Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000181 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000181
Unique NameTCONS_00000181
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1900

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000181 ID=TCONS_00000181|Name=TCONS_00000181|organism=Clytia hemisphaerica|type=transcript|length=1900bp
TTTTAGATAAAATTTCTACTCTAGCAATACATAATTTGATAGATGATGTA
TCTTAAttaaatgcaataaaaaaagaaaacactatAATAATAGAACAAGC
AGGACACTGTAAAATAAATTACcaacaaacaaatcaaaatgtgGAAATCA
TTAGCTCTGGTGTTAGTTGTATTATGTATTTTGGAACAAGGACAATGTGA
AGTTTTCACTTCGATGGCTAACATGGAAAACTTGGCAGAAACCGAACAGT
TACTTTTCTCATCTTTCAAAACATACTTACAAGCTGAAGAAGATCGTTTG
aaggttttaaaaaattttatgttGAGAGTGGAGGATGCACAGAAGAATGT
AAACTTGTCAGATGTAGCAAAATATCTGGGAAACCCAATTAATACGTATT
TGATGCTTCGGAGATTGAGCTCTGAATGGAGAGATGTCGAATCGTTTTTA
TCACAAGATGGCGAGGCTGCTGAagATTTCAAGGCGATTTACGATAATGC
AAAAATGGTTCTACCAACAACGGAAGACCATGAAGGTGCCATGACTGCTT
TATTTCGATTGCAAGACACATACAAAGTCCCATCCAACATGCTTGCTAAA
GgTATTATTCCTGGAGTCAAAAGCTTGTCCCATCACCTTGAAATTCGTGA
GATATATGAAATTGGTCTACACGCTTACGACAACCAAAATTATCAGTATG
CTAGCGAATGGATGAGAACCGCATATGAAGAGTTTGGTTTAAACGCTACA
ATCGACGGAATCAAGAGAAATAAAGTGCTCGATTATCTTGCATACTCGGA
GTATAAGaaaggGAATCTTCCTGAAGCATTCAAACTAACCAAAGAACTAG
CGGCTTTAAAACCGAAAGACAAGCGTATCTTGGGAAATCTCGAACATTAC
CGGTATGAACTCCGGGCTTCACAATCGACCGGGAAGCGCGGTGATCCGGG
TACCCTGACTGATGAAGAACTCTACAAGAACGCGAAAGGGGGCAGTCAAA
CTGAAGCGCGTTCGCGGCGTGCATCACTTGGAGATTACGAGAAATTATGC
AGAGGAGAGGTCAGACAACAGaCAAAGAGAGAACTGAAGAAGATGAAATG
TTGGTACAAAACAAATGATCCAACTCTCATCCTGAAGCCACAAAAATTTG
AACGTATTTGGGCTGATCCTGAAATCTTCATGCTTCGAGATGTAATTACT
AATAGACAAATCGAGCAACTCAAAGAAGAGGCGTACCCTATTTTAAAACG
TGCCACGATTCAAGACCCCATCACAGGACAACTGAGACACGCCGATTATC
GAGTCAGTAAAAGTGCCTGGTTGTCACCGTCCCGCCACGAGTTCGTACGA
CAAATCGCTTTGAGAGCGCAATCCGCTACTAATTTGGATATTCGATCGTC
AGAACAACTTCAGATTGCGAATTACGGTATTGGTGGCCATTATGAACCTC
ACTTTGACCACGCACGTGAAGATGAAGATAAATTTACTGACCTGGGAATG
GGAAACCGAATTGCCACCGTACTTTATTATCTTTCTGACGTCGAGGCTGG
CGGAGCTACAGTTTTTACGGTTGGAAAAACCGCTGTCTTTCCAAGCAAGG
GAGATGCAGTATTTTGGTATAATTTGAAACGAAACGGAATTGGCAACCCA
AGAACTCGCCATGCTGCTTGTCCCGTACTCGTTGGTACCAAATGGGttTC
CAACTTTTGGATCCATGAATATAATCAGGAATTCAGAAGACCATGTGCGT
TGAAGAGCCATTTGTAAACAAGAAAGTTGTTCGGTAAAATATCACTTTGA
TTGTAACCTTTGGTAGGCTATTTAAAGTTagtttatttatattttcatcA
ACTTGCCCTctaaactacacgttttttataagaacaaactatataagaac
Run BLAST on NCBI

protein sequence of TCONS_00000181-protein

>TCONS_00000181-protein ID=TCONS_00000181-protein|Name=TCONS_00000181-protein|organism=Clytia hemisphaerica|type=polypeptide|length=542bp
MWKSLALVLVVLCILEQGQCEVFTSMANMENLAETEQLLFSSFKTYLQAE
EDRLKVLKNFMLRVEDAQKNVNLSDVAKYLGNPINTYLMLRRLSSEWRDV
ESFLSQDGEAAEDFKAIYDNAKMVLPTTEDHEGAMTALFRLQDTYKVPSN
MLAKGIIPGVKSLSHHLEIREIYEIGLHAYDNQNYQYASEWMRTAYEEFG
LNATIDGIKRNKVLDYLAYSEYKKGNLPEAFKLTKELAALKPKDKRILGN
LEHYRYELRASQSTGKRGDPGTLTDEELYKNAKGGSQTEARSRRASLGDY
EKLCRGEVRQQTKRELKKMKCWYKTNDPTLILKPQKFERIWADPEIFMLR
DVITNRQIEQLKEEAYPILKRATIQDPITGQLRHADYRVSKSAWLSPSRH
EFVRQIALRAQSATNLDIRSSEQLQIANYGIGGHYEPHFDHAREDEDKFT
DLGMGNRIATVLYYLSDVEAGGATVFTVGKTAVFPSKGDAVFWYNLKRNG
IGNPRTRHAACPVLVGTKWVSNFWIHEYNQEFRRPCALKSHL
Run BLAST on NCBI

transcript from alignment at sc0000001:976137..990982-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000181 ID=TCONS_00000181|Name=TCONS_00000181|organism=Clytia hemisphaerica|type=transcript|length=14846bp|location=Sequence derived from alignment at sc0000001:976137..990982- (Clytia hemisphaerica)
TTTTAGATAAAATTTCTACTCTAGCAATACATAATTTGATAGATGATGTA TCTTAATTAAATGCAATAAAAAAAGAAAACACTATAATAATAGAACAAGC AGGACACTGTAAAATAAATTACCAACAAACAAATCAAAATGTGGAAATCA TTAGCTCTGGTGTTAGTTGTATTATGTATTTTGGAACAAGGACAATGTGA AGTTTTCACTTCGATGGCTAACATGGAAAACTTGGCAGAAACCGAACAGT TACTTTTCTCATCTTTCAAAACATACTTACAAGCTGAAGAAGATCGTTTG AAGGTTTTAAAAAATTTTATGTTGAGAGTGGAGGATGCACAGAAGAATGT AAACTTGTCAGATGTAGCAAAATATCTGGGAAACCCAATTAATACGTATT TGATGCTTCGGAGATTGAGCTCTGAATGGAGAGATGTCGAATCGTTTTTA TCACAAGATGGCGAGGCTGCTGAAGGTTTTTGTTATTTTTGTTTTTATTT TTGAAGACCCTCATACACTTGTCAATGATAAATCAATATTCAAAAATTGT CAAATTCATAAGGGCCTTGAGTGATAAATTTTAAACCATGGTTATCTCTC AATGAGAACAACTAAAAAATCTGAGAGATAATGTCATAGTTTGAAACCAC CGGGTTTACTTAGGCTACTTAAGCAAATGTACCGTATGTGCTATCTAAAA CATTTGTATCATGTGTTGCTATGGAAACTCAGAAACCATTACCAAGGCTA ACCAAGGGTATACGAATTTTGCCTCTTCTGGTTAAAAGTCATCAAATTTG ACGTAACTGAAGTATTTACATTACAACCTCAATATGGAACTTTGGGTAGT TTATTCCATATTTTTTGCGTCATTCTTTATTTTTTTATGAGAAATGTCCC CACCGTCATGATTTCTTCTTTCATTAGATTTCAAGGCGATTTACGATAAT GCAAAAATGGTTCTACCAACAACGGAAGACCATGAAGGTGCCATGACTGC TTTATTTCGATTGCAAGACACATACAAAGTCCCATCCAACATGCTTGCTA AAGGTGAGTCCACACTCTTTACCTGAGGTGTTGAGAAGAATTGGTTTCGT GTAAAGAGGGTCTTAACGCGAATTGATTTTTATGCCTCGAAAGTCTCCCA ACTACGTGCTCATAAGAAAAGAAAATAGAATTTGGTATAAAGAAAAATCC TCAAAACTTATATAGTATAGGGTATAGTTTTATCTCATGACCAAAAAATG TGAGAAGTTATTACTTTAATGTTTCTGTTGATAGACTCAATGGTAATTAA CTAAAATATTTTTAGAATTGTTCTTTATTCCATATTACATTTCCCAGTAT TCGCTTACGCAACAATCAATAAAAAAAGCTATTTAAATCAGTCTGGTTAA GGATGAGGCAATATCACAGTGAACGAATTTTATTGTCAACAATTAAGTTC GTCTCAATATATCTGCAGCGAAGACAAAAAAAGGCTGTAACTTTGGTTAA GATTCGAATAAAATGGCGGTTTTGTGCTCATTGGAAAGATATTCGAGAGT GGAATGCTATAAAACAGAAAAATTTCGAAAAAAAAATGAACAATAAAGAT GAAAATTGAAAAAGAAAAAATCCAATATTTTGAATACCTGTTTTCTAATT ACCATTTCACAATGGGAATTCTTTGATCATTTTGTTTCCGCTGCAGATTA TATCGAGACAGACTTTAGTGTATAAAACTATCCGCCTTTTTCATAGCGTG ATTCAGATTTACCGACTTTTTTTTTTTTATCAGGTATTATTCCTGGAGTC AAAAGCTTGTCCCATCACCTTGAAATTCGTGAGATATATGAAATTGGTCT ACACGCTTACGACAACCAAAATTATCAGTATGCTAGCGAATGGATGAGAA CCGCATATGAAGAGTTTGGTTTAAACGCTACAATCGACGGAATCAAGAGA AATAAAGTGCTCGATTATCTTGCATACTCGGAGTATAAGGTATTTAACAT TTTTAATTAATATTGTCGATGTTATGATTAATTTTTTTGGAACCTGTCAA AAATGAAATATTTAACTTCCACCGTTTTACTTAAATGCTTACAATATGGG AAATTGATCTTTTTTAAACCATTAGGAAGTTTTCCAAAAATTTATTTTTA GTCCAGTCACAGATACTCCATCTGAACGAAAAATTCGCCGAAAATTGTTC TTCATTAATCTTTCTCGTTGCGATTTTCAAATTTTTGGATTATCAGGAAA AGTCTAACTGAAAATTTATAACAGGTTATGGTAGTTCTGTTGGATAGATG GCTATCTGTCATTTACTGGTAAAAAATGAATTTTTAATTTTAGAAAGGGA ATCTTCCTGAAGCATTCAAACTAACCAAAGAACTAGCGGCTTTAAGTAAG TATTTTTTCATCCATTCTACTTATCAGGCTATACAGCGTTATAGTTCCCA TCCTGGTGGGGGATGTATCTGTAAATACTCTTTTGGTAAAAAAGGTCTTT GAAAATTTTGCGAATTTTTTTTACAAGTTGTTTTCAAAACCCACACTGGG CTCCAATATTTTATTTTAAATATCATATTCCTTCTTCTCAATTTTAACCC AATTCGTACTAGGGGGGGGGGGCTGTTTCTGTTCGGGGGTGAAACTAGTG TTAATAGCTCCTGAAATAGTAGAGCTTTTGGCATGAAATTTTCTGTAAAT TCCTAACTTTTATTAAGACTCAAAATAAAAAAAATTTTCACACCTCGAGC ATGATGACATTTCTGACAGTAAGGTGTCACAAAAATTGACCCATTTCCAA TACAAATTTATTTTTTATGTCAAATTATATCGTTTAAACCGTAATTTATT GATTTTTTAGGATAAAATAAGTATTTTAGACTCACGGAACTTTTTTCTAA AGCCTTTGTTAGAGTACAATAGCTAATCAAAAGAACAAAGGAAATTTTCG GTTTTTACTCACTTTGGGCATGATGAGTGACGTGATCAAAAAGAATTTTT TTCAAAAGTTACCTTGTATGACAAGGGTCATGTGTTTCATCCAAAAAGAC CCGCAAGATTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT TTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCGTGCATCA TTGAAGTACGTCTGGCTGGAAAAGATATGCTTTGCTTTGCATGCGTCTAC CGCAGTCCAACGAATCAATCAAACTCTGGAGAAAATAATGCCATTCTTAA CCAGCTCTTACGAATTATATCAGAAGATAAGAGATACACGCATCGTTGCA TCATTGGCGACTTCCATTTTCCAACTATAAATTGGAAGAACTGGACAAGC CCACATGTAGAGGAAAGTAAAGAAGAGCAATTCCTGGAAGCATTACGTGA TTCATTCCTTTTCCAACATACGNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNAGAACTATCTCAACATGGAACGCGCTTCCAAAATACGTGG CAGAAGCATCATCGATAAAATCGTTCAAGAATAATTTAAACAAAGCATGG GCAAACCATGAACTACGATATTTATTGTAAATAAACAAAGACCAGTTCTA GAGGCCCACGGCGTGCCTGAACTTTGTATTCGTTGTAATAATAATAATAA AAGATCAAAAGTTAAGGGGTGGTACAGGAAAGCCCCCCCCCTAGTTTTGA ACCGCCCCTAAAAGCCTAGTATGAATAAGATAACCTTACTCCTGTGTCTA ATACATGTAAACAAAACATCAAACATATCAACAAAATATGCTGAAACATA TTTATAACTTCAGAAATATATTGTTGGCTCTTTAGTTCGATCTTTAAGGG ATCAAGATTTTTTTTCAAATTACAGATTTACAGAAGATGTGTTTTTTGAC TTTCAAGCTAAGGGAATGCTTTAGGCCGAATTACAGAGAGATTTAGATAA TAGGGGTTCGAATTAGAGAAAGTTGCCTGTATTTATCTTTTATACTCCAT GAAACCAAAACCGTTTCTGATTTTTTTTATGTTCGCTTTGGTATTCTACA GAACCGAAAGACAAGCGTATCTTGGGAAATCTCGAACATTACCGGTATGA ACTCCGGGCTTCACAATCGACCGGGAAGCGCGGTGATCCGGGTACCCTGA CTGATGAAGAACTCTACAAGAACGCGAAAGGGGGCAGTCAAACTGAAGCG CGTTCGCGGCGTGCATCACTTGGAGATTACGAGAAATTATGCAGAGGAGA GGTCAGACAACAGGTTAGTTGGTTGTTTTTGAAATTTCCTGGTTTAATGT TTAGACCTTATTCAGAACCCTTAAATTATGCTTACATTGTGGACGTTTTT ATTTTTTTTTTTCGCGATTTCCTCATTTTCTCTTCTTTTCAGGAAACATT AGAATCGGACAAAGATACAAAGTTGAAAACATTCCTGTCTCAGTGTCTTA GTAGAACTTTTCCCCTTTTTTAAGAATGTAAATTTCCATTGCAATCCCGA TTGGGATAGAAAACCTAGTAATTTTAGCCCGAAAATCCAGTAGGGATGGT TTTGCATTGCACTTCTTTCAATTTATTTTCCCATTGGGATAGAATTTGGC AACATCCTAGTGGGATTATTTTTCCCACTGGGGACGAGTTTTGGCTTATA TTTTCCAGTTTGGTGGGGTCCCATAAGTTCAATGACACGTGACTCACAGT AATATCTACAATCGGTGACGAAATACTTGGCACAAAAAGGAAATCCACCG GGGTGTTTTGAAACCACAATCGATTTGCAAGTGATCTAAAGTAGGTTGGA AGGGTAGAGTTTTAACTCTGATCGAAATAATCGTTGAAATCAAGTTGAAG GCCTGAAATTGACATTCTCGCTCGAACTTCAATTTTTGAAAAATTGTAAA TTGGCCAAAAGTGCCAATATGTTATGGCACCGATTGTAGAATGAAAAGGG ATTGTTTTTCTTCATCTTCAGACAAAGAGAGAACTGAAGAAGATGAAATG TTGGTACAAAACAAATGATCCAACTCTCATCCTGAAGCCACAAAAATTTG AACGTATTTGGGCTGATCCTGAAATCTTCATGCTTCGAGATGTAATTACT AATAGACAAATCGAGCAACTCAAAGAAGAGGCGTACCCTATTGTAAGACA ACGTTCCTTTATCCATTCTTTTTATCCCAAAGACTTATATATTATTTTAT TTTAAAAATCTTATTGCATTCTTTTTTCATGCTATTTTTTCGAAAATCGA TTCTCGATTATATTGAAATTATATTCCATCTGATATCATCCTAACAATGA ACTTGTGCTTCTTATTTACATGCAGTTTTGTTTAGTGAATGTCAAATTTT ATTCAAAATGATATTATCATCCCGTTACGATTATTGTATTATTATATATC AACAATAATACTCTATTACATTGTTTATAAACAAATCCAGTCTAATTTAG AGCCATTAATCGCTTGGAGAGGATCTACAAGGAATTTTTTGGACCTACCT CCGGGTGCCCCGGCGGAGGTCCTATAAATTAACCTTCGTTCGTTCGTTCG TTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTT CGTTCGTTCGTCTGTTACCAGCTTTTTCAGGATTGGCTCATTAGTTTTTT TTTTATTTTTGGCACAATGATGCAAAATGGTAATGCCCAAAATGTGACGG AGCCCGATTTTTGAGAAAAAATCTTTTCCGGTCGAAAATGNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNTTTTCACACAAAAACATTATTAATAGCAATGCCCACC ATTAAGCATGGTTCAATCGTCAATAGAACTGAGTTTTGAAGCCGGAACTT TCTAAAAATCGCCCGTGCAGCCCATTTTCGCCGGAAAAACGGTATTTCTT GATTTTCTCGAGCTGTACTTTATAATTTTTCATGAAATTTTGCACACTGA TGCAAAATGATAATACCTAAAATGTGACGGAGCCCGATTTTCGAAAAAAA ATTTTTTCCGGCCGAAAAAGCCGGAAATATGCCGGAAATACTGGTTTTTT GACATTTTCTCGAGATTTTATCATTAGTTTTTTCTGATTTTTTGCACAAA GATGCGTATTATCAATGCCCAAAACATGGCCGAGTCCGATTTTTGAGAAA AATTTCTTTCCGGCGGAAAATGCCTGAAATATGCCGGAAATCACCGTTTT ATGGGTTTTCATGGGCTTTTTCCTTTTAAATGGTTGCTTTTTCATTCAAA CACATTATTAATAGCAATGTTCACCATCAAGCATGATTCAATTGTCAATA AGACTGATTTTTGCGACCACAACTTTCTATTCATTTTTTCCTTACATTCA TCATCAGGTAGGTCCATTCAGCATCTATCTTGTTGTCTTAGTTTTCAATC TAGTAAATCTGAGCTTTCGATTTTTTTGCCATAAAACGATTTTATTAAGT GAGAAAATCTTCTTTTAATTCGTTACAAATTTTCAAAATCTTTGTATTTG AATGTATTTCCCCTCTAGTTAAAACGTGCCACGATTCAAGACCCCATCAC AGGACAACTGAGACACGCCGATTATCGAGTCAGTAAAAGTGCCTGGTTGT CACCGTCCCGCCACGAGTTCGTACGACAAATCGCTTTGAGAGCGCAATCC GCTACTAATTTGGATATTCGATCGTCAGGTAAGAATTGAATGTCATCTTA TTTTCTTATTAATGTAGCTCTGATGCCACAATTTCTGTTACCTTATCGGC CAAACCTTAGTCGGCCCTAAGTGACTAAATTTTGGCTTGGTGACTAAAAT TAGGGCCGTCTAAAAATTTGGGCCGACTAAAATTTGGGCCGACTAAAAAT TTGGCCCAAATTAAAAGTTTATAATTAAGGTTTCCCTATTTTCCAGTATT TTAAGCTTTCTCCTATTTTCCATTTGCTTGTAAATTTAGGAATGGCCAAA ATTTTTAGTCTGTCTTAATTATTAGTCGGCCCTTATTGGCTAAATTTTGA CCAGGTGACTAAAATTAGGGCAGATTAATAATTAAGGCCGACTAAAATTA AGGCCGACTAAGTTTTGGCCGATAAGGTAGACGGTAGACGTATACTTAGA CGGACAAATCCAGCGAATAACATTTTTTCGTTGTTTTTAGGTCTTTGCTT TTGTTGTCGATTTATATTAAAAGTCTTTTCATTTTTTAAAAGTTTCTACT ACAGATCAATTTGAGAAAAACAGATACTTCTGTGAATCAACTCACAGTTC TTTATCTACTTCTCCTTAAAATTAACAATTTTTTTAAAAATTCTTCCAGA ACAACTTCAGATTGCGAATTACGGTATTGGTGGCCATTATGAACCTCACT TTGACCACGCACGTGAAGATGAAGATAAATTTACTGACCTGGGAATGGGA AACCGAATTGCCACCGTACTTTATTATGTAAGTAAACTTCAATGTCTTTT CTTTTCTCTCGGGTCTGTGTTTTATATTTTCTATTCCAATGTTGCTGAGA TTTGACTCAGAGCTGACTTACTCTTGTTAACTTTTCGCGACCGTTCATTT CGCGAGCCAAGAAAAATCGCGTGATTTTTGTATTCTTATTTTTTTGCGAA TCAGCATTTAGAAAAAACGTAGATTGAATTTCGCGAATCAGTCAACATCA GTTGAATAAGGACTTGGAAACGCAAATCTTTGGTCAGAAAAATAGAAATT ATTTGATACTTTACATCGAGAATGTGATTTTAAAAGTTTGGTTGTCTCCC GCGATTTCGCCTGATTTATTTTACGCGAAAAAGGCAAACTTAATCCGATC AATGTTTTTGTATTGTAAATATTGCCAAAGTTTTGCCAGGTTTTTTCGTA TAAAGCCATGGAATTCTAAATCTAAATATAAAAGACATTTTACATAATAA CTCTCTTTCTCTTTACTTCAGCTTTCTGACGTCGAGGCTGGCGGAGCTAC AGTTTTTACGGTTGGAAAAACCGCTGTCTTTCCAAGCAAGGTATCGTATT GTAGTTTCATTCGCGTAAACACGTTTTTCATTAACCCCCCTGTATAGTAA TAATCCAATATTAAGTAGGCCTTTATCAATCGTGTATACTTTTCCTGGAG TATAAAGTAAATTTAAGCTAAAGCCCTGGCTATATGTTTATTATTTATTT TCCATAATGGAAAAGATTGATTCTTCAATAGTTTTCCTTGATACGTTAAT GTTATCTTGTTGTTTTCTTTACAGGGAGATGCAGTATTTTGGTATAATTT GAAACGAAACGGAATTGGCAACCCAAGAACTCGCCATGCTGCTTGTCCCG TACTCGTTGGTACCAAATGGGGTGAGTTGCCCTGACCCAGAAATGCTTTA TACTGTATAGAGTGCATCCTTCATTCAATCTGTTGTTGGACCTACCCCGG TGGAGGTCCTATAAATTAACCTATGTTTGTTCGTTCGTTCGTTCGTTATT AGCTTTTCTCGAGATTGGCTCATTATTTTTTTCTGATTTTTTTAACAAAG ATGCATAACTATATACCCTTGAATGTGTCGGAGCCCGATTTTCGAAAAAA AAAAATTTTGGTCAAATTTGAGCCAAAAAACGGCTAAAAAACGGGTTTTT TGGACTTGGTGAAAAATTCGATCATTAATTTTTTCCAATTTTTTGNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAGTA GGGTACCATCATAGGTAAAAGATGGTTCAAGCAGATTTTTGCAAAAAAAT TTTGTTGGCTCAAAAAACGCATGTTTATCTATAAGAAGCACTATTTAAGC ATACATCAATGTTCTAAGTCAAATTACTCTATTTTTTATGCGATAGATGT TTTTTTTTGCTCATGAGGGCTGAATATGTGTGTTTAGACACGAAATTTTG GTTGCTTGGCGTGTTTTTATAAAAAAAACTGGCTAAATTCGATATTTTTT TATAAGCACATTATCAATTACTTAGGTATTAGCTTTTCTCGAGATTGGCT CTTTCATTCTTTATGATTTTTGCACAAAGATGCATAATTATAAACCCTTG AATGTGACGGACCCTGATATTTGAAAAAAAATGTTTTGGGCAAATTTGGG CCAAAAAACGGCTAAAAAGGGTTTTTGGACTTTGTGAAATATATCCATTG CTTTTTTCTGAATTTTTGCATGAAAGTAGGTAAAAGATGGCTCAAGCAGA TTTTTGTAAAAAAAGAATTTTTTAGCTCAAAAAACGCATGTTTATCTATA ANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA TTTCTTGCTCACGAAGTCTTGAATATGAAAGAATATTTCAAGGGCATGAA ATTTTGGTTTCTAAACGTTTTTTTATAAGAAACAAACGACTAATTTAATT AAATCGTCACTATTTGTGTTCTGAATGATTGATATAAATTATATGTGTTA ATTTCAAAACCAGGTAGGTACATAAAAGTATCGCTTGTTTTTTTTAGAAT TAACTTATAGGACAGTCTGTAGTACTTGCGTATTATAAGATTTCCAAAAG ATTGCAGTGGGTTGACGAACTAAATTGAAATGTAAACTCTTGTTCAATGT AAATTTTAGGCCATTTAACTGTGTTTGCCTTCTTAAATTGAACTTTTTTT GAAGGTGGTACCCGAATTAGAGGCCATTGCAGTACCATACCTAACTCCCA ACAGCGTTTCGTCAGAAGTATTCAAGGAAAAGTAGATCTAATTTTTTTGA CGAGGTTTTTGGCTCATTTACACTGAGTGGTGTAAACCTTTAGGATGGAA ATTCTAAGTTGAATCAAAAACCAAAATTTTTTTCCTTTTCAGTTTCCAAC TTTTGGATCCATGAATATAATCAGGAATTCAGAAGACCATGTGCGTTGAA GAGCCATTTGTAAACAAGAAAGTTGTTCGGTAAAATATCACTTTGATTGT AACCTTTGGTAGGCTATTTAAAGTTAGTTTATTTATATTTTCATCAACTT GCCCTCTAAACTACACGTTTTTTATAAGAACAAACTATATAAGAAC

Coding sequence (CDS) from alignment at sc0000001:976137..990982-

>TCONS_00000181 ID=TCONS_00000181|Name=TCONS_00000181|organism=Clytia hemisphaerica|type=CDS|length=17919bp|location=Sequence derived from alignment at sc0000001:976137..990982- (Clytia hemisphaerica)
TTTCCAACTTTTGGATCCATGAATATAATCAGGAATTCAGAAGACCATGT
GCGTTGAAGAGCCATTTGTAAGGAGATGCAGTATTTTGGTATAATTTGAA
ACGAAACGGAATTGGCAACCCAAGAACTCGCCATGCTGCTTGTCCCGTAC
TCGTTGGTACCAAATGGGCTTTCTGACGTCGAGGCTGGCGGAGCTACAGT
TTTTACGGTTGGAAAAACCGCTGTCTTTCCAAGCAAGAACAACTTCAGAT
TGCGAATTACGGTATTGGTGGCCATTATGAACCTCACTTTGACCACGCAC
GTGAAGATGAAGATAAATTTACTGACCTGGGAATGGGAAACCGAATTGCC
ACCGTACTTTATTATTTAAAACGTGCCACGATTCAAGACCCCATCACAGG
ACAACTGAGACACGCCGATTATCGAGTCAGTAAAAGTGCCTGGTTGTCAC
CGTCCCGCCACGAGTTCGTACGACAAATCGCTTTGAGAGCGCAATCCGCT
ACTAATTTGGATATTCGATCGTCAGACAAAGAGAGAACTGAAGAAGATGA
AATGTTGGTACAAAACAAATGATCCAACTCTCATCCTGAAGCCACAAAAA
TTTGAACGTATTTGGGCTGATCCTGAAATCTTCATGCTTCGAGATGTAAT
TACTAATAGACAAATCGAGCAACTCAAAGAAGAGGCGTACCCTATTAACC
GAAAGACAAGCGTATCTTGGGAAATCTCGAACATTACCGGTATGAACTCC
GGGCTTCACAATCGACCGGGAAGCGCGGTGATCCGGGTACCCTGACTGAT
GAAGAACTCTACAAGAACGCGAAAGGGGGCAGTCAAACTGAAGCGCGTTC
GCGGCGTGCATCACTTGGAGATTACGAGAAATTATGCAGAGGAGAGGTCA
GACAACAGAAAGGGAATCTTCCTGAAGCATTCAAACTAACCAAAGAACTA
GCGGCTTTAAGTATTATTCCTGGAGTCAAAAGCTTGTCCCATCACCTTGA
AATTCGTGAGATATATGAAATTGGTCTACACGCTTACGACAACCAAAATT
ATCAGTATGCTAGCGAATGGATGAGAACCGCATATGAAGAGTTTGGTTTA
AACGCTACAATCGACGGAATCAAGAGAAATAAAGTGCTCGATTATCTTGC
ATACTCGGAGTATAAGATTTCAAGGCGATTTACGATAATGCAAAAATGGT
TCTACCAACAACGGAAGACCATGAAGGTGCCATGACTGCTTTATTTCGAT
TGCAAGACACATACAAAGTCCCATCCAACATGCTTGCTAAAGATGTGGAA
ATCATTAGCTCTGGTGTTAGTTGTATTATGTATTTTGGAACAAGGACAAT
GTGAAGTTTTCACTTCGATGGCTAACATGGAAAACTTGGCAGAAACCGAA
CAGTTACTTTTCTCATCTTTCAAAACATACTTACAAGCTGAAGAAGATCG
TTTGAAGGTTTTAAAAAATTTTATGTTGAGAGTGGAGGATGCACAGAAGA
ATGTAAACTTGTCAGATGTAGCAAAATATCTGGGAAACCCAATTAATACG
TATTTGATGCTTCGGAGATTGAGCTCTGAATGGAGAGATGTCGAATCGTT
TTTATCACAAGATGGCGAGGCTGCTGAAGTTTCCAACTTTTGGATCCATG
AATATAATCAGGAATTCAGAAGACCATGTGCGTTGAAGAGCCATTTGTAA
GGAGATGCAGTATTTTGGTATAATTTGAAACGAAACGGAATTGGCAACCC
AAGAACTCGCCATGCTGCTTGTCCCGTACTCGTTGGTACCAAATGGGCTT
TCTGACGTCGAGGCTGGCGGAGCTACAGTTTTTACGGTTGGAAAAACCGC
TGTCTTTCCAAGCAAGAACAACTTCAGATTGCGAATTACGGTATTGGTGG
CCATTATGAACCTCACTTTGACCACGCACGTGAAGATGAAGATAAATTTA
CTGACCTGGGAATGGGAAACCGAATTGCCACCGTACTTTATTATTTAAAA
CGTGCCACGATTCAAGACCCCATCACAGGACAACTGAGACACGCCGATTA
TCGAGTCAGTAAAAGTGCCTGGTTGTCACCGTCCCGCCACGAGTTCGTAC
GACAAATCGCTTTGAGAGCGCAATCCGCTACTAATTTGGATATTCGATCG
TCAGACAAAGAGAGAACTGAAGAAGATGAAATGTTGGTACAAAACAAATG
ATCCAACTCTCATCCTGAAGCCACAAAAATTTGAACGTATTTGGGCTGAT
CCTGAAATCTTCATGCTTCGAGATGTAATTACTAATAGACAAATCGAGCA
ACTCAAAGAAGAGGCGTACCCTATTAACCGAAAGACAAGCGTATCTTGGG
AAATCTCGAACATTACCGGTATGAACTCCGGGCTTCACAATCGACCGGGA
AGCGCGGTGATCCGGGTACCCTGACTGATGAAGAACTCTACAAGAACGCG
AAAGGGGGCAGTCAAACTGAAGCGCGTTCGCGGCGTGCATCACTTGGAGA
TTACGAGAAATTATGCAGAGGAGAGGTCAGACAACAGAAAGGGAATCTTC
CTGAAGCATTCAAACTAACCAAAGAACTAGCGGCTTTAAGTATTATTCCT
GGAGTCAAAAGCTTGTCCCATCACCTTGAAATTCGTGAGATATATGAAAT
TGGTCTACACGCTTACGACAACCAAAATTATCAGTATGCTAGCGAATGGA
TGAGAACCGCATATGAAGAGTTTGGTTTAAACGCTACAATCGACGGAATC
AAGAGAAATAAAGTGCTCGATTATCTTGCATACTCGGAGTATAAGATTTC
AAGGCGATTTACGATAATGCAAAAATGGTTCTACCAACAACGGAAGACCA
TGAAGGTGCCATGACTGCTTTATTTCGATTGCAAGACACATACAAAGTCC
CATCCAACATGCTTGCTAAAGATGTGGAAATCATTAGCTCTGGTGTTAGT
TGTATTATGTATTTTGGAACAAGGACAATGTGAAGTTTTCACTTCGATGG
CTAACATGGAAAACTTGGCAGAAACCGAACAGTTACTTTTCTCATCTTTC
AAAACATACTTACAAGCTGAAGAAGATCGTTTGAAGGTTTTAAAAAATTT
TATGTTGAGAGTGGAGGATGCACAGAAGAATGTAAACTTGTCAGATGTAG
CAAAATATCTGGGAAACCCAATTAATACGTATTTGATGCTTCGGAGATTG
AGCTCTGAATGGAGAGATGTCGAATCGTTTTTATCACAAGATGGCGAGGC
TGCTGAAGTTTCCAACTTTTGGATCCATGAATATAATCAGGAATTCAGAA
GACCATGTGCGTTGAAGAGCCATTTGTAAGGAGATGCAGTATTTTGGTAT
AATTTGAAACGAAACGGAATTGGCAACCCAAGAACTCGCCATGCTGCTTG
TCCCGTACTCGTTGGTACCAAATGGGCTTTCTGACGTCGAGGCTGGCGGA
GCTACAGTTTTTACGGTTGGAAAAACCGCTGTCTTTCCAAGCAAGAACAA
CTTCAGATTGCGAATTACGGTATTGGTGGCCATTATGAACCTCACTTTGA
CCACGCACGTGAAGATGAAGATAAATTTACTGACCTGGGAATGGGAAACC
GAATTGCCACCGTACTTTATTATTTAAAACGTGCCACGATTCAAGACCCC
ATCACAGGACAACTGAGACACGCCGATTATCGAGTCAGTAAAAGTGCCTG
GTTGTCACCGTCCCGCCACGAGTTCGTACGACAAATCGCTTTGAGAGCGC
AATCCGCTACTAATTTGGATATTCGATCGTCAGACAAAGAGAGAACTGAA
GAAGATGAAATGTTGGTACAAAACAAATGATCCAACTCTCATCCTGAAGC
CACAAAAATTTGAACGTATTTGGGCTGATCCTGAAATCTTCATGCTTCGA
GATGTAATTACTAATAGACAAATCGAGCAACTCAAAGAAGAGGCGTACCC
TATTAACCGAAAGACAAGCGTATCTTGGGAAATCTCGAACATTACCGGTA
TGAACTCCGGGCTTCACAATCGACCGGGAAGCGCGGTGATCCGGGTACCC
TGACTGATGAAGAACTCTACAAGAACGCGAAAGGGGGCAGTCAAACTGAA
GCGCGTTCGCGGCGTGCATCACTTGGAGATTACGAGAAATTATGCAGAGG
AGAGGTCAGACAACAGAAAGGGAATCTTCCTGAAGCATTCAAACTAACCA
AAGAACTAGCGGCTTTAAGTATTATTCCTGGAGTCAAAAGCTTGTCCCAT
CACCTTGAAATTCGTGAGATATATGAAATTGGTCTACACGCTTACGACAA
CCAAAATTATCAGTATGCTAGCGAATGGATGAGAACCGCATATGAAGAGT
TTGGTTTAAACGCTACAATCGACGGAATCAAGAGAAATAAAGTGCTCGAT
TATCTTGCATACTCGGAGTATAAGATTTCAAGGCGATTTACGATAATGCA
AAAATGGTTCTACCAACAACGGAAGACCATGAAGGTGCCATGACTGCTTT
ATTTCGATTGCAAGACACATACAAAGTCCCATCCAACATGCTTGCTAAAG
ATGTGGAAATCATTAGCTCTGGTGTTAGTTGTATTATGTATTTTGGAACA
AGGACAATGTGAAGTTTTCACTTCGATGGCTAACATGGAAAACTTGGCAG
AAACCGAACAGTTACTTTTCTCATCTTTCAAAACATACTTACAAGCTGAA
GAAGATCGTTTGAAGGTTTTAAAAAATTTTATGTTGAGAGTGGAGGATGC
ACAGAAGAATGTAAACTTGTCAGATGTAGCAAAATATCTGGGAAACCCAA
TTAATACGTATTTGATGCTTCGGAGATTGAGCTCTGAATGGAGAGATGTC
GAATCGTTTTTATCACAAGATGGCGAGGCTGCTGAAGTTTCCAACTTTTG
GATCCATGAATATAATCAGGAATTCAGAAGACCATGTGCGTTGAAGAGCC
ATTTGTAAGGAGATGCAGTATTTTGGTATAATTTGAAACGAAACGGAATT
GGCAACCCAAGAACTCGCCATGCTGCTTGTCCCGTACTCGTTGGTACCAA
ATGGGCTTTCTGACGTCGAGGCTGGCGGAGCTACAGTTTTTACGGTTGGA
AAAACCGCTGTCTTTCCAAGCAAGAACAACTTCAGATTGCGAATTACGGT
ATTGGTGGCCATTATGAACCTCACTTTGACCACGCACGTGAAGATGAAGA
TAAATTTACTGACCTGGGAATGGGAAACCGAATTGCCACCGTACTTTATT
ATTTAAAACGTGCCACGATTCAAGACCCCATCACAGGACAACTGAGACAC
GCCGATTATCGAGTCAGTAAAAGTGCCTGGTTGTCACCGTCCCGCCACGA
GTTCGTACGACAAATCGCTTTGAGAGCGCAATCCGCTACTAATTTGGATA
TTCGATCGTCAGACAAAGAGAGAACTGAAGAAGATGAAATGTTGGTACAA
AACAAATGATCCAACTCTCATCCTGAAGCCACAAAAATTTGAACGTATTT
GGGCTGATCCTGAAATCTTCATGCTTCGAGATGTAATTACTAATAGACAA
ATCGAGCAACTCAAAGAAGAGGCGTACCCTATTAACCGAAAGACAAGCGT
ATCTTGGGAAATCTCGAACATTACCGGTATGAACTCCGGGCTTCACAATC
GACCGGGAAGCGCGGTGATCCGGGTACCCTGACTGATGAAGAACTCTACA
AGAACGCGAAAGGGGGCAGTCAAACTGAAGCGCGTTCGCGGCGTGCATCA
CTTGGAGATTACGAGAAATTATGCAGAGGAGAGGTCAGACAACAGAAAGG
GAATCTTCCTGAAGCATTCAAACTAACCAAAGAACTAGCGGCTTTAAGTA
TTATTCCTGGAGTCAAAAGCTTGTCCCATCACCTTGAAATTCGTGAGATA
TATGAAATTGGTCTACACGCTTACGACAACCAAAATTATCAGTATGCTAG
CGAATGGATGAGAACCGCATATGAAGAGTTTGGTTTAAACGCTACAATCG
ACGGAATCAAGAGAAATAAAGTGCTCGATTATCTTGCATACTCGGAGTAT
AAGATTTCAAGGCGATTTACGATAATGCAAAAATGGTTCTACCAACAACG
GAAGACCATGAAGGTGCCATGACTGCTTTATTTCGATTGCAAGACACATA
CAAAGTCCCATCCAACATGCTTGCTAAAGATGTGGAAATCATTAGCTCTG
GTGTTAGTTGTATTATGTATTTTGGAACAAGGACAATGTGAAGTTTTCAC
TTCGATGGCTAACATGGAAAACTTGGCAGAAACCGAACAGTTACTTTTCT
CATCTTTCAAAACATACTTACAAGCTGAAGAAGATCGTTTGAAGGTTTTA
AAAAATTTTATGTTGAGAGTGGAGGATGCACAGAAGAATGTAAACTTGTC
AGATGTAGCAAAATATCTGGGAAACCCAATTAATACGTATTTGATGCTTC
GGAGATTGAGCTCTGAATGGAGAGATGTCGAATCGTTTTTATCACAAGAT
GGCGAGGCTGCTGAAGTTTCCAACTTTTGGATCCATGAATATAATCAGGA
ATTCAGAAGACCATGTGCGTTGAAGAGCCATTTGTAAGGAGATGCAGTAT
TTTGGTATAATTTGAAACGAAACGGAATTGGCAACCCAAGAACTCGCCAT
GCTGCTTGTCCCGTACTCGTTGGTACCAAATGGGCTTTCTGACGTCGAGG
CTGGCGGAGCTACAGTTTTTACGGTTGGAAAAACCGCTGTCTTTCCAAGC
AAGAACAACTTCAGATTGCGAATTACGGTATTGGTGGCCATTATGAACCT
CACTTTGACCACGCACGTGAAGATGAAGATAAATTTACTGACCTGGGAAT
GGGAAACCGAATTGCCACCGTACTTTATTATTTAAAACGTGCCACGATTC
AAGACCCCATCACAGGACAACTGAGACACGCCGATTATCGAGTCAGTAAA
AGTGCCTGGTTGTCACCGTCCCGCCACGAGTTCGTACGACAAATCGCTTT
GAGAGCGCAATCCGCTACTAATTTGGATATTCGATCGTCAGACAAAGAGA
GAACTGAAGAAGATGAAATGTTGGTACAAAACAAATGATCCAACTCTCAT
CCTGAAGCCACAAAAATTTGAACGTATTTGGGCTGATCCTGAAATCTTCA
TGCTTCGAGATGTAATTACTAATAGACAAATCGAGCAACTCAAAGAAGAG
GCGTACCCTATTAACCGAAAGACAAGCGTATCTTGGGAAATCTCGAACAT
TACCGGTATGAACTCCGGGCTTCACAATCGACCGGGAAGCGCGGTGATCC
GGGTACCCTGACTGATGAAGAACTCTACAAGAACGCGAAAGGGGGCAGTC
AAACTGAAGCGCGTTCGCGGCGTGCATCACTTGGAGATTACGAGAAATTA
TGCAGAGGAGAGGTCAGACAACAGAAAGGGAATCTTCCTGAAGCATTCAA
ACTAACCAAAGAACTAGCGGCTTTAAGTATTATTCCTGGAGTCAAAAGCT
TGTCCCATCACCTTGAAATTCGTGAGATATATGAAATTGGTCTACACGCT
TACGACAACCAAAATTATCAGTATGCTAGCGAATGGATGAGAACCGCATA
TGAAGAGTTTGGTTTAAACGCTACAATCGACGGAATCAAGAGAAATAAAG
TGCTCGATTATCTTGCATACTCGGAGTATAAGATTTCAAGGCGATTTACG
ATAATGCAAAAATGGTTCTACCAACAACGGAAGACCATGAAGGTGCCATG
ACTGCTTTATTTCGATTGCAAGACACATACAAAGTCCCATCCAACATGCT
TGCTAAAGATGTGGAAATCATTAGCTCTGGTGTTAGTTGTATTATGTATT
TTGGAACAAGGACAATGTGAAGTTTTCACTTCGATGGCTAACATGGAAAA
CTTGGCAGAAACCGAACAGTTACTTTTCTCATCTTTCAAAACATACTTAC
AAGCTGAAGAAGATCGTTTGAAGGTTTTAAAAAATTTTATGTTGAGAGTG
GAGGATGCACAGAAGAATGTAAACTTGTCAGATGTAGCAAAATATCTGGG
AAACCCAATTAATACGTATTTGATGCTTCGGAGATTGAGCTCTGAATGGA
GAGATGTCGAATCGTTTTTATCACAAGATGGCGAGGCTGCTGAAGTTTCC
AACTTTTGGATCCATGAATATAATCAGGAATTCAGAAGACCATGTGCGTT
GAAGAGCCATTTGTAAGGAGATGCAGTATTTTGGTATAATTTGAAACGAA
ACGGAATTGGCAACCCAAGAACTCGCCATGCTGCTTGTCCCGTACTCGTT
GGTACCAAATGGGCTTTCTGACGTCGAGGCTGGCGGAGCTACAGTTTTTA
CGGTTGGAAAAACCGCTGTCTTTCCAAGCAAGAACAACTTCAGATTGCGA
ATTACGGTATTGGTGGCCATTATGAACCTCACTTTGACCACGCACGTGAA
GATGAAGATAAATTTACTGACCTGGGAATGGGAAACCGAATTGCCACCGT
ACTTTATTATTTAAAACGTGCCACGATTCAAGACCCCATCACAGGACAAC
TGAGACACGCCGATTATCGAGTCAGTAAAAGTGCCTGGTTGTCACCGTCC
CGCCACGAGTTCGTACGACAAATCGCTTTGAGAGCGCAATCCGCTACTAA
TTTGGATATTCGATCGTCAGACAAAGAGAGAACTGAAGAAGATGAAATGT
TGGTACAAAACAAATGATCCAACTCTCATCCTGAAGCCACAAAAATTTGA
ACGTATTTGGGCTGATCCTGAAATCTTCATGCTTCGAGATGTAATTACTA
ATAGACAAATCGAGCAACTCAAAGAAGAGGCGTACCCTATTAACCGAAAG
ACAAGCGTATCTTGGGAAATCTCGAACATTACCGGTATGAACTCCGGGCT
TCACAATCGACCGGGAAGCGCGGTGATCCGGGTACCCTGACTGATGAAGA
ACTCTACAAGAACGCGAAAGGGGGCAGTCAAACTGAAGCGCGTTCGCGGC
GTGCATCACTTGGAGATTACGAGAAATTATGCAGAGGAGAGGTCAGACAA
CAGAAAGGGAATCTTCCTGAAGCATTCAAACTAACCAAAGAACTAGCGGC
TTTAAGTATTATTCCTGGAGTCAAAAGCTTGTCCCATCACCTTGAAATTC
GTGAGATATATGAAATTGGTCTACACGCTTACGACAACCAAAATTATCAG
TATGCTAGCGAATGGATGAGAACCGCATATGAAGAGTTTGGTTTAAACGC
TACAATCGACGGAATCAAGAGAAATAAAGTGCTCGATTATCTTGCATACT
CGGAGTATAAGATTTCAAGGCGATTTACGATAATGCAAAAATGGTTCTAC
CAACAACGGAAGACCATGAAGGTGCCATGACTGCTTTATTTCGATTGCAA
GACACATACAAAGTCCCATCCAACATGCTTGCTAAAGATGTGGAAATCAT
TAGCTCTGGTGTTAGTTGTATTATGTATTTTGGAACAAGGACAATGTGAA
GTTTTCACTTCGATGGCTAACATGGAAAACTTGGCAGAAACCGAACAGTT
ACTTTTCTCATCTTTCAAAACATACTTACAAGCTGAAGAAGATCGTTTGA
AGGTTTTAAAAAATTTTATGTTGAGAGTGGAGGATGCACAGAAGAATGTA
AACTTGTCAGATGTAGCAAAATATCTGGGAAACCCAATTAATACGTATTT
GATGCTTCGGAGATTGAGCTCTGAATGGAGAGATGTCGAATCGTTTTTAT
CACAAGATGGCGAGGCTGCTGAAGTTTCCAACTTTTGGATCCATGAATAT
AATCAGGAATTCAGAAGACCATGTGCGTTGAAGAGCCATTTGTAAGGAGA
TGCAGTATTTTGGTATAATTTGAAACGAAACGGAATTGGCAACCCAAGAA
CTCGCCATGCTGCTTGTCCCGTACTCGTTGGTACCAAATGGGCTTTCTGA
CGTCGAGGCTGGCGGAGCTACAGTTTTTACGGTTGGAAAAACCGCTGTCT
TTCCAAGCAAGAACAACTTCAGATTGCGAATTACGGTATTGGTGGCCATT
ATGAACCTCACTTTGACCACGCACGTGAAGATGAAGATAAATTTACTGAC
CTGGGAATGGGAAACCGAATTGCCACCGTACTTTATTATTTAAAACGTGC
CACGATTCAAGACCCCATCACAGGACAACTGAGACACGCCGATTATCGAG
TCAGTAAAAGTGCCTGGTTGTCACCGTCCCGCCACGAGTTCGTACGACAA
ATCGCTTTGAGAGCGCAATCCGCTACTAATTTGGATATTCGATCGTCAGA
CAAAGAGAGAACTGAAGAAGATGAAATGTTGGTACAAAACAAATGATCCA
ACTCTCATCCTGAAGCCACAAAAATTTGAACGTATTTGGGCTGATCCTGA
AATCTTCATGCTTCGAGATGTAATTACTAATAGACAAATCGAGCAACTCA
AAGAAGAGGCGTACCCTATTAACCGAAAGACAAGCGTATCTTGGGAAATC
TCGAACATTACCGGTATGAACTCCGGGCTTCACAATCGACCGGGAAGCGC
GGTGATCCGGGTACCCTGACTGATGAAGAACTCTACAAGAACGCGAAAGG
GGGCAGTCAAACTGAAGCGCGTTCGCGGCGTGCATCACTTGGAGATTACG
AGAAATTATGCAGAGGAGAGGTCAGACAACAGAAAGGGAATCTTCCTGAA
GCATTCAAACTAACCAAAGAACTAGCGGCTTTAAGTATTATTCCTGGAGT
CAAAAGCTTGTCCCATCACCTTGAAATTCGTGAGATATATGAAATTGGTC
TACACGCTTACGACAACCAAAATTATCAGTATGCTAGCGAATGGATGAGA
ACCGCATATGAAGAGTTTGGTTTAAACGCTACAATCGACGGAATCAAGAG
AAATAAAGTGCTCGATTATCTTGCATACTCGGAGTATAAGATTTCAAGGC
GATTTACGATAATGCAAAAATGGTTCTACCAACAACGGAAGACCATGAAG
GTGCCATGACTGCTTTATTTCGATTGCAAGACACATACAAAGTCCCATCC
AACATGCTTGCTAAAGATGTGGAAATCATTAGCTCTGGTGTTAGTTGTAT
TATGTATTTTGGAACAAGGACAATGTGAAGTTTTCACTTCGATGGCTAAC
ATGGAAAACTTGGCAGAAACCGAACAGTTACTTTTCTCATCTTTCAAAAC
ATACTTACAAGCTGAAGAAGATCGTTTGAAGGTTTTAAAAAATTTTATGT
TGAGAGTGGAGGATGCACAGAAGAATGTAAACTTGTCAGATGTAGCAAAA
TATCTGGGAAACCCAATTAATACGTATTTGATGCTTCGGAGATTGAGCTC
TGAATGGAGAGATGTCGAATCGTTTTTATCACAAGATGGCGAGGCTGCTG
AAGTTTCCAACTTTTGGATCCATGAATATAATCAGGAATTCAGAAGACCA
TGTGCGTTGAAGAGCCATTTGTAAGGAGATGCAGTATTTTGGTATAATTT
GAAACGAAACGGAATTGGCAACCCAAGAACTCGCCATGCTGCTTGTCCCG
TACTCGTTGGTACCAAATGGGCTTTCTGACGTCGAGGCTGGCGGAGCTAC
AGTTTTTACGGTTGGAAAAACCGCTGTCTTTCCAAGCAAGAACAACTTCA
GATTGCGAATTACGGTATTGGTGGCCATTATGAACCTCACTTTGACCACG
CACGTGAAGATGAAGATAAATTTACTGACCTGGGAATGGGAAACCGAATT
GCCACCGTACTTTATTATTTAAAACGTGCCACGATTCAAGACCCCATCAC
AGGACAACTGAGACACGCCGATTATCGAGTCAGTAAAAGTGCCTGGTTGT
CACCGTCCCGCCACGAGTTCGTACGACAAATCGCTTTGAGAGCGCAATCC
GCTACTAATTTGGATATTCGATCGTCAGACAAAGAGAGAACTGAAGAAGA
TGAAATGTTGGTACAAAACAAATGATCCAACTCTCATCCTGAAGCCACAA
AAATTTGAACGTATTTGGGCTGATCCTGAAATCTTCATGCTTCGAGATGT
AATTACTAATAGACAAATCGAGCAACTCAAAGAAGAGGCGTACCCTATTA
ACCGAAAGACAAGCGTATCTTGGGAAATCTCGAACATTACCGGTATGAAC
TCCGGGCTTCACAATCGACCGGGAAGCGCGGTGATCCGGGTACCCTGACT
GATGAAGAACTCTACAAGAACGCGAAAGGGGGCAGTCAAACTGAAGCGCG
TTCGCGGCGTGCATCACTTGGAGATTACGAGAAATTATGCAGAGGAGAGG
TCAGACAACAGAAAGGGAATCTTCCTGAAGCATTCAAACTAACCAAAGAA
CTAGCGGCTTTAAGTATTATTCCTGGAGTCAAAAGCTTGTCCCATCACCT
TGAAATTCGTGAGATATATGAAATTGGTCTACACGCTTACGACAACCAAA
ATTATCAGTATGCTAGCGAATGGATGAGAACCGCATATGAAGAGTTTGGT
TTAAACGCTACAATCGACGGAATCAAGAGAAATAAAGTGCTCGATTATCT
TGCATACTCGGAGTATAAGATTTCAAGGCGATTTACGATAATGCAAAAAT
GGTTCTACCAACAACGGAAGACCATGAAGGTGCCATGACTGCTTTATTTC
GATTGCAAGACACATACAAAGTCCCATCCAACATGCTTGCTAAAGATGTG
GAAATCATTAGCTCTGGTGTTAGTTGTATTATGTATTTTGGAACAAGGAC
AATGTGAAGTTTTCACTTCGATGGCTAACATGGAAAACTTGGCAGAAACC
GAACAGTTACTTTTCTCATCTTTCAAAACATACTTACAAGCTGAAGAAGA
TCGTTTGAAGGTTTTAAAAAATTTTATGTTGAGAGTGGAGGATGCACAGA
AGAATGTAAACTTGTCAGATGTAGCAAAATATCTGGGAAACCCAATTAAT
ACGTATTTGATGCTTCGGAGATTGAGCTCTGAATGGAGAGATGTCGAATC
GTTTTTATCACAAGATGGCGAGGCTGCTGAAGTTTCCAACTTTTGGATCC
ATGAATATAATCAGGAATTCAGAAGACCATGTGCGTTGAAGAGCCATTTG
TAAGGAGATGCAGTATTTTGGTATAATTTGAAACGAAACGGAATTGGCAA
CCCAAGAACTCGCCATGCTGCTTGTCCCGTACTCGTTGGTACCAAATGGG
CTTTCTGACGTCGAGGCTGGCGGAGCTACAGTTTTTACGGTTGGAAAAAC
CGCTGTCTTTCCAAGCAAGAACAACTTCAGATTGCGAATTACGGTATTGG
TGGCCATTATGAACCTCACTTTGACCACGCACGTGAAGATGAAGATAAAT
TTACTGACCTGGGAATGGGAAACCGAATTGCCACCGTACTTTATTATTTA
AAACGTGCCACGATTCAAGACCCCATCACAGGACAACTGAGACACGCCGA
TTATCGAGTCAGTAAAAGTGCCTGGTTGTCACCGTCCCGCCACGAGTTCG
TACGACAAATCGCTTTGAGAGCGCAATCCGCTACTAATTTGGATATTCGA
TCGTCAGACAAAGAGAGAACTGAAGAAGATGAAATGTTGGTACAAAACAA
ATGATCCAACTCTCATCCTGAAGCCACAAAAATTTGAACGTATTTGGGCT
GATCCTGAAATCTTCATGCTTCGAGATGTAATTACTAATAGACAAATCGA
GCAACTCAAAGAAGAGGCGTACCCTATTAACCGAAAGACAAGCGTATCTT
GGGAAATCTCGAACATTACCGGTATGAACTCCGGGCTTCACAATCGACCG
GGAAGCGCGGTGATCCGGGTACCCTGACTGATGAAGAACTCTACAAGAAC
GCGAAAGGGGGCAGTCAAACTGAAGCGCGTTCGCGGCGTGCATCACTTGG
AGATTACGAGAAATTATGCAGAGGAGAGGTCAGACAACAGAAAGGGAATC
TTCCTGAAGCATTCAAACTAACCAAAGAACTAGCGGCTTTAAGTATTATT
CCTGGAGTCAAAAGCTTGTCCCATCACCTTGAAATTCGTGAGATATATGA
AATTGGTCTACACGCTTACGACAACCAAAATTATCAGTATGCTAGCGAAT
GGATGAGAACCGCATATGAAGAGTTTGGTTTAAACGCTACAATCGACGGA
ATCAAGAGAAATAAAGTGCTCGATTATCTTGCATACTCGGAGTATAAGAT
TTCAAGGCGATTTACGATAATGCAAAAATGGTTCTACCAACAACGGAAGA
CCATGAAGGTGCCATGACTGCTTTATTTCGATTGCAAGACACATACAAAG
TCCCATCCAACATGCTTGCTAAAGATGTGGAAATCATTAGCTCTGGTGTT
AGTTGTATTATGTATTTTGGAACAAGGACAATGTGAAGTTTTCACTTCGA
TGGCTAACATGGAAAACTTGGCAGAAACCGAACAGTTACTTTTCTCATCT
TTCAAAACATACTTACAAGCTGAAGAAGATCGTTTGAAGGTTTTAAAAAA
TTTTATGTTGAGAGTGGAGGATGCACAGAAGAATGTAAACTTGTCAGATG
TAGCAAAATATCTGGGAAACCCAATTAATACGTATTTGATGCTTCGGAGA
TTGAGCTCTGAATGGAGAGATGTCGAATCGTTTTTATCACAAGATGGCGA
GGCTGCTGAAGTTTCCAACTTTTGGATCCATGAATATAATCAGGAATTCA
GAAGACCATGTGCGTTGAAGAGCCATTTGTAAGGAGATGCAGTATTTTGG
TATAATTTGAAACGAAACGGAATTGGCAACCCAAGAACTCGCCATGCTGC
TTGTCCCGTACTCGTTGGTACCAAATGGGCTTTCTGACGTCGAGGCTGGC
GGAGCTACAGTTTTTACGGTTGGAAAAACCGCTGTCTTTCCAAGCAAGAA
CAACTTCAGATTGCGAATTACGGTATTGGTGGCCATTATGAACCTCACTT
TGACCACGCACGTGAAGATGAAGATAAATTTACTGACCTGGGAATGGGAA
ACCGAATTGCCACCGTACTTTATTATTTAAAACGTGCCACGATTCAAGAC
CCCATCACAGGACAACTGAGACACGCCGATTATCGAGTCAGTAAAAGTGC
CTGGTTGTCACCGTCCCGCCACGAGTTCGTACGACAAATCGCTTTGAGAG
CGCAATCCGCTACTAATTTGGATATTCGATCGTCAGACAAAGAGAGAACT
GAAGAAGATGAAATGTTGGTACAAAACAAATGATCCAACTCTCATCCTGA
AGCCACAAAAATTTGAACGTATTTGGGCTGATCCTGAAATCTTCATGCTT
CGAGATGTAATTACTAATAGACAAATCGAGCAACTCAAAGAAGAGGCGTA
CCCTATTAACCGAAAGACAAGCGTATCTTGGGAAATCTCGAACATTACCG
GTATGAACTCCGGGCTTCACAATCGACCGGGAAGCGCGGTGATCCGGGTA
CCCTGACTGATGAAGAACTCTACAAGAACGCGAAAGGGGGCAGTCAAACT
GAAGCGCGTTCGCGGCGTGCATCACTTGGAGATTACGAGAAATTATGCAG
AGGAGAGGTCAGACAACAGAAAGGGAATCTTCCTGAAGCATTCAAACTAA
CCAAAGAACTAGCGGCTTTAAGTATTATTCCTGGAGTCAAAAGCTTGTCC
CATCACCTTGAAATTCGTGAGATATATGAAATTGGTCTACACGCTTACGA
CAACCAAAATTATCAGTATGCTAGCGAATGGATGAGAACCGCATATGAAG
AGTTTGGTTTAAACGCTACAATCGACGGAATCAAGAGAAATAAAGTGCTC
GATTATCTTGCATACTCGGAGTATAAGATTTCAAGGCGATTTACGATAAT
GCAAAAATGGTTCTACCAACAACGGAAGACCATGAAGGTGCCATGACTGC
TTTATTTCGATTGCAAGACACATACAAAGTCCCATCCAACATGCTTGCTA
AAGATGTGGAAATCATTAGCTCTGGTGTTAGTTGTATTATGTATTTTGGA
ACAAGGACAATGTGAAGTTTTCACTTCGATGGCTAACATGGAAAACTTGG
CAGAAACCGAACAGTTACTTTTCTCATCTTTCAAAACATACTTACAAGCT
GAAGAAGATCGTTTGAAGGTTTTAAAAAATTTTATGTTGAGAGTGGAGGA
TGCACAGAAGAATGTAAACTTGTCAGATGTAGCAAAATATCTGGGAAACC
CAATTAATACGTATTTGATGCTTCGGAGATTGAGCTCTGAATGGAGAGAT
GTCGAATCGTTTTTATCACAAGATGGCGAGGCTGCTGAAGTTTCCAACTT
TTGGATCCATGAATATAATCAGGAATTCAGAAGACCATGTGCGTTGAAGA
GCCATTTGTAAGGAGATGCAGTATTTTGGTATAATTTGAAACGAAACGGA
ATTGGCAACCCAAGAACTCGCCATGCTGCTTGTCCCGTACTCGTTGGTAC
CAAATGGGCTTTCTGACGTCGAGGCTGGCGGAGCTACAGTTTTTACGGTT
GGAAAAACCGCTGTCTTTCCAAGCAAGAACAACTTCAGATTGCGAATTAC
GGTATTGGTGGCCATTATGAACCTCACTTTGACCACGCACGTGAAGATGA
AGATAAATTTACTGACCTGGGAATGGGAAACCGAATTGCCACCGTACTTT
ATTATTTAAAACGTGCCACGATTCAAGACCCCATCACAGGACAACTGAGA
CACGCCGATTATCGAGTCAGTAAAAGTGCCTGGTTGTCACCGTCCCGCCA
CGAGTTCGTACGACAAATCGCTTTGAGAGCGCAATCCGCTACTAATTTGG
ATATTCGATCGTCAGACAAAGAGAGAACTGAAGAAGATGAAATGTTGGTA
CAAAACAAATGATCCAACTCTCATCCTGAAGCCACAAAAATTTGAACGTA
TTTGGGCTGATCCTGAAATCTTCATGCTTCGAGATGTAATTACTAATAGA
CAAATCGAGCAACTCAAAGAAGAGGCGTACCCTATTAACCGAAAGACAAG
CGTATCTTGGGAAATCTCGAACATTACCGGTATGAACTCCGGGCTTCACA
ATCGACCGGGAAGCGCGGTGATCCGGGTACCCTGACTGATGAAGAACTCT
ACAAGAACGCGAAAGGGGGCAGTCAAACTGAAGCGCGTTCGCGGCGTGCA
TCACTTGGAGATTACGAGAAATTATGCAGAGGAGAGGTCAGACAACAGAA
AGGGAATCTTCCTGAAGCATTCAAACTAACCAAAGAACTAGCGGCTTTAA
GTATTATTCCTGGAGTCAAAAGCTTGTCCCATCACCTTGAAATTCGTGAG
ATATATGAAATTGGTCTACACGCTTACGACAACCAAAATTATCAGTATGC
TAGCGAATGGATGAGAACCGCATATGAAGAGTTTGGTTTAAACGCTACAA
TCGACGGAATCAAGAGAAATAAAGTGCTCGATTATCTTGCATACTCGGAG
TATAAGATTTCAAGGCGATTTACGATAATGCAAAAATGGTTCTACCAACA
ACGGAAGACCATGAAGGTGCCATGACTGCTTTATTTCGATTGCAAGACAC
ATACAAAGTCCCATCCAACATGCTTGCTAAAGATGTGGAAATCATTAGCT
CTGGTGTTAGTTGTATTATGTATTTTGGAACAAGGACAATGTGAAGTTTT
CACTTCGATGGCTAACATGGAAAACTTGGCAGAAACCGAACAGTTACTTT
TCTCATCTTTCAAAACATACTTACAAGCTGAAGAAGATCGTTTGAAGGTT
TTAAAAAATTTTATGTTGAGAGTGGAGGATGCACAGAAGAATGTAAACTT
GTCAGATGTAGCAAAATATCTGGGAAACCCAATTAATACGTATTTGATGC
TTCGGAGATTGAGCTCTGAATGGAGAGATGTCGAATCGTTTTTATCACAA
GATGGCGAGGCTGCTGAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000107XLOC_000107Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000181-proteinTCONS_00000181-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000181-exon-sc0000001-1575043694:990508..990982TCONS_00000181-exon-sc0000001-1575043694:990508..990982Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1575043694:989930..990055TCONS_00000181-exon-sc0000001-1575043694:989930..990055Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1575043694:988994..989199TCONS_00000181-exon-sc0000001-1575043694:988994..989199Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1575043694:988588..988639TCONS_00000181-exon-sc0000001-1575043694:988588..988639Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1575043694:982370..982581TCONS_00000181-exon-sc0000001-1575043694:982370..982581Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1575043694:981491..981661TCONS_00000181-exon-sc0000001-1575043694:981491..981661Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1575043694:979755..979914TCONS_00000181-exon-sc0000001-1575043694:979755..979914Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1575043694:979006..979133TCONS_00000181-exon-sc0000001-1575043694:979006..979133Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1575043694:978443..978511TCONS_00000181-exon-sc0000001-1575043694:978443..978511Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1575043694:978112..978208TCONS_00000181-exon-sc0000001-1575043694:978112..978208Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1575043694:976137..976340TCONS_00000181-exon-sc0000001-1575043694:976137..976340Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1510915933:990508..990982TCONS_00000181-exon-sc0000001-1510915933:990508..990982Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1510915933:989930..990055TCONS_00000181-exon-sc0000001-1510915933:989930..990055Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1510915933:988994..989199TCONS_00000181-exon-sc0000001-1510915933:988994..989199Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1510915933:988588..988639TCONS_00000181-exon-sc0000001-1510915933:988588..988639Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1510915933:982370..982581TCONS_00000181-exon-sc0000001-1510915933:982370..982581Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1510915933:981491..981661TCONS_00000181-exon-sc0000001-1510915933:981491..981661Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1510915933:979755..979914TCONS_00000181-exon-sc0000001-1510915933:979755..979914Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1510915933:979006..979133TCONS_00000181-exon-sc0000001-1510915933:979006..979133Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1510915933:978443..978511TCONS_00000181-exon-sc0000001-1510915933:978443..978511Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1510915933:978112..978208TCONS_00000181-exon-sc0000001-1510915933:978112..978208Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1510915933:976137..976340TCONS_00000181-exon-sc0000001-1510915933:976137..976340Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1491911889:990508..990982TCONS_00000181-exon-sc0000001-1491911889:990508..990982Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1491911889:989930..990055TCONS_00000181-exon-sc0000001-1491911889:989930..990055Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1491911889:988994..989199TCONS_00000181-exon-sc0000001-1491911889:988994..989199Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1491911889:988588..988639TCONS_00000181-exon-sc0000001-1491911889:988588..988639Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1491911889:982370..982581TCONS_00000181-exon-sc0000001-1491911889:982370..982581Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1491911889:981491..981661TCONS_00000181-exon-sc0000001-1491911889:981491..981661Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1491911889:979755..979914TCONS_00000181-exon-sc0000001-1491911889:979755..979914Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1491911889:979006..979133TCONS_00000181-exon-sc0000001-1491911889:979006..979133Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1491911889:978443..978511TCONS_00000181-exon-sc0000001-1491911889:978443..978511Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1491911889:978112..978208TCONS_00000181-exon-sc0000001-1491911889:978112..978208Clytia hemisphaericaexon
TCONS_00000181-exon-sc0000001-1491911889:976137..976340TCONS_00000181-exon-sc0000001-1491911889:976137..976340Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:976137..990982 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
2.59928 3.00518 1.10933 0.838451 20.3229 14.2195 14.1607 16.0345 11.2795 11.3243 11.2656 6.34456 12.1102 12.7039 16.6191 10.8028 18.9156 16.3359 9.63714 15.7087 8.68095 10.005 9.18925 10.7802 11.1953 15.8997 5.63857 3.31584 12.5066 7.61881
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006620Pro_4_hyd_alph
IPR005123Oxoglu/Fe-dep_dioxygenase
IPR011990TPR-like_helical_dom
IPR013547Pro_4_hyd_alph_N
Vocabulary: Molecular Function
TermDefinition
GO:0005506iron ion binding
GO:0031418L-ascorbic acid binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016491oxidoreductase activity
GO:0005515protein binding
GO:0004656procollagen-proline 4-dioxygenase activity
GO:0016702oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: Cellular Component
TermDefinition
GO:0005783endoplasmic reticulum
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
cellular_component GO:0005783 endoplasmic reticulum
molecular_function GO:0005506 iron ion binding
molecular_function GO:0031418 L-ascorbic acid binding
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
molecular_function GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
molecular_function GO:0004656 procollagen-proline 4-dioxygenase activity
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00000181 vs. Swiss-Prot (Human)
Match: P4HA1 (Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens GN=P4HA1 PE=1 SV=2)

HSP 1 Score: 397.127 bits (1019), Expect = 4.045e-130
Identity = 225/536 (41.98%), Postives = 323/536 (60.26%), Query Frame = 1
Query:  160 VLVVLCILEQGQCE--VFTSMANMENLAETEQLLFSSFKTYLQAEEDRLKVLKNFMLRVEDAQKNVNLSDVAKYLGNPINTYLMLRRLSSEWRDVESFLSQDGEAAEDFKAIYDNAKMVLPTTEDHEGAMTALFRLQDTYKVPSNMLAKGIIPGVKSLSHHLEIREIYEIGLHAYDNQNYQYASEWMRTAYEEFGLNATIDGIKRNKVLDYLAYSEYKKGNLPEAFKLTKELAALKPKDKRILGNLEHYRYELRASQSTGKRGDPGTLTDEELYKNAKGGSQTEARSRRASLGDYEKLCRGEVRQQTKRELKKMKCWYK--TNDPTLILKPQKFERIWADPEIFMLRDVITNRQIEQLKEEAYPILKRATIQDPITGQLRHADYRVSKSAWLSPSRHEFVRQIALRAQSATNLDIRSSEQLQIANYGIGGHYEPHFDHAREDE-DKFTDLGMGNRIATVLYYLSDVEAGGATVFTVGKTAVFPSKGDAVFWYNLKRNGIGNPRTRHAACPVLVGTKWVSNFWIHEYNQEFRRPCAL 1752
            +L++  +L Q       FTS+  M +L  TE+ L +S K Y++AEED+L+ +K +  ++ D   +    D   ++G+P+N + +++RL++EW ++E+ + +D   ++ F +     +   P  ED  GA  AL RLQDTY + ++ ++KG +PGVK  S  L   + +E+G  AY   +Y +   WM  A  +      I  I +  VLDYL+Y+ Y++G+L +A  LTK+L  L P+ +R  GNL+++ Y +   +   K       +D++     KG +      R+     YE LCRGE  + T R  KK+ C Y     +P  IL P K E  W  P I    D+I++ +IE +K+ A P L+RATI +PITG L    YR+SKSAWLS   +  V +I +R Q  T LD+ ++E+LQ+ANYG+GG YEPHFD AR+DE D F +LG GNRIAT L+Y+SDV AGGATVF     +V+P KG AVFWYNL  +G G+  TRHAACPVLVG KWVSN W+HE  QEFRRPC L
Sbjct:    5 ILIIGILLPQSLAHPGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKL-DRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKD--MSDGFISNLTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSF-LTAEDCFELGKVAYTEADYYHTELWMEQALRQLD-EGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQ-SDQKTTPKKKGVAVDYLPERQK----YEMLCRGEGIKMTPRRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRLRRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTL 530          
The following BLAST results are available for this feature:
BLAST of TCONS_00000181 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
P4HA14.045e-13041.98Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapie... [more]
back to top