATAAATGTGAGTTTTCTGG CTAGTTATTACCGAACCAGACTTTAGTTTTTATAAAGAGGATCTAAGGCT CCCTATCCCTCTATCTATGATATGCACCTGTTGTGATGTCTTCCAAGGAC CCGACAGCTGATTGGTTGCAAGTGACTGATTTTACAAATCAGCTATTGGA TCCATGATGTAATGTCAGAAGACACTGCAATGGTACATTTCATGAATATA TTCCTATCATCCTTCAAAACGTGGGGAGATTCGGCTTCGAGTTTACCAGG AAGGATTTACGTCAAAATGCCTGAAGTCTTTGCATTGGTCCAAATAATTT TGACGTCATTTCCTTGTATTCATTACCAATTCCCTCAAAACCCAACCTGG TTGTTCATGTTCGGTAGCACAGATATTCGAGGCATGGACTTTTCAGCCTG TTAGAATCTTGCTGAGATTCACTTTTTTCAAAAATCTTTTATTTTTTCAG TCCAACTGGCAATCCAAACAAAGTAAAATCAACCTTGGCAACTTGAAGAC GTTCTTGAAGAAACACAAAGAAAAGGTACCTTTTTTAAACCTTTTGGCTA AACTTATCTGATTCCATTTATTGTGCCTAATTTGATCTCAGACTCCTGAC CAAGCATTGTAACACTTTCAGTGTTGTCGCCCTTATATAAATGTTTCATT CGCCTCTAAATAACATTTGAATTTCGTTTTCTCTAGGTTAACGTCAGTGC TAGAGGTGCCATCCGTCGGTTCAGTTCATTTGGAGTGGGCGGTCACGCCC ATGGTTTATTGGGTGGACGAGGTGGCTCTCCCGTCAGTGTCGGTAGCAGC CGATCGCCTTCAAAACATTTATTGGTACCGAACGCCCTTCAATCATGCGT GATAAATGAAGATGAAGAAGAAGAGGAAGAAGCAGATGAGAATCAAAACA TCCGGAATATCAATGATTCTTTACGGAGTGGCCCGATTTTTACTGTAACA AAGGAAGCGGAAAGGCCCCCTTCCGGTGATTATGGTGAAGCATTACCGGA TTTCAATACGGATACACCAGACGGGTTGAGAAATTATTTACAGCAAATGA TTAATACTGGGTTATTACCGGGCCGTTCTGGACCACCGGACATGTCTGAA CAGTTTAGTGATGAAGATCATTGAAGGAATAAGAGGTCGGATGATAAAGT AGATTTCCAGACAGCGCGAAACGTTCAAACAAGGTATATCAAACGTTCCT AACGTCTTTTAACGTTA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000130XLOC_000130Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000238-exon-sc0000001-1575043694:2092521..2092531TCONS_00000238-exon-sc0000001-1575043694:2092521..2092531Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1575043694:2089787..2091674TCONS_00000238-exon-sc0000001-1575043694:2089787..2091674Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1575043694:2088550..2088571TCONS_00000238-exon-sc0000001-1575043694:2088550..2088571Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1575043694:2088145..2088235TCONS_00000238-exon-sc0000001-1575043694:2088145..2088235Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1575043694:2087375..2087575TCONS_00000238-exon-sc0000001-1575043694:2087375..2087575Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1575043694:2086624..2086762TCONS_00000238-exon-sc0000001-1575043694:2086624..2086762Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1575043694:2085951..2086074TCONS_00000238-exon-sc0000001-1575043694:2085951..2086074Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1575043694:2082320..2082368TCONS_00000238-exon-sc0000001-1575043694:2082320..2082368Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1575043694:2082024..2082050TCONS_00000238-exon-sc0000001-1575043694:2082024..2082050Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1575043694:2081098..2081250TCONS_00000238-exon-sc0000001-1575043694:2081098..2081250Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1575043694:2080695..2080740TCONS_00000238-exon-sc0000001-1575043694:2080695..2080740Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1575043694:2080157..2080231TCONS_00000238-exon-sc0000001-1575043694:2080157..2080231Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1575043694:2079465..2079995TCONS_00000238-exon-sc0000001-1575043694:2079465..2079995Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2092521..2092531TCONS_00000238-exon-sc0000001-1510915933:2092521..2092531Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2089787..2091674TCONS_00000238-exon-sc0000001-1510915933:2089787..2091674Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2088550..2088571TCONS_00000238-exon-sc0000001-1510915933:2088550..2088571Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2088145..2088235TCONS_00000238-exon-sc0000001-1510915933:2088145..2088235Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2087375..2087575TCONS_00000238-exon-sc0000001-1510915933:2087375..2087575Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2086624..2086762TCONS_00000238-exon-sc0000001-1510915933:2086624..2086762Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2085951..2086074TCONS_00000238-exon-sc0000001-1510915933:2085951..2086074Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2082320..2082368TCONS_00000238-exon-sc0000001-1510915933:2082320..2082368Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2082024..2082050TCONS_00000238-exon-sc0000001-1510915933:2082024..2082050Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2081098..2081250TCONS_00000238-exon-sc0000001-1510915933:2081098..2081250Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2080695..2080740TCONS_00000238-exon-sc0000001-1510915933:2080695..2080740Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2080157..2080231TCONS_00000238-exon-sc0000001-1510915933:2080157..2080231Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1510915933:2079465..2079995TCONS_00000238-exon-sc0000001-1510915933:2079465..2079995Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2092521..2092531TCONS_00000238-exon-sc0000001-1491911889:2092521..2092531Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2089787..2091674TCONS_00000238-exon-sc0000001-1491911889:2089787..2091674Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2088550..2088571TCONS_00000238-exon-sc0000001-1491911889:2088550..2088571Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2088145..2088235TCONS_00000238-exon-sc0000001-1491911889:2088145..2088235Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2087375..2087575TCONS_00000238-exon-sc0000001-1491911889:2087375..2087575Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2086624..2086762TCONS_00000238-exon-sc0000001-1491911889:2086624..2086762Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2085951..2086074TCONS_00000238-exon-sc0000001-1491911889:2085951..2086074Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2082320..2082368TCONS_00000238-exon-sc0000001-1491911889:2082320..2082368Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2082024..2082050TCONS_00000238-exon-sc0000001-1491911889:2082024..2082050Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2081098..2081250TCONS_00000238-exon-sc0000001-1491911889:2081098..2081250Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2080695..2080740TCONS_00000238-exon-sc0000001-1491911889:2080695..2080740Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2080157..2080231TCONS_00000238-exon-sc0000001-1491911889:2080157..2080231Clytia hemisphaericaexon
TCONS_00000238-exon-sc0000001-1491911889:2079465..2079995TCONS_00000238-exon-sc0000001-1491911889:2079465..2079995Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2079465..2092531 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.301839 0 0.472371 0 2.4643e-10 0.00135832 8.41011e-08 1.15562 2.36266 3.08461 1.25771 0.652033 0.431034 0.484011 8.10543e-09 6.94052e-09 9.07228e-09 0.279175 0.92351 0.853555 0 0 0 0 0.609753 0.0150271 0 0 0 1.09239e-07
Blast
BLAST of TCONS_00000238 vs. Swiss-Prot (Human)
Match: MYLK (Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4)

HSP 1 Score: 268.085 bits (684), Expect = 2.593e-73
Identity = 127/302 (42.05%), Postives = 209/302 (69.21%), Query Frame = 1
Query: 1975 VSKAFEQSEEISRGKFGKVYKMVARATGDTYAAKYIKV-TPKLREDVLNTIDIMKKIHHVRLMNLFDVYDLGSQIVMILEYVGGGMLFERIVEKN-SLTEAECALYIKQVLQGXXXXXXQNIAHLELKPENIICVNRSNMDIKIIDFGLAKQLSHDKPIKITAGSPEFVAPEILSFDPVSLNSDLWSVGVITYILLSGISPFIGDDDNDTLMNVSCGEYEYDDQAFGQITNDAKSFIDKLLVSNPKKRGNVGRCLQHPWINSNWQSKQS-KINLGNLKTFLKKHKEKVNVSARGAIRRFSSF 2871
            VS  ++  E +  GKFG+V+++V + T   +A K+ K  + K +E++   I IM  +HH +L+   D ++  + IVM+LE V GG LFERI++++  LTE EC  Y++Q+ +G+ ++H Q I HL+LKPENI+CVN++   IK+IDFGLA++L +   +K+  G+PEFVAPE+++++P+   +D+WS+GVI YIL+SG+SPF+GD+DN+TL NV+   +++DD+AF +I++DAK FI  LL  + K R +  +CLQHPW+  + ++ ++ K++   +K ++ + K +   +A  AI R SS 
Sbjct: 1460 VSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM 1761          
The following BLAST results are available for this feature:
BLAST of TCONS_00000238 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MYLK2.593e-7342.05Myosin light chain kinase, smooth muscle OS=Homo s... [more]
back to top