Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000182 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000182
Unique NameTCONS_00000182
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2900

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000182 ID=TCONS_00000182|Name=TCONS_00000182|organism=Clytia hemisphaerica|type=transcript|length=2900bp
GAAGCCTCAGTACAAAGTTTAGCTCGACCCAGTCCCCGGCGAACACGATG
TGTTGATTCAGCAAAACTGTGTCCATCTCTTTCCATTCAGTTGCAGTTCA
GCTAACCTTGTGTTAAGTAGTTGTTTTTGGGTATCGTCGTGTCGACGCCT
AAGCCTACTTTATTTAAATGTAttgttaaaaatttacaaaaaaaaattat
aaaattataaaaaaccataaaaaaatatatcatataTACACGTGAAGGAA
ACCATCCTGAGTACACAGAGATTGCATTGCACGAGATGAATCAACAAGGA
CAAGGTGCATCATCCGCAAACTACCCAATCGCTTCCCTGTACGTTGGTGA
CTTGAGTCCAGATGTTACAGAAGCCATGCTTTTCGAGAAGTTCAGTGCTA
CTGGTCCAGTGTTATCTATCCGAGTCTGTCGTGACTTGGTCACTAGACGG
TCCCTTGGCTATGCTTATGTCAACTATCAACAACCTGCTGATgCTGAGCG
AGCCATTGATACTTTGAACTATGACCCCATCAAAGGACGTCCGTGCCGTA
TCATGTGGTCTCAACGTGACCCAACTCTACGAAGATCTGGTGTTGGAAAC
ATTTTCATCAAGAACTTGGATAAGCATATCGATCACAAAGGTCTTTATGA
TACCTTCAGTGCTTTTGGAAACATTCTCTCATGTAAAATTGCTGCTGACG
ACAAAGGTCAATCCAAGGGCTATGGTTTTGTTCATTATGAAACTAAAGAA
GCTGCCCAAGAAGCTATCAGCAAAGTCAACGGCATGATGTTGAACGACAA
GAAAGTCTTTGTGGGAGAATTCATGTGTAAGAAAGAGCGTGTGGACCAGA
TTGGTGAccaacaaaagaaatttaagaacatcttttGCAAGAATTTTGGA
AATGAATTTACAAATGACAAACTTTTGGGATTGTTTCAAGAATTTGGAGA
AATCACCAGTTGTGTTGTTATGACTGACGAGTCTGGAACAAGCAGAGGCT
TTGGTTTTATTGCCTTTGAAAATCATGAAGATGCTGAAAAGGCTTGTGAT
GAGTTGAACAATAAGGAGATTGATGGAAACAAAATCACTTGTTGCCGTGC
TCAAAAAAAAGCTGAAAGATCCATGGAATTGAAAAGCAAATTTGAACAAC
AAAAGAACGAGAGAATTAGCAGATATCAAGGTGTTAACTTGTACATCAAG
AATCTGGAAGATGGCATCGACGATGAACGTCTTCGAACTGAATTCTCTCA
ATTTGGAACCATCACCAGCGCGAAAGTCATGAAAGACGACAAAGTAAATT
CCAAAGGATTTGGTTTCGTTTGTTTTTCGTCTCCTGATGAAGCAACAAAA
GCAGTCACAGAAATGAACGGACGCATCATTGTCACCAAACCCTTGTATGT
TGCATTGGCTCAACGTAAGGAAGAACGTCGTGCACAATTGTCTACTCAGT
TTATGCAGAGAGTTGGTCCTCTAAGATATCAACCTGGAGCCGGAATGCCT
CAGCAACAAGGTTATTCCTTCCAGCCAGGCCAACCAAGCTTCTATATCCC
AACGATGCCACAAGGTCAACGTGCTGCCTTCATTGCTCAACCAGTGAGCC
AAATGACCAGACCTCGATGGCAATCAGCAAACGTACGTCAAATGCAAGGT
GGATACCCCAACCCTGGAGGAAACGTTCGCGGATCACGACCAAGACACCC
CAACTCGGTCCAACCCCGACGTGAAACACCTTACAATCAGAAATTTCAAC
AAGGAGGCAATATGCCAAACCAAGTGATGCGTGCTGGTGGTCCAGTACCA
AACCAAAGAGCTCAATACAAATTGAACCAAAATACACGCAATCAATACCC
AGCTGGACCAGCACCTCCAGCTGTTGTCCCACAACAAGTTGCTGATCAAC
CAGCTCCAATGATGCCAGGAcaACAAGAGCCATTGACTGCTTCCACTTTG
GCTGGAGCCACTCCATCCGAGCAAAAGCAGATGATTGGTGAACGTCTTTT
CCCCTTGGTCCAAGAACATCAACCCAAGATGGCCGGCAAGATCACTGGAA
TGTTGTTGGAGATCGATAATGGTGAATTGTTGAACATGTTGGAAAGTCGT
GATTTGTTGAAAGATAAAGTGGGAGAAGCTGTGGCAGTACTTCAAGCTCA
TCAAGCTAAAGAGGCTCAAACCCAGGCTAAGACTGGTGAACAAGCCTAAT
TCCCTTCACACCCTAGCGTTGAGCATGCTTTGAATGGactaaaagaaagt
tttaatgGAAGATTATTTCGGAAAGTTGTgtatgttttgatgttttttga
agctttgttgttttgaaaaatttctctgGAGAACGTTTTTCTGCTATTCC
GGCGCTGAAGAaatttagtttaacttttattttttagtaAAGAAATacta
tatatggaaattttacAGTATATTGCATAACAGGATTGATTAGGACGGTA
TTTATCAGAggttttaaggatttttatcGTTAATGTGAAAGTTATATGAA
AGGGTTAACAATGGTTTATGTGTTGATGGATCTTAAAATTTCTCTGTGCC
TCTTTTAAAATCTAGTTTGCAATCAATATGTTCTTCTAATTTTCTATGta
cactttattttttcattaaaatacataaaataaaaacagacaaaaaacaa
aaaggtcATGTCGACTGTAAACTTTGCATGTTTGTATTTGGTATCGCTTG
TGAACAgtactgaatcaatcttccattTATTGTAATNTGTTTGTATTTGG
TATCGCTTGTGAACAgtactgaatcaatcttccattTTTTgtaacattgt
agtatggtaTTATGTCATGAAAGAAGAATATAGCAGCATGCTTACACTTA
ACCAAACAATGcgttttctatatttttactTGCCAACTTTATTTGCTATT
Run BLAST on NCBI

protein sequence of TCONS_00000182-protein

>TCONS_00000182-protein ID=TCONS_00000182-protein|Name=TCONS_00000182-protein|organism=Clytia hemisphaerica|type=polypeptide|length=637bp
MNQQGQGASSANYPIASLYVGDLSPDVTEAMLFEKFSATGPVLSIRVCRD
LVTRRSLGYAYVNYQQPADAERAIDTLNYDPIKGRPCRIMWSQRDPTLRR
SGVGNIFIKNLDKHIDHKGLYDTFSAFGNILSCKIAADDKGQSKGYGFVH
YETKEAAQEAISKVNGMMLNDKKVFVGEFMCKKERVDQIGDQQKKFKNIF
CKNFGNEFTNDKLLGLFQEFGEITSCVVMTDESGTSRGFGFIAFENHEDA
EKACDELNNKEIDGNKITCCRAQKKAERSMELKSKFEQQKNERISRYQGV
NLYIKNLEDGIDDERLRTEFSQFGTITSAKVMKDDKVNSKGFGFVCFSSP
DEATKAVTEMNGRIIVTKPLYVALAQRKEERRAQLSTQFMQRVGPLRYQP
GAGMPQQQGYSFQPGQPSFYIPTMPQGQRAAFIAQPVSQMTRPRWQSANV
RQMQGGYPNPGGNVRGSRPRHPNSVQPRRETPYNQKFQQGGNMPNQVMRA
GGPVPNQRAQYKLNQNTRNQYPAGPAPPAVVPQQVADQPAPMMPGQQEPL
TASTLAGATPSEQKQMIGERLFPLVQEHQPKMAGKITGMLLEIDNGELLN
MLESRDLLKDKVGEAVAVLQAHQAKEAQTQAKTGEQA
Run BLAST on NCBI

transcript from alignment at sc0000001:996620..1005049-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000182 ID=TCONS_00000182|Name=TCONS_00000182|organism=Clytia hemisphaerica|type=transcript|length=8430bp|location=Sequence derived from alignment at sc0000001:996620..1005049- (Clytia hemisphaerica)
GAAGCCTCAGTACAAAGTTTAGCTCGACCCAGTCCCCGGCGAACACGATG TGTTGATTCAGCAAAACTGTGTCCATCTCTTTCCATTCAGTTGCAGTTCA GCTAACCTTGTGTTAAGTAGTTGTTTTTGGGTATCGTCGTGTCGACGCCT AAGCCTACTTTATTTAAATGTATTGTTAAAAATTTACAAAAAAAAATTAT AAAATTATAAAAAACCATAAAAAAATATATCATATATACACGTGAAGGAA ACCATCCTGAGTACACAGAGATTGCATTGCACGAGGTTTGTTTACAACGA CTAGCAGTGTAACACATTTTACCAGGCGTGACAACAACATTCGCCTCTTT ATTATTATTCAAGAAGAATTTATAATCAAACTCGAAGTTTTATTTACTTG AGAACTTTACACATACAAGATGAATCAACAAGGACAAGGTGCATCATCCG CAAACTACCCAATCGCTTCCCTGTACGTTGGTGACTTGAGTCCAGATGTT ACAGAAGCCATGCTTTTCGAGAAGTTCAGTGCTACTGGTCCAGTGTTATC TATCCGAGTCTGTCGTGACTTGGTCACTAGACGGTCCCTTGGCTATGCTT ATGTCAACTATCAACAACCTGCTGATGGTAATATTTATTTTTGTTGTTTA AAAAGACATCTTCCATGGTTTTGCATGAATTAGATGAAAATAATGCAGGA ATTGATTAGCTATATGGTTAAAGAACGAAAAATGATGCATGCGTGTTACA ATGCAGGATTCTTTAGAGGATGATATAAATTCTGATGCAAAAGATTTGTT ATGAAATTGGAAGTAAAACAGATTTAGATTTCATAAAATGTTATGCTGTA GTCAGTTATACTTAATTTGAGGGTGCTGACTCAGAATTGGGCTATTCCAA AAAAAAATTGTATAGGGGTATTGATAAACTTTTTTTCACTAACCCCCCTG GAAATTTTGGATAACAAACTATCCCCTGGAAATTAGGAGTCGACACCCCT GGAAAGTTAAATATTGTGAAAAAGTGCCTGGAAAGTGGCTATTGATGCCA GTGTAGGAGGAGAGAACCCCCTGGAAACCTTTAATAACCCCCTTGGAAAA TCTGAAAATGACCAAAAGCCCCTTGGAAAATCGAGGCTCAGTCCCCCCTG GAAAAGTTCGTCAATACCCCTGTATGGTTTAAAAATAGAATAGCCCATTA GTGTTATCCAAGTTTAGGTTTAATTTTTTGTCTATCATGTGTTCTTTTCT TTTACATTGGGCTATTCAAAAATAAAATTGTACATGGGTATTAACAAACT TTTTACATTAACCCCTTGGAAATTGGGTCAACACCCCTGGAAATTAAAAT TTTATGAAAAAGGGGCTGGAAAATGACTAGTAATGATGTCAGTTTAGGAA GAGAAAACCCCTTGTAGAATTAAGGCTCAAACACCCCTGTACCGTAAGTT GGTCTAATATCAACATCCCCCGTTTAATTCCGACACGCTTCTTTACAGAC AGGAATAATATGAAAGCTTGAATCACTGGTTTAAAAAAGGATTATTCCTC TCTGACCACTAAGCAAAGAAAAACAGTTTAAACCATTCTATCAATTTCAG CTGATAAAAAGGGTGTCGGAATTAAGTTACGGTATGGTTTAAAAATGGAA TAGCCCATTCCAGGCTAAAATTTAAGGCCTAAAAAATTATGATTTTTGGT TTTTTTTGCCATTTGTAGATCAGAAGTTTTAGCCTTTGTTTAAAAACAAA GGAAATGGGGAATTTCCCTAAATTCTGCTTCTAATATACGCATAATTAAA GACCTTTTTCACCACAAACATTAACAACTTTTGATCTTAATGTCAGAAAT TTTCACTGGCAGTTCAAGTTCCTTTGCTTTTATTAAAACATTGGATAAGG ATAGTATTTGCTATTTTAAGCTCAAAAAAGAATTTAGTGAATTGAAGTAC TTTAAATATTGTTCATGCAGCCCTGTGAATCGAGGTCGGCATTCGGCAAT GCCGACTTGAAAGCCGACGTAACTTGAGCTGAAGTCGGCTTTTATTTGCT GACGTAATTTACACTCTAGGTCGGCGCGCCAACAAAAGAAATGTTTTGGT AATCTAATTGTGTTATCATTTGATAACACTTGTGCATGATAATCAAGCCT CATTCCATTCTCTTTATAAAACATAAAACTTAATAACACAATTATAGAGC AGCTGAATTTGTTAGTTCGTTAATTTTCTTCCTATTTTGTCTTTGCCGAC CTGAACAAGCTACTTAGGACGGCTTTGCCGACCTAAAATGACCTCTAGGT CAGCAAAATTTTGCCGGCCTACGGCTCGTTTTGGTCGGCATTTAAGTGCC GATATTATTTTGTCTGAATTCACAGGGCTGTTCATGGGAATTCAATTGCA AAAATATCTGACATTACACTTCACTTAGTAATTTCTTGTAGTACATCTTT TGCTCATTTTCAAGAGCTTTGTCATATGGTTGCAAAGTTCATTCTTGAGG CCATTGTACAGACTCATTTGGCTGTTTATCAATCCAAGTCTCTTGATTTA GTTTTTTGTTTTATTTAAAAGTAATGAAGTATGCTTTAAAGTCTGAAGTA ATCTTGCAAATTTCTGATGTTTGGGCGAGACAGCATAGCACTTTTTTTAT TTAGGTAAGAACTGCATAAAATTGTAAAAAAGCACAAAAGTTGCAATTTT TGGTCAATTTTAGACCAAAATGTGGCGAAAAGTGGAACTTGCGCATGAAA TATCTCGAGTTAGGTAATGAAATCGGCCATACCCGTTTAAAAGTCTTCTG TATAGTTTTTTGAGAGCTTTCGAATGGTTTACCTGATATTGTCTGAAAAT GAGTTTGAAATTTTCAAAACATTTCGCCCTTAGGGTTTTGCCTGGGGAAA AAAGAAATTGCCCAAAAAAGGGATGTTCCACCAGTGGGATTTTAGGGGAT TTTTTCCTGAGGCATAAGCATCCTATAGAGAAAGTCTGGAGAAAGTTTCA GCTATATATTATTTTTTTCCTGTAAATTTATGCTAAACGACCCCACTATT AGCTTGATCTGGAAATAGTATTTGTTTTAATAAAAAACAAGAGATTATTT TGAAAATTAAAAACTTGACTTTGGAAGTAGCGATTTTCTAGTTCCAGATT CTGGATTGAAACCTAAAGAGTGTTCAGTTAATGAAATTTTTAGAGTCATT GTACATGTCCATAATGTTTTTATTTCAATTTATTTCCAGCTGAGCGAGCC ATTGATACTTTGAACTATGACCCCATCAAAGGACGTCCGTGCCGTATCAT GTGGTCTCAACGTGACCCAACTCTACGAAGATCTGGTGTTGGAAACATTT TCATCAAGAACTTGGATAAGCATATCGATCACAAAGGTCTTTATGATACC TTCAGTGCTTTTGGAAACATTCTCTCATGTAAAATTGCTGCTGACGACAA AGGTCAATCCAAGGGCTATGGTTTTGTTCATTATGAAACTAAAGAAGCTG CCCAAGAAGCTATCAGCAAAGTCAACGGCATGATGTTGAACGACAAGAAA GTGTAAGTGAAACCTTTTCAGAAGCTTAACTTGGATTAGTGAGTAGCAAG CTATTTCAAACAATTGATGACTTGTTTGGCTGTGTTTGTCTCATATCAAA CATGATAATCTTGGAGTGTTCTTGGCTGACCCTTACTATAATGGTAGTAT GTGTATATATAGTATGTATGGGTTTTAATACGATAATCAGGCTCAGGATT CAATTAAGAACTTTTTTATTGTTTTAGCATAAAATAATGCAGTCAAAGCC AATAGAGTGCTCAATTGCAAGTAGAGTGATTTTGGTTTCCAAATGTCCTT ATTATTCAAAGATATTTTGAATATATGTTTTTACTATAAGTTTAAGTACT TCAGGTGTACAAACCTTCACAAGCAGAAACTTCCGCAAGATAGAAAAGCT GCAAAATGAATTATATACCCTTTCAAGAATTTTAAAAGACATTAACTTTT GCCAAAACGGCTAAAATCTGTCAAGATCAAGATTTTCTGCTCCCAAAAGT TTGTCACCTTAGCATATTTTTATTGGCCTGTTCAACTCAAATTAAACTGC TTGACTTACATTCTACTTTAACTTCCGTCTGATTGTTGGCATGGTTTTAT CTCTTATTTCACGGTTTCGCTCATCAACTATGATTTTGATTGTTTACTCA TTTCAGCTTTGTGGGAGAATTCATGTGTAAGAAAGAGCGTGTGGACCAGA TTGGTGACCAACAAAAGAAATTTAAGAACATCTTTTGCAAGAATTTTGGA AATGAATTTACAAATGACAAACTTTTGGGATTGTTTCAAGAATTTGGAGA AATCACCAGTTGTGTTGTTATGACTGATGAGTCTGGAACAAGCAGAGGCT TTGGTTTTATTGCCTTTGAAAATCATGAAGATGCTGAAAAGGTGAGTATC CATTAAGAGGTCAAGCTATATTCAATTTGAAAAGCTCTCCAATTTTTCTT GGTCCTTTTTCAAGTTTACAAACAAACACTAAATGGAACTGAATGTTCAT TAATTTTCTTTAATTTCCTCAGGGAAAATTTAATAAATTTCTCAAATACC ACCCTTTCGGTGTTTTAGTAGCAAGTTTTTTTGGTATACCACCACATCAC TAACAACACGATAGTTTGAGTCACNTCTCATATCAAACATGATAATCTTG GAGTGTTCTTGGCTGACCCTTACTATAATGGTAGTATGTGTATATATAGT ATGTATGGGTTTTAATAAGATAATGAATCAGGCTCAGGATTCAATTAAGA ACTTTTTTATTGTTTTAGCATAAAATAATGCAGTCAAAGCCAATAGAGTG CTCAATTGCAAGTAGAGTGATTTTGGTTTCCAAATGTCCTTATTATTCAA AGATATTTTGAATATATGTTTTTACTATAAGTTTAAGTACTTCAGGTGTA CAAACCTTCACAAGCAGAAACTTCCGCAAGATAGAAAAGCTGCAAAATGA ATTATATACCCTTTCAAGAATTTTAAAAGACATTAACTTTTGCCAAAACG GCTAAAATCTGTCAAGATCAAGATTTTCTGCTCCCAAAAGTTTGTCACCT TAGCATATTTTTATTGGCCTGTTCAACTCAAATTAAACTGCTTGACTTAC ATTCTACTTTAACTTCCGTCTGATTGTTGGCGTGGTTTTATCTCTTATTT CACGGTTTCGCTCATCAACTATGATTTTGATTGTTTACTCATTTCAGCTT TGTGGGAGAATTCATGTGTAAGAAAGAGCGTGTGGACCAGATTGGTGACC AACAAAAGAAATTTAAGAACATCTTTTGCAAGAATTTTGGAAATGAATTT ACAAATGACAAACTTTTGGGATTGTTTCAAGAATTTGGAGAAATCACCAG TTGTGTTGTTATGACTGACGAGTCTGGAACAAGCAGAGGCTTTGGTTTTA TTGCCTTTGAAAATCATGAAGATGCTGAAAAGGTGAGTATCCATTAAGAG GTAAAGCTATATTCAATTTGAAAAGCTCTCCAATTTTTCTTGGTCCTTTT TCAAGTTTACAAACAAACACTCAATGGAACTGAATGTTCATTAATTTTCT TTAATTTCCTCAGGGAAAATTTAATAAATTTCTCAAATACCACCCTTTCG GTGTTTTAGTAGCAAGTTTTTTTGGTATACCACCACATCACTAACAACAC GATAGTTTGAGTCACATTTTAGTACTGTCCACCCCTGTTGAAAATAGGAT GAAAATGAATAAACTGATTCTTTTTTCTCTAGGCTTGTGATGAGTTGAAC AATAAGGAGATTGATGGAAACAAAATCACTTGTTGCCGTGCTCAAAAAAA AGCTGAAAGATCCATGGAATTGAAAAGCAAATTTGAACAACAAAAGAACG AGAGAATTAGCAGATATCAAGGTATCCAAGCTGAAATCTTTCGAGTGTTG TATCAAGCAGTGTTGAAATCTAGTTTTAAAGACAACCTTTTAATTGTTAT TTAATGAATTCCGCTTCGTAGGCATTTCTGCCTCTTCGAAAAGATCTTCT ATAAAGTTGCTTAGAAAAAATTCGTTGTGTTAACTTCAAAGTTCTCTTCT ATCCCGTTTGGCTTCTGGAATCTTTGCATTCTTTCTCTAAGTTAGCCCTT AGATTTGATTTTTTTAAGAATGATTAATTTGTAAAACCGTGAAAGGGTAG TACTGAGATTTTGACAACAATTCATCTTCATCTGTTAATTTTCTTTCTAG GTGTTAACTTGTACATCAAGAATCTGGAAGATGGCATCGACGATGAACGT CTTCGAACTGAATTCTCTCAATTTGGAACCATCACCAGCGCGAAAGTCAT GAAAGACGACAAAGTAAATTCCAAAGGATTTGGTTTCGTTTGTTTTTCGT CTCCTGATGAAGCAACAAAAGCAGTCACAGAAATGAACGGACGCATCATT GTCACCAAACCCTTGTATGTTGCATTGGCTCAACGTAAGGAAGAACGTCG TGCACAATTGTCTACTCAGTTTATGCAGAGAGTTGGTCCTCTAAGATATC AACCTGGAGCCGTAAGTTGACTCTTTTCTCCTTTGGAAACTTTCTGCTTG AAACTGAATTGAATATTAATATCCACGAAACTCTTTATACATTATTTGAT GTTATATATCAAAACTCATTTAGCATAGAAACAAAACTTAAAAAAAAAAA TTTATGTAAAGTTCGCTTGTTTTTGCGTGTACTTTCAAGAATTTAAAATT TAAAATTTCGAGATACAATTAGGGTGCTACAAAGTTTTACGGGATGGTTT TACTAAGCCTCGTTAACGGCTTATCTCTTAAAACTTATTTTGCCATTATT TTTCAGGGAATGCCTCAGCAACAAGGTTATTCCTTCCAGCCAGGCCAACC AAGCTTCTATATCCCAACGATGCCACAAGGTCAACGTGCTGCCTTCATTG CTCAACCAGTGAGCCAAATGACCAGACCTCGATGGCAATCAGCAAACGTA CGTCAAATGCAAGGTGGATACCCCAACCCTGGAGGAAACGTTCGCGGATC ACGACCAAGACACCCCAACTCGGTCCAACCCCGACGTGAAACACCTTACA ATCAGAAATTTCAACAAGGAGGCAATATGCCAAACCAAGTGATGCGTGCT GGTGGTCCAGTACCAAACCAAAGAGCTCAATACAAATTGAACCAAAATAC ACGCAATCAATACCCAGCTGGACCAGCACCTCCAGCTGTTGTCCCACAAC AAGTTGCTGATCAACCAGCTCCAATGATGCCAGGAGTAAGCTAATATTGT TATTGTAGTTATCTGTTAGTGTTAAATTAGGAAGTGTAAGAACTATTGCG AATCTGACGTTTAGTCTAACCTAATGCGTTGTGCTACTTTGGAAAAATTT CCCTCGTAATTAAACTGCTAGTAACGTTGTGTTTTTGTTTTGTTTTTCAG CAACAAGAGCCATTGACTGCTTCCACTTTGGCTGGAGCCACTCCATCCGA GCAAAAGCAGATGATTGGTGAACGTCTTTTCCCCTTGGTCCAAGAACATC AACCCAAGATGGCCGGCAAGATCACTGGAATGTTGTTGGAGATCGATAAT GGTGAATTGTTGAACATGTTGGAAAGTCGTGATTTGTTGAAAGATAAAGT GGGAGAAGCTGTGGCAGTACTTCAAGCTCATCAAGCTAAAGAGGCTCAAA CCCAGGCTAAGACTGGTGAACAAGCCTAATTCCCTTCACACCCTAGCGTT GAGCATGCTTTGAATGGACTAAAAGAAAGTTTTAATGGAAGATTATTTCG GAAAGTTGTGTATGTTTTGATGTTTTTTGAAGCTTTGTTGTTTTGAAAAA TTTCTCTGGAGAACGTTTTTCTGCTATTCCGGCGCTGAAGAAATTTAGTT TAACTTTTATTTTTTAGTAAAGAAATACTATATATGGAAATTTTACAGTA TATTGCATAACAGGATTGATTAGGACGGTATTTATCAGAGGTTTTAAGGA TTTTTATCGTTAATGTGAAAGTTATATGAAAGGGTTAACAATGGTTTATG TGTTGATGGATCTTAAAATTTCTCTGTGCCTCTTTTAAAATCTAGTTTGC AATCAATATGTTCTTCTAATTTTCTATGTACACTTTATTTTTTCATTAAA ATACATAAAATAAAAACAGACAAAAAACAAAAAGGTCATGTCGACTGTAA ACTTTGCATGTTTGTATTTGGTATCGCTTGTGAACAGTACTGAATCAATC TTCCATTTATTGTAATNTGTTTGTATTTGGTATCGCTTGTGAACAGTACT GAATCAATCTTCCATTTTTTGTAACATTGTAGTATGGTATTATGTCATGA AAGAAGAATATAGCAGCATGCTTACACTTAACCAAACAATGCGTTTTCTA TATTTTTACTTGCCAACTTTATTTGCTATT

Coding sequence (CDS) from alignment at sc0000001:996620..1005049-

>TCONS_00000182 ID=TCONS_00000182|Name=TCONS_00000182|organism=Clytia hemisphaerica|type=CDS|length=15312bp|location=Sequence derived from alignment at sc0000001:996620..1005049- (Clytia hemisphaerica)
CAACAAGAGCCATTGACTGCTTCCACTTTGGCTGGAGCCACTCCATCCGA
GCAAAAGCAGATGATTGGTGAACGTCTTTTCCCCTTGGTCCAAGAACATC
AACCCAAGATGGCCGGCAAGATCACTGGAATGTTGTTGGAGATCGATAAT
GGTGAATTGTTGAACATGTTGGAAAGTCGTGATTTGTTGAAAGATAAAGT
GGGAGAAGCTGTGGCAGTACTTCAAGCTCATCAAGCTAAAGAGGCTCAAA
CCCAGGCTAAGACTGGTGAACAAGCCTAAGGAATGCCTCAGCAACAAGGT
TATTCCTTCCAGCCAGGCCAACCAAGCTTCTATATCCCAACGATGCCACA
AGGTCAACGTGCTGCCTTCATTGCTCAACCAGTGAGCCAAATGACCAGAC
CTCGATGGCAATCAGCAAACGTACGTCAAATGCAAGGTGGATACCCCAAC
CCTGGAGGAAACGTTCGCGGATCACGACCAAGACACCCCAACTCGGTCCA
ACCCCGACGTGAAACACCTTACAATCAGAAATTTCAACAAGGAGGCAATA
TGCCAAACCAAGTGATGCGTGCTGGTGGTCCAGTACCAAACCAAAGAGCT
CAATACAAATTGAACCAAAATACACGCAATCAATACCCAGCTGGACCAGC
ACCTCCAGCTGTTGTCCCACAACAAGTTGCTGATCAACCAGCTCCAATGA
TGCCAGGAGTGTTAACTTGTACATCAAGAATCTGGAAGATGGCATCGACG
ATGAACGTCTTCGAACTGAATTCTCTCAATTTGGAACCATCACCAGCGCG
AAAGTCATGAAAGACGACAAAGTAAATTCCAAAGGATTTGGTTTCGTTTG
TTTTTCGTCTCCTGATGAAGCAACAAAAGCAGTCACAGAAATGAACGGAC
GCATCATTGTCACCAAACCCTTGTATGTTGCATTGGCTCAACGTAAGGAA
GAACGTCGTGCACAATTGTCTACTCAGTTTATGCAGAGAGTTGGTCCTCT
AAGATATCAACCTGGAGCCGCTTGTGATGAGTTGAACAATAAGGAGATTG
ATGGAAACAAAATCACTTGTTGCCGTGCTCAAAAAAAAGCTGAAAGATCC
ATGGAATTGAAAAGCAAATTTGAACAACAAAAGAACGAGAGAATTAGCAG
ATATCAAGGTGTAAGAAAGAGCGTGTGGACCAGATTGGTGACCAACAAAA
GAAATTTAAGAACATCTTTTGCAAGAATTTTGGAAATGAATTTACAAATG
ACAAACTTTTGGGATTGTTTCAAGAATTTGGAGAAATCACCAGTTGTGTT
GTTATGACTGACGAGTCTGGAACAAGCAGAGGCTTTGGTTTTATTGCCTT
TGAAAATCATGAAGATGCTGAAAAGCTTTGTGGGAGAATTCATCTGAGCG
AGCCATTGATACTTTGAACTATGACCCCATCAAAGGACGTCCGTGCCGTA
TCATGTGGTCTCAACGTGACCCAACTCTACGAAGATCTGGTGTTGGAAAC
ATTTTCATCAAGAACTTGGATAAGCATATCGATCACAAAGGTCTTTATGA
TACCTTCAGTGCTTTTGGAAACATTCTCTCATGTAAAATTGCTGCTGACG
ACAAAGGTCAATCCAAGGGCTATGGTTTTGTTCATTATGAAACTAAAGAA
GCTGCCCAAGAAGCTATCAGCAAAGTCAACGGCATGATGTTGAACGACAA
GAAAGTATGAATCAACAAGGACAAGGTGCATCATCCGCAAACTACCCAAT
CGCTTCCCTGTACGTTGGTGACTTGAGTCCAGATGTTACAGAAGCCATGC
TTTTCGAGAAGTTCAGTGCTACTGGTCCAGTGTTATCTATCCGAGTCTGT
CGTGACTTGGTCACTAGACGGTCCCTTGGCTATGCTTATGTCAACTATCA
ACAACCTGCTGATGCAACAAGAGCCATTGACTGCTTCCACTTTGGCTGGA
GCCACTCCATCCGAGCAAAAGCAGATGATTGGTGAACGTCTTTTCCCCTT
GGTCCAAGAACATCAACCCAAGATGGCCGGCAAGATCACTGGAATGTTGT
TGGAGATCGATAATGGTGAATTGTTGAACATGTTGGAAAGTCGTGATTTG
TTGAAAGATAAAGTGGGAGAAGCTGTGGCAGTACTTCAAGCTCATCAAGC
TAAAGAGGCTCAAACCCAGGCTAAGACTGGTGAACAAGCCTAAGGAATGC
CTCAGCAACAAGGTTATTCCTTCCAGCCAGGCCAACCAAGCTTCTATATC
CCAACGATGCCACAAGGTCAACGTGCTGCCTTCATTGCTCAACCAGTGAG
CCAAATGACCAGACCTCGATGGCAATCAGCAAACGTACGTCAAATGCAAG
GTGGATACCCCAACCCTGGAGGAAACGTTCGCGGATCACGACCAAGACAC
CCCAACTCGGTCCAACCCCGACGTGAAACACCTTACAATCAGAAATTTCA
ACAAGGAGGCAATATGCCAAACCAAGTGATGCGTGCTGGTGGTCCAGTAC
CAAACCAAAGAGCTCAATACAAATTGAACCAAAATACACGCAATCAATAC
CCAGCTGGACCAGCACCTCCAGCTGTTGTCCCACAACAAGTTGCTGATCA
ACCAGCTCCAATGATGCCAGGAGTGTTAACTTGTACATCAAGAATCTGGA
AGATGGCATCGACGATGAACGTCTTCGAACTGAATTCTCTCAATTTGGAA
CCATCACCAGCGCGAAAGTCATGAAAGACGACAAAGTAAATTCCAAAGGA
TTTGGTTTCGTTTGTTTTTCGTCTCCTGATGAAGCAACAAAAGCAGTCAC
AGAAATGAACGGACGCATCATTGTCACCAAACCCTTGTATGTTGCATTGG
CTCAACGTAAGGAAGAACGTCGTGCACAATTGTCTACTCAGTTTATGCAG
AGAGTTGGTCCTCTAAGATATCAACCTGGAGCCGCTTGTGATGAGTTGAA
CAATAAGGAGATTGATGGAAACAAAATCACTTGTTGCCGTGCTCAAAAAA
AAGCTGAAAGATCCATGGAATTGAAAAGCAAATTTGAACAACAAAAGAAC
GAGAGAATTAGCAGATATCAAGGTGTAAGAAAGAGCGTGTGGACCAGATT
GGTGACCAACAAAAGAAATTTAAGAACATCTTTTGCAAGAATTTTGGAAA
TGAATTTACAAATGACAAACTTTTGGGATTGTTTCAAGAATTTGGAGAAA
TCACCAGTTGTGTTGTTATGACTGACGAGTCTGGAACAAGCAGAGGCTTT
GGTTTTATTGCCTTTGAAAATCATGAAGATGCTGAAAAGCTTTGTGGGAG
AATTCATCTGAGCGAGCCATTGATACTTTGAACTATGACCCCATCAAAGG
ACGTCCGTGCCGTATCATGTGGTCTCAACGTGACCCAACTCTACGAAGAT
CTGGTGTTGGAAACATTTTCATCAAGAACTTGGATAAGCATATCGATCAC
AAAGGTCTTTATGATACCTTCAGTGCTTTTGGAAACATTCTCTCATGTAA
AATTGCTGCTGACGACAAAGGTCAATCCAAGGGCTATGGTTTTGTTCATT
ATGAAACTAAAGAAGCTGCCCAAGAAGCTATCAGCAAAGTCAACGGCATG
ATGTTGAACGACAAGAAAGTATGAATCAACAAGGACAAGGTGCATCATCC
GCAAACTACCCAATCGCTTCCCTGTACGTTGGTGACTTGAGTCCAGATGT
TACAGAAGCCATGCTTTTCGAGAAGTTCAGTGCTACTGGTCCAGTGTTAT
CTATCCGAGTCTGTCGTGACTTGGTCACTAGACGGTCCCTTGGCTATGCT
TATGTCAACTATCAACAACCTGCTGATGCAACAAGAGCCATTGACTGCTT
CCACTTTGGCTGGAGCCACTCCATCCGAGCAAAAGCAGATGATTGGTGAA
CGTCTTTTCCCCTTGGTCCAAGAACATCAACCCAAGATGGCCGGCAAGAT
CACTGGAATGTTGTTGGAGATCGATAATGGTGAATTGTTGAACATGTTGG
AAAGTCGTGATTTGTTGAAAGATAAAGTGGGAGAAGCTGTGGCAGTACTT
CAAGCTCATCAAGCTAAAGAGGCTCAAACCCAGGCTAAGACTGGTGAACA
AGCCTAAGGAATGCCTCAGCAACAAGGTTATTCCTTCCAGCCAGGCCAAC
CAAGCTTCTATATCCCAACGATGCCACAAGGTCAACGTGCTGCCTTCATT
GCTCAACCAGTGAGCCAAATGACCAGACCTCGATGGCAATCAGCAAACGT
ACGTCAAATGCAAGGTGGATACCCCAACCCTGGAGGAAACGTTCGCGGAT
CACGACCAAGACACCCCAACTCGGTCCAACCCCGACGTGAAACACCTTAC
AATCAGAAATTTCAACAAGGAGGCAATATGCCAAACCAAGTGATGCGTGC
TGGTGGTCCAGTACCAAACCAAAGAGCTCAATACAAATTGAACCAAAATA
CACGCAATCAATACCCAGCTGGACCAGCACCTCCAGCTGTTGTCCCACAA
CAAGTTGCTGATCAACCAGCTCCAATGATGCCAGGAGTGTTAACTTGTAC
ATCAAGAATCTGGAAGATGGCATCGACGATGAACGTCTTCGAACTGAATT
CTCTCAATTTGGAACCATCACCAGCGCGAAAGTCATGAAAGACGACAAAG
TAAATTCCAAAGGATTTGGTTTCGTTTGTTTTTCGTCTCCTGATGAAGCA
ACAAAAGCAGTCACAGAAATGAACGGACGCATCATTGTCACCAAACCCTT
GTATGTTGCATTGGCTCAACGTAAGGAAGAACGTCGTGCACAATTGTCTA
CTCAGTTTATGCAGAGAGTTGGTCCTCTAAGATATCAACCTGGAGCCGCT
TGTGATGAGTTGAACAATAAGGAGATTGATGGAAACAAAATCACTTGTTG
CCGTGCTCAAAAAAAAGCTGAAAGATCCATGGAATTGAAAAGCAAATTTG
AACAACAAAAGAACGAGAGAATTAGCAGATATCAAGGTGTAAGAAAGAGC
GTGTGGACCAGATTGGTGACCAACAAAAGAAATTTAAGAACATCTTTTGC
AAGAATTTTGGAAATGAATTTACAAATGACAAACTTTTGGGATTGTTTCA
AGAATTTGGAGAAATCACCAGTTGTGTTGTTATGACTGACGAGTCTGGAA
CAAGCAGAGGCTTTGGTTTTATTGCCTTTGAAAATCATGAAGATGCTGAA
AAGCTTTGTGGGAGAATTCATCTGAGCGAGCCATTGATACTTTGAACTAT
GACCCCATCAAAGGACGTCCGTGCCGTATCATGTGGTCTCAACGTGACCC
AACTCTACGAAGATCTGGTGTTGGAAACATTTTCATCAAGAACTTGGATA
AGCATATCGATCACAAAGGTCTTTATGATACCTTCAGTGCTTTTGGAAAC
ATTCTCTCATGTAAAATTGCTGCTGACGACAAAGGTCAATCCAAGGGCTA
TGGTTTTGTTCATTATGAAACTAAAGAAGCTGCCCAAGAAGCTATCAGCA
AAGTCAACGGCATGATGTTGAACGACAAGAAAGTATGAATCAACAAGGAC
AAGGTGCATCATCCGCAAACTACCCAATCGCTTCCCTGTACGTTGGTGAC
TTGAGTCCAGATGTTACAGAAGCCATGCTTTTCGAGAAGTTCAGTGCTAC
TGGTCCAGTGTTATCTATCCGAGTCTGTCGTGACTTGGTCACTAGACGGT
CCCTTGGCTATGCTTATGTCAACTATCAACAACCTGCTGATGCAACAAGA
GCCATTGACTGCTTCCACTTTGGCTGGAGCCACTCCATCCGAGCAAAAGC
AGATGATTGGTGAACGTCTTTTCCCCTTGGTCCAAGAACATCAACCCAAG
ATGGCCGGCAAGATCACTGGAATGTTGTTGGAGATCGATAATGGTGAATT
GTTGAACATGTTGGAAAGTCGTGATTTGTTGAAAGATAAAGTGGGAGAAG
CTGTGGCAGTACTTCAAGCTCATCAAGCTAAAGAGGCTCAAACCCAGGCT
AAGACTGGTGAACAAGCCTAAGGAATGCCTCAGCAACAAGGTTATTCCTT
CCAGCCAGGCCAACCAAGCTTCTATATCCCAACGATGCCACAAGGTCAAC
GTGCTGCCTTCATTGCTCAACCAGTGAGCCAAATGACCAGACCTCGATGG
CAATCAGCAAACGTACGTCAAATGCAAGGTGGATACCCCAACCCTGGAGG
AAACGTTCGCGGATCACGACCAAGACACCCCAACTCGGTCCAACCCCGAC
GTGAAACACCTTACAATCAGAAATTTCAACAAGGAGGCAATATGCCAAAC
CAAGTGATGCGTGCTGGTGGTCCAGTACCAAACCAAAGAGCTCAATACAA
ATTGAACCAAAATACACGCAATCAATACCCAGCTGGACCAGCACCTCCAG
CTGTTGTCCCACAACAAGTTGCTGATCAACCAGCTCCAATGATGCCAGGA
GTGTTAACTTGTACATCAAGAATCTGGAAGATGGCATCGACGATGAACGT
CTTCGAACTGAATTCTCTCAATTTGGAACCATCACCAGCGCGAAAGTCAT
GAAAGACGACAAAGTAAATTCCAAAGGATTTGGTTTCGTTTGTTTTTCGT
CTCCTGATGAAGCAACAAAAGCAGTCACAGAAATGAACGGACGCATCATT
GTCACCAAACCCTTGTATGTTGCATTGGCTCAACGTAAGGAAGAACGTCG
TGCACAATTGTCTACTCAGTTTATGCAGAGAGTTGGTCCTCTAAGATATC
AACCTGGAGCCGCTTGTGATGAGTTGAACAATAAGGAGATTGATGGAAAC
AAAATCACTTGTTGCCGTGCTCAAAAAAAAGCTGAAAGATCCATGGAATT
GAAAAGCAAATTTGAACAACAAAAGAACGAGAGAATTAGCAGATATCAAG
GTGTAAGAAAGAGCGTGTGGACCAGATTGGTGACCAACAAAAGAAATTTA
AGAACATCTTTTGCAAGAATTTTGGAAATGAATTTACAAATGACAAACTT
TTGGGATTGTTTCAAGAATTTGGAGAAATCACCAGTTGTGTTGTTATGAC
TGACGAGTCTGGAACAAGCAGAGGCTTTGGTTTTATTGCCTTTGAAAATC
ATGAAGATGCTGAAAAGCTTTGTGGGAGAATTCATCTGAGCGAGCCATTG
ATACTTTGAACTATGACCCCATCAAAGGACGTCCGTGCCGTATCATGTGG
TCTCAACGTGACCCAACTCTACGAAGATCTGGTGTTGGAAACATTTTCAT
CAAGAACTTGGATAAGCATATCGATCACAAAGGTCTTTATGATACCTTCA
GTGCTTTTGGAAACATTCTCTCATGTAAAATTGCTGCTGACGACAAAGGT
CAATCCAAGGGCTATGGTTTTGTTCATTATGAAACTAAAGAAGCTGCCCA
AGAAGCTATCAGCAAAGTCAACGGCATGATGTTGAACGACAAGAAAGTAT
GAATCAACAAGGACAAGGTGCATCATCCGCAAACTACCCAATCGCTTCCC
TGTACGTTGGTGACTTGAGTCCAGATGTTACAGAAGCCATGCTTTTCGAG
AAGTTCAGTGCTACTGGTCCAGTGTTATCTATCCGAGTCTGTCGTGACTT
GGTCACTAGACGGTCCCTTGGCTATGCTTATGTCAACTATCAACAACCTG
CTGATGCAACAAGAGCCATTGACTGCTTCCACTTTGGCTGGAGCCACTCC
ATCCGAGCAAAAGCAGATGATTGGTGAACGTCTTTTCCCCTTGGTCCAAG
AACATCAACCCAAGATGGCCGGCAAGATCACTGGAATGTTGTTGGAGATC
GATAATGGTGAATTGTTGAACATGTTGGAAAGTCGTGATTTGTTGAAAGA
TAAAGTGGGAGAAGCTGTGGCAGTACTTCAAGCTCATCAAGCTAAAGAGG
CTCAAACCCAGGCTAAGACTGGTGAACAAGCCTAAGGAATGCCTCAGCAA
CAAGGTTATTCCTTCCAGCCAGGCCAACCAAGCTTCTATATCCCAACGAT
GCCACAAGGTCAACGTGCTGCCTTCATTGCTCAACCAGTGAGCCAAATGA
CCAGACCTCGATGGCAATCAGCAAACGTACGTCAAATGCAAGGTGGATAC
CCCAACCCTGGAGGAAACGTTCGCGGATCACGACCAAGACACCCCAACTC
GGTCCAACCCCGACGTGAAACACCTTACAATCAGAAATTTCAACAAGGAG
GCAATATGCCAAACCAAGTGATGCGTGCTGGTGGTCCAGTACCAAACCAA
AGAGCTCAATACAAATTGAACCAAAATACACGCAATCAATACCCAGCTGG
ACCAGCACCTCCAGCTGTTGTCCCACAACAAGTTGCTGATCAACCAGCTC
CAATGATGCCAGGAGTGTTAACTTGTACATCAAGAATCTGGAAGATGGCA
TCGACGATGAACGTCTTCGAACTGAATTCTCTCAATTTGGAACCATCACC
AGCGCGAAAGTCATGAAAGACGACAAAGTAAATTCCAAAGGATTTGGTTT
CGTTTGTTTTTCGTCTCCTGATGAAGCAACAAAAGCAGTCACAGAAATGA
ACGGACGCATCATTGTCACCAAACCCTTGTATGTTGCATTGGCTCAACGT
AAGGAAGAACGTCGTGCACAATTGTCTACTCAGTTTATGCAGAGAGTTGG
TCCTCTAAGATATCAACCTGGAGCCGCTTGTGATGAGTTGAACAATAAGG
AGATTGATGGAAACAAAATCACTTGTTGCCGTGCTCAAAAAAAAGCTGAA
AGATCCATGGAATTGAAAAGCAAATTTGAACAACAAAAGAACGAGAGAAT
TAGCAGATATCAAGGTGTAAGAAAGAGCGTGTGGACCAGATTGGTGACCA
ACAAAAGAAATTTAAGAACATCTTTTGCAAGAATTTTGGAAATGAATTTA
CAAATGACAAACTTTTGGGATTGTTTCAAGAATTTGGAGAAATCACCAGT
TGTGTTGTTATGACTGACGAGTCTGGAACAAGCAGAGGCTTTGGTTTTAT
TGCCTTTGAAAATCATGAAGATGCTGAAAAGCTTTGTGGGAGAATTCATC
TGAGCGAGCCATTGATACTTTGAACTATGACCCCATCAAAGGACGTCCGT
GCCGTATCATGTGGTCTCAACGTGACCCAACTCTACGAAGATCTGGTGTT
GGAAACATTTTCATCAAGAACTTGGATAAGCATATCGATCACAAAGGTCT
TTATGATACCTTCAGTGCTTTTGGAAACATTCTCTCATGTAAAATTGCTG
CTGACGACAAAGGTCAATCCAAGGGCTATGGTTTTGTTCATTATGAAACT
AAAGAAGCTGCCCAAGAAGCTATCAGCAAAGTCAACGGCATGATGTTGAA
CGACAAGAAAGTATGAATCAACAAGGACAAGGTGCATCATCCGCAAACTA
CCCAATCGCTTCCCTGTACGTTGGTGACTTGAGTCCAGATGTTACAGAAG
CCATGCTTTTCGAGAAGTTCAGTGCTACTGGTCCAGTGTTATCTATCCGA
GTCTGTCGTGACTTGGTCACTAGACGGTCCCTTGGCTATGCTTATGTCAA
CTATCAACAACCTGCTGATGCAACAAGAGCCATTGACTGCTTCCACTTTG
GCTGGAGCCACTCCATCCGAGCAAAAGCAGATGATTGGTGAACGTCTTTT
CCCCTTGGTCCAAGAACATCAACCCAAGATGGCCGGCAAGATCACTGGAA
TGTTGTTGGAGATCGATAATGGTGAATTGTTGAACATGTTGGAAAGTCGT
GATTTGTTGAAAGATAAAGTGGGAGAAGCTGTGGCAGTACTTCAAGCTCA
TCAAGCTAAAGAGGCTCAAACCCAGGCTAAGACTGGTGAACAAGCCTAAG
GAATGCCTCAGCAACAAGGTTATTCCTTCCAGCCAGGCCAACCAAGCTTC
TATATCCCAACGATGCCACAAGGTCAACGTGCTGCCTTCATTGCTCAACC
AGTGAGCCAAATGACCAGACCTCGATGGCAATCAGCAAACGTACGTCAAA
TGCAAGGTGGATACCCCAACCCTGGAGGAAACGTTCGCGGATCACGACCA
AGACACCCCAACTCGGTCCAACCCCGACGTGAAACACCTTACAATCAGAA
ATTTCAACAAGGAGGCAATATGCCAAACCAAGTGATGCGTGCTGGTGGTC
CAGTACCAAACCAAAGAGCTCAATACAAATTGAACCAAAATACACGCAAT
CAATACCCAGCTGGACCAGCACCTCCAGCTGTTGTCCCACAACAAGTTGC
TGATCAACCAGCTCCAATGATGCCAGGAGTGTTAACTTGTACATCAAGAA
TCTGGAAGATGGCATCGACGATGAACGTCTTCGAACTGAATTCTCTCAAT
TTGGAACCATCACCAGCGCGAAAGTCATGAAAGACGACAAAGTAAATTCC
AAAGGATTTGGTTTCGTTTGTTTTTCGTCTCCTGATGAAGCAACAAAAGC
AGTCACAGAAATGAACGGACGCATCATTGTCACCAAACCCTTGTATGTTG
CATTGGCTCAACGTAAGGAAGAACGTCGTGCACAATTGTCTACTCAGTTT
ATGCAGAGAGTTGGTCCTCTAAGATATCAACCTGGAGCCGCTTGTGATGA
GTTGAACAATAAGGAGATTGATGGAAACAAAATCACTTGTTGCCGTGCTC
AAAAAAAAGCTGAAAGATCCATGGAATTGAAAAGCAAATTTGAACAACAA
AAGAACGAGAGAATTAGCAGATATCAAGGTGTAAGAAAGAGCGTGTGGAC
CAGATTGGTGACCAACAAAAGAAATTTAAGAACATCTTTTGCAAGAATTT
TGGAAATGAATTTACAAATGACAAACTTTTGGGATTGTTTCAAGAATTTG
GAGAAATCACCAGTTGTGTTGTTATGACTGACGAGTCTGGAACAAGCAGA
GGCTTTGGTTTTATTGCCTTTGAAAATCATGAAGATGCTGAAAAGCTTTG
TGGGAGAATTCATCTGAGCGAGCCATTGATACTTTGAACTATGACCCCAT
CAAAGGACGTCCGTGCCGTATCATGTGGTCTCAACGTGACCCAACTCTAC
GAAGATCTGGTGTTGGAAACATTTTCATCAAGAACTTGGATAAGCATATC
GATCACAAAGGTCTTTATGATACCTTCAGTGCTTTTGGAAACATTCTCTC
ATGTAAAATTGCTGCTGACGACAAAGGTCAATCCAAGGGCTATGGTTTTG
TTCATTATGAAACTAAAGAAGCTGCCCAAGAAGCTATCAGCAAAGTCAAC
GGCATGATGTTGAACGACAAGAAAGTATGAATCAACAAGGACAAGGTGCA
TCATCCGCAAACTACCCAATCGCTTCCCTGTACGTTGGTGACTTGAGTCC
AGATGTTACAGAAGCCATGCTTTTCGAGAAGTTCAGTGCTACTGGTCCAG
TGTTATCTATCCGAGTCTGTCGTGACTTGGTCACTAGACGGTCCCTTGGC
TATGCTTATGTCAACTATCAACAACCTGCTGATGCAACAAGAGCCATTGA
CTGCTTCCACTTTGGCTGGAGCCACTCCATCCGAGCAAAAGCAGATGATT
GGTGAACGTCTTTTCCCCTTGGTCCAAGAACATCAACCCAAGATGGCCGG
CAAGATCACTGGAATGTTGTTGGAGATCGATAATGGTGAATTGTTGAACA
TGTTGGAAAGTCGTGATTTGTTGAAAGATAAAGTGGGAGAAGCTGTGGCA
GTACTTCAAGCTCATCAAGCTAAAGAGGCTCAAACCCAGGCTAAGACTGG
TGAACAAGCCTAAGGAATGCCTCAGCAACAAGGTTATTCCTTCCAGCCAG
GCCAACCAAGCTTCTATATCCCAACGATGCCACAAGGTCAACGTGCTGCC
TTCATTGCTCAACCAGTGAGCCAAATGACCAGACCTCGATGGCAATCAGC
AAACGTACGTCAAATGCAAGGTGGATACCCCAACCCTGGAGGAAACGTTC
GCGGATCACGACCAAGACACCCCAACTCGGTCCAACCCCGACGTGAAACA
CCTTACAATCAGAAATTTCAACAAGGAGGCAATATGCCAAACCAAGTGAT
GCGTGCTGGTGGTCCAGTACCAAACCAAAGAGCTCAATACAAATTGAACC
AAAATACACGCAATCAATACCCAGCTGGACCAGCACCTCCAGCTGTTGTC
CCACAACAAGTTGCTGATCAACCAGCTCCAATGATGCCAGGAGTGTTAAC
TTGTACATCAAGAATCTGGAAGATGGCATCGACGATGAACGTCTTCGAAC
TGAATTCTCTCAATTTGGAACCATCACCAGCGCGAAAGTCATGAAAGACG
ACAAAGTAAATTCCAAAGGATTTGGTTTCGTTTGTTTTTCGTCTCCTGAT
GAAGCAACAAAAGCAGTCACAGAAATGAACGGACGCATCATTGTCACCAA
ACCCTTGTATGTTGCATTGGCTCAACGTAAGGAAGAACGTCGTGCACAAT
TGTCTACTCAGTTTATGCAGAGAGTTGGTCCTCTAAGATATCAACCTGGA
GCCGCTTGTGATGAGTTGAACAATAAGGAGATTGATGGAAACAAAATCAC
TTGTTGCCGTGCTCAAAAAAAAGCTGAAAGATCCATGGAATTGAAAAGCA
AATTTGAACAACAAAAGAACGAGAGAATTAGCAGATATCAAGGTGTAAGA
AAGAGCGTGTGGACCAGATTGGTGACCAACAAAAGAAATTTAAGAACATC
TTTTGCAAGAATTTTGGAAATGAATTTACAAATGACAAACTTTTGGGATT
GTTTCAAGAATTTGGAGAAATCACCAGTTGTGTTGTTATGACTGACGAGT
CTGGAACAAGCAGAGGCTTTGGTTTTATTGCCTTTGAAAATCATGAAGAT
GCTGAAAAGCTTTGTGGGAGAATTCATCTGAGCGAGCCATTGATACTTTG
AACTATGACCCCATCAAAGGACGTCCGTGCCGTATCATGTGGTCTCAACG
TGACCCAACTCTACGAAGATCTGGTGTTGGAAACATTTTCATCAAGAACT
TGGATAAGCATATCGATCACAAAGGTCTTTATGATACCTTCAGTGCTTTT
GGAAACATTCTCTCATGTAAAATTGCTGCTGACGACAAAGGTCAATCCAA
GGGCTATGGTTTTGTTCATTATGAAACTAAAGAAGCTGCCCAAGAAGCTA
TCAGCAAAGTCAACGGCATGATGTTGAACGACAAGAAAGTATGAATCAAC
AAGGACAAGGTGCATCATCCGCAAACTACCCAATCGCTTCCCTGTACGTT
GGTGACTTGAGTCCAGATGTTACAGAAGCCATGCTTTTCGAGAAGTTCAG
TGCTACTGGTCCAGTGTTATCTATCCGAGTCTGTCGTGACTTGGTCACTA
GACGGTCCCTTGGCTATGCTTATGTCAACTATCAACAACCTGCTGATGCA
ACAAGAGCCATTGACTGCTTCCACTTTGGCTGGAGCCACTCCATCCGAGC
AAAAGCAGATGATTGGTGAACGTCTTTTCCCCTTGGTCCAAGAACATCAA
CCCAAGATGGCCGGCAAGATCACTGGAATGTTGTTGGAGATCGATAATGG
TGAATTGTTGAACATGTTGGAAAGTCGTGATTTGTTGAAAGATAAAGTGG
GAGAAGCTGTGGCAGTACTTCAAGCTCATCAAGCTAAAGAGGCTCAAACC
CAGGCTAAGACTGGTGAACAAGCCTAAGGAATGCCTCAGCAACAAGGTTA
TTCCTTCCAGCCAGGCCAACCAAGCTTCTATATCCCAACGATGCCACAAG
GTCAACGTGCTGCCTTCATTGCTCAACCAGTGAGCCAAATGACCAGACCT
CGATGGCAATCAGCAAACGTACGTCAAATGCAAGGTGGATACCCCAACCC
TGGAGGAAACGTTCGCGGATCACGACCAAGACACCCCAACTCGGTCCAAC
CCCGACGTGAAACACCTTACAATCAGAAATTTCAACAAGGAGGCAATATG
CCAAACCAAGTGATGCGTGCTGGTGGTCCAGTACCAAACCAAAGAGCTCA
ATACAAATTGAACCAAAATACACGCAATCAATACCCAGCTGGACCAGCAC
CTCCAGCTGTTGTCCCACAACAAGTTGCTGATCAACCAGCTCCAATGATG
CCAGGAGTGTTAACTTGTACATCAAGAATCTGGAAGATGGCATCGACGAT
GAACGTCTTCGAACTGAATTCTCTCAATTTGGAACCATCACCAGCGCGAA
AGTCATGAAAGACGACAAAGTAAATTCCAAAGGATTTGGTTTCGTTTGTT
TTTCGTCTCCTGATGAAGCAACAAAAGCAGTCACAGAAATGAACGGACGC
ATCATTGTCACCAAACCCTTGTATGTTGCATTGGCTCAACGTAAGGAAGA
ACGTCGTGCACAATTGTCTACTCAGTTTATGCAGAGAGTTGGTCCTCTAA
GATATCAACCTGGAGCCGCTTGTGATGAGTTGAACAATAAGGAGATTGAT
GGAAACAAAATCACTTGTTGCCGTGCTCAAAAAAAAGCTGAAAGATCCAT
GGAATTGAAAAGCAAATTTGAACAACAAAAGAACGAGAGAATTAGCAGAT
ATCAAGGTGTAAGAAAGAGCGTGTGGACCAGATTGGTGACCAACAAAAGA
AATTTAAGAACATCTTTTGCAAGAATTTTGGAAATGAATTTACAAATGAC
AAACTTTTGGGATTGTTTCAAGAATTTGGAGAAATCACCAGTTGTGTTGT
TATGACTGACGAGTCTGGAACAAGCAGAGGCTTTGGTTTTATTGCCTTTG
AAAATCATGAAGATGCTGAAAAGCTTTGTGGGAGAATTCATCTGAGCGAG
CCATTGATACTTTGAACTATGACCCCATCAAAGGACGTCCGTGCCGTATC
ATGTGGTCTCAACGTGACCCAACTCTACGAAGATCTGGTGTTGGAAACAT
TTTCATCAAGAACTTGGATAAGCATATCGATCACAAAGGTCTTTATGATA
CCTTCAGTGCTTTTGGAAACATTCTCTCATGTAAAATTGCTGCTGACGAC
AAAGGTCAATCCAAGGGCTATGGTTTTGTTCATTATGAAACTAAAGAAGC
TGCCCAAGAAGCTATCAGCAAAGTCAACGGCATGATGTTGAACGACAAGA
AAGTATGAATCAACAAGGACAAGGTGCATCATCCGCAAACTACCCAATCG
CTTCCCTGTACGTTGGTGACTTGAGTCCAGATGTTACAGAAGCCATGCTT
TTCGAGAAGTTCAGTGCTACTGGTCCAGTGTTATCTATCCGAGTCTGTCG
TGACTTGGTCACTAGACGGTCCCTTGGCTATGCTTATGTCAACTATCAAC
AACCTGCTGATG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000108XLOC_000108Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000182-exon-sc0000001-1575043694:1004765..1005049TCONS_00000182-exon-sc0000001-1575043694:1004765..1005049Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1575043694:1004423..1004630TCONS_00000182-exon-sc0000001-1575043694:1004423..1004630Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1575043694:1001498..1001810TCONS_00000182-exon-sc0000001-1575043694:1001498..1001810Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1575043694:1000826..1000843TCONS_00000182-exon-sc0000001-1575043694:1000826..1000843Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1575043694:999568..999784TCONS_00000182-exon-sc0000001-1575043694:999568..999784Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1575043694:999129..999267TCONS_00000182-exon-sc0000001-1575043694:999129..999267Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1575043694:998489..998799TCONS_00000182-exon-sc0000001-1575043694:998489..998799Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1575043694:997765..998193TCONS_00000182-exon-sc0000001-1575043694:997765..998193Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1575043694:996620..997599TCONS_00000182-exon-sc0000001-1575043694:996620..997599Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1510915933:1004765..1005049TCONS_00000182-exon-sc0000001-1510915933:1004765..1005049Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1510915933:1004423..1004630TCONS_00000182-exon-sc0000001-1510915933:1004423..1004630Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1510915933:1001498..1001810TCONS_00000182-exon-sc0000001-1510915933:1001498..1001810Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1510915933:1000826..1000843TCONS_00000182-exon-sc0000001-1510915933:1000826..1000843Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1510915933:999568..999784TCONS_00000182-exon-sc0000001-1510915933:999568..999784Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1510915933:999129..999267TCONS_00000182-exon-sc0000001-1510915933:999129..999267Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1510915933:998489..998799TCONS_00000182-exon-sc0000001-1510915933:998489..998799Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1510915933:997765..998193TCONS_00000182-exon-sc0000001-1510915933:997765..998193Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1510915933:996620..997599TCONS_00000182-exon-sc0000001-1510915933:996620..997599Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1491911889:1004765..1005049TCONS_00000182-exon-sc0000001-1491911889:1004765..1005049Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1491911889:1004423..1004630TCONS_00000182-exon-sc0000001-1491911889:1004423..1004630Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1491911889:1001498..1001810TCONS_00000182-exon-sc0000001-1491911889:1001498..1001810Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1491911889:1000826..1000843TCONS_00000182-exon-sc0000001-1491911889:1000826..1000843Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1491911889:999568..999784TCONS_00000182-exon-sc0000001-1491911889:999568..999784Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1491911889:999129..999267TCONS_00000182-exon-sc0000001-1491911889:999129..999267Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1491911889:998489..998799TCONS_00000182-exon-sc0000001-1491911889:998489..998799Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1491911889:997765..998193TCONS_00000182-exon-sc0000001-1491911889:997765..998193Clytia hemisphaericaexon
TCONS_00000182-exon-sc0000001-1491911889:996620..997599TCONS_00000182-exon-sc0000001-1491911889:996620..997599Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000182-proteinTCONS_00000182-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:996620..1005049 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
771.216 776.49 230.398 174.951 608.158 510.784 662.382 686.16 1409.99 1369.6 1677.97 1760.2 1747.91 1561.54 1518.44 1668.29 1407.45 1653.79 1178 1396.35 1777.64 1883.96 1296.21 1368.56 1170.72 974.785 1283.19 1441.76 1080.77 1102.97
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000504RRM_dom
IPR002004PABP_HYD
IPR003954RRM_dom_euk
IPR006515PABP_1234
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0003723 RNA binding
Blast
BLAST of TCONS_00000182 vs. Swiss-Prot (Human)
Match: PABP1 (Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2)

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 384/646 (59.44%), Postives = 465/646 (71.98%), Query Frame = 1
Query:  310 SSANYPIASLYVGDLSPDVTEAMLFEKFSATGPVLSIRVCRDLVTRRSLGYAYVNYQQPADAERAIDTLNYDPIKGRPCRIMWSQRDPTLRRSGVGNIFIKNLDKHIDHKGLYDTFSAFGNILSCKIAADDKGQSKGYGFVHYETKEAAQEAISKVNGMMLNDKKVFVGEFMCKKERVDQIGDQQKKFKNIFCKNFGNEFTNDKLLGLFQEFGEITSCVVMTDESGTSRGFGFIAFENHEDAEKACDELNNKEIDGNKITCCRAQKKAERSMELKSKFEQQKNERISRYQGVNLYIKNLEDGIDDERLRTEFSQFGTITSAKVMKDDKVNSKGFGFVCFSSPDEATKAVTEMNGRIIVTKPLYVALAQRKEERRAQLSTQFMQRVGPLRYQPGAGMPQQQGYSFQPGQPS-FYIPTMPQGQ-RAAFIAQPVSQMTR----PRWQSANVRQMQGGYPNP----GGNVRGSRPRHP-NSVQP-RRETPYNQKFQQGGNMPNQVMRAGGPVPNQRA-----------QYKLNQNTRNQYXXXXXXXXXXXXXXXXXXXXMMPGQQEPLTASTLAGATPSEQKQMIGERLFPLVQEHQPKMAGKITGMLLEIDNGELLNMLESRDLLKDKVGEAVAVLQAHQAKEAQTQA 2178
            S+ +YP+ASLYVGDL PDVTEAML+EKFS  GP+LSIRVCRD++TRRSLGYAYVN+QQPADAERA+DT+N+D IKG+P RIMWSQRDP+LR+SGVGNIFIKNLDK ID+K LYDTFSAFGNILSCK+  D+ G SKGYGFVH+ET+EAA+ AI K+NGM+LND+KVFVG F  +KER  ++G + K+F N++ KNFG +  +++L  LF +FG   S  VMTDESG S+GFGF++FE HEDA+KA DE+N KE++G +I   RAQKK ER  ELK KFEQ K +RI+RYQGVNLY+KNL+DGIDDERLR EFS FGTITSAKVM +    SKGFGFVCFSSP+EATKAVTEMNGRI+ TKPLYVALAQRKEER+A L+ Q+MQR+  +R      +P      +QP  PS +++  +PQ Q RAA+   P SQ+ +    PRW +      QG  P+P     G +R + PR P ++++P   + P     Q+  N   Q M   GP P   A           QYK     RN      A P V  QQ A          QEPLTAS LA A P EQKQM+GERLFPL+Q   P +AGKITGMLLEIDN ELL+MLES + L+ KV EAVAVLQAHQAKEA  +A
Sbjct:    4 SAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGG-RSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR-----AVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYY--PPSQIAQLRPSPRWTA------QGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTM---GPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQG-----QEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKA 626          

HSP 2 Score: 168.318 bits (425), Expect = 1.938e-43
Identity = 100/298 (33.56%), Postives = 160/298 (53.69%), Query Frame = 1
Query:  568 DPTLRRSGVGNIFIKNLDKHIDHKGLYDTFSAFGNILSCKIAAD-DKGQSKGYGFVHYETKEAAQEAISKVNGMMLNDKKVFVGEFMCKKERVDQIGDQQKKFKNIFCKNFGNEFTNDKLLGLFQEFGEITSCVVMTDESGTSRGFGFIAFENHEDAEKACDELNNKEIDGNKITCCRAQKKAERSMELKSKFEQQKNERISRYQGVNLYIKNLEDGIDDERLRTEFSQFGTITSAKVMKDDKVNSKGFGFVCFSSPDEATKAVTEMNGRIIVTKPLYVALAQRKEERRAQLSTQFMQ 1458
            +P+     + ++++ +L   +    LY+ FS  G ILS ++  D    +S GY +V+++    A+ A+  +N  ++  K V +       +R   +  ++    NIF KN      N  L   F  FG I SC V+ DE+G S+G+GF+ FE  E AE+A +++N   ++  K+   R + + ER  EL ++ +          +  N+YIKN  + +DDERL+  F +FG   S KVM D+   SKGFGFV F   ++A KAV EMNG+ +  K +YV  AQ+K ER+ +L  +F Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRI----MWSQRDPSL--RKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAK----------EFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          
The following BLAST results are available for this feature:
BLAST of TCONS_00000182 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PABP11.938e-4359.44Polyadenylate-binding protein 1 OS=Homo sapiens GN... [more]
back to top