Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000177 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000177
Unique NameTCONS_00000177
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3500

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000177 ID=TCONS_00000177|Name=TCONS_00000177|organism=Clytia hemisphaerica|type=transcript|length=3500bp
TAGAAATTTGTTTggcgaaaattttaaatttttcttaaaaatggtCTATA
GTTTGCGATCGAGAACTGATGAAACAACTTTCGAGCAACAAAATATTACG
ACAAATAACGATGCTTATAATATTTATAACGACTGTAGTTACGAGAATGA
AAATTACGACAACGAGAGTGAAATTTACGATGACAATAACAATAATCGGT
GTGAATCTCCAACTTACGAGAATGGATACATGTTCCGTAAACAACCATTA
ACGACAACTTACGACAATTTTACGACCAATCTACCAACTGGTATTATTAA
ACCGATCCCTGTCACTCGTAAGCCCGAAATCGAAACGAGTATCGAGAAAC
CGACGACAAGATTTCGAGCAAGGATTCACAGTGTCGATGATATACTTGAT
CTATCACCGAAACTTAAAACACCGACAGATTCGGTAACTTTCGTTTTCAA
TAACGGTCAGTCTAACACCGTCTTTAAGGAGAAAACTCGCAACCGTAAAA
AAGTCGTAACTCGAGTTCCACGTGTGACACGACGACAAACGACGACAGCT
TTTGTTAAGCCACGACAATCGAAACGAATTTCTCCCAACAAAGACGATGA
AGaCCCTGGAGGTGTCAACCAGCTCGGCGGCGTATTTGTCAATGGCCGCC
CATTACCCGATTATATGCGCCATCGCATTATCGAACTCGCACAATGTGGT
GTCCGCCCTTCCGAGATTTCACGCCAACTACTTGTTTCCCACGGATGTGT
CAGTAAAATATTGGGGCGATATTATGAAACCGGATCTGTCCGCCCGGGTG
CGATTGGCGGCAGTAAACCGAAAGTCGCAACGCCTAAAGTTGTTCATCGA
ATTGTTAAACTTAAAGAAGAGAACCCGTGCATGTTTGCGTGGGAAATAAG
GAACTCATTATTAGCGGAAGGTATATGTGACAACGGGAACGTGCCTTCCG
TGAGTTCTATAAATAGAATATTACGTAATCACGCAGCCGAAAAAGAGACT
AAGGAAGCAAAAATGAAACAAGAAGagcttcaaaaacaaaacggtTTCGG
AATGcttaataatttcaatttcggTAATTTCGCTACCGCACCTTTTAATG
GACTTAATACGATAACGGGGACTCAAGACGCCGCTACAAATGCGGCCGCG
GCTAACGCCGCTTATAGCCAGTTTCCGTTTTTTAATACGTCATTTCCGAT
TCTAACGGGCCCTCTTCAACAGCAAACTACCGCACAACAGTTATTGTCTT
TACCGTTAAATCAAATGTCGCCGGAACGCAAATTTAAGACGCCGACAAAT
GACGGAGTGTCGTATCAAACAATAGACGACACAACCGGGAATCCCTTCCA
CGACCATTTACAAGGTTCCGTTGTTACGTCAGCTGCCATAAGCGATTACG
CACAAGTTCTGAGTGAAGAGTCACTACGGTCGACCGGGGAACCGGACCTA
CATACCGGACACGCCCAACATCAACAACAACATCAAGTGAAGGATATATC
ACCGAACTCTTCAGTGTTAGTTGATGACCATCATCATCACAGGAATGACC
TATTGTTATCCAAAGAAGACCATACGAAACTTATCCAACACTTAGAGCAG
GGAAGTAATCAACTCGGAGCAGCTAACCACCAAGATGGACCCTCCAATCT
CACTCATGTCGACCCTACCGGCCTCTNCTTATCCAACACTTAGAGCAGGC
AAGTAACCAACTCGGAGCAGCTAACCACCAAGATGGACCCTCCAATCTCA
CCCATGTCGACCCTACCGGCCTCGTAGCGCCGCATCAACATCAACAACAA
ACACACAGAAAGAAAAGATCGTTAGAAATATCACCGACAAAGTCAGACTC
CAGTAAAGAGGAGaataataatttgaagccaGGAAATTCTTTGATGAGTG
AACAAATGAGTCCTGATATGAAAAGACGACGATTTGCAAGTGAAAGTCCT
GTTTCATCTGACATGTTGACACAGAAGATTTCACCCACATGGTATAAATA
TGGCGCAATGTTCCCTGGCAACGGTAACCTAGTCAACGTAAACAACATGA
ACGCACTTAATCAAATCAACAATTCACTCGGTGCCNTGGCAACGGTAACC
TAGTCAACGTAAACAACATGAACGCACTTAATCAAATCAACAATTCACTT
GGTGCCTTCAATAATCTTGGACAATTTTCAAATAATGTTAACGGGATTAA
CGGATTAACGACTCTAAACGCATATGCTAACAACGTAGCCGCCCTTAACG
CCATGACGTCGATGGCGGTGAACGGGAATACGCTAAATGGGTTGAATTTA
CAGAACTTGAATAATCAAGGCGTGACCGGTTTTACGCCCACCTTTGATGG
CGAACGGTCGCTTGGTAATAGTTTGAATAATATATCGAATAATGATTTCG
GTGGATGGCCGAATAATTTTGTCGGGATTTTATCGGATTCGCCGTCGTCT
TATCAACAAAATGGCGGCAATATTGGGTCTGGGAAtaattcaaatcaaat
caatccCTCGTTTGGATTGAATATGTCCTTCACGCCCACGTCGAAAAATT
TAATACAAGGACTTACGAATTCTACGTCGCCGACAAGTGCTTTGTCGAAT
TTGTTACCAGGGcaacaaaacttttttatacAAAACAGTCCGCAAATGAG
TGGAACGGGAAATGGTAGCGGAGTAGCGAATGTAAATCAAAATGGTGGTG
GCGGTTACCAACAACAACAAACGCAACAACAAGAtgttttaagtttaaaa
atgaTGTCATCGCCAAGTTTGCTTATGCGAAATACGAATGTTAATGTCGG
CAACTAAAAACCGAGAAACGACGGGTGTTTCTCTTGAATTATAATAAGAG
TTGACCCTTTTTAGACTGCGATTTACGTTTTGTGTATTTTTATACAAGAT
TGTGTTATGCTTTCGCGTAAAAGAAAGCTTGTGTGAAGTTTTTTTCGTTT
GTTTATGTACTtcaatgtaaacaattttgaatCTTCGTTTTTTTTACCGA
GTGACCATTGTTGTGTGTTAAAGTCCATTTTTGTTTGTCTAAAGGCTGGT
CTCCGCTTGTGCgtcttccacgctattggtcaaaggaaaaatgaaacaat
tccattggcgcgatctgacgtaacgttccaaaaaagttgaaatgtagtca
actttcttttcaagcgcgcactacatttttatgacgtaatcttttttaca
agcaaaattgattgaagccaaaaggtacaatcgcagcgcgcgcaagcaGA
GACCGCCTTAAGGGATTCGTAATCGTATAGTGTCGGAAAACTACTAGATG
GTTTTTAATGTTGTGATAAATTGTGTTTTGCGGTATCTGTATTGTTGAGC
ATGACTGACATTAGAAACATAGAAAGAATATAAATTCtatatttttgtac
atttttgaagacttttatcaaaatattagtaaaaatatatacacCAGTTT
TACTTTCATAACATTTATATACAGCATAAGAGAAAATTTCTTGAACTTAA
Run BLAST on NCBI

transcript from alignment at sc0000001:816700..823905-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000177 ID=TCONS_00000177|Name=TCONS_00000177|organism=Clytia hemisphaerica|type=transcript|length=7206bp|location=Sequence derived from alignment at sc0000001:816700..823905- (Clytia hemisphaerica)
TAGAAATTTGTTTGGCGAAAATTTTAAATTTTTCTTAAAAATGGTCTATA GTTTGCGATCGAGAACTGATGAAACAACTTTCGAGCAACAAAATATTACG ACAAATAACGATGCTTATAATATTTATAACGACTGTAGTTACGAGAATGA AAATTACGACAACGAGAGTGAAATTTACGATGACAATAACAATAATCGGT GTGAATCTCCAACTTACGAGAATGGATACATGTTCCGTAAACAACCATTA ACGACAACTTACGACAATTTTACGACCAATCTACCAACTGGTATTATTAA ACCGATCCCTGTCACTCGTAAGCCCGAAATCGAAACGAGTATCGAGAAAC CGACGACAAGATTTCGAGCAAGGATTCACAGTGTCGATGATATACTTGAT CTATCACCGAAACTTAAAACACCGACAGATTCGGTAACTTTCGTTTTCAA TAACGGTCAGTCTAACACCGTCTTTAAGGAGAAAACTCGCAACCGTAAAA AAGTCGTAACTCGAGTTCCACGTGTGACACGACGACAAACGACGACAGCT TTTGTTAAGCCACGACAATCGAAACGAATTTCTCCCAACAAAGACGATGA AGGTAAATGACTAAATTCGTTTTTTTATAAGAACAAACTATATAAGAACA TTAATTCTCGATGGCTGATATCAAGAATCAAAAAAATCAAAAAATTTTCT TCTAAGCAATGAAGGCCTATACTAATATTAGCCCTGTTTAAGATTTGGTG AAAAGATTAATCTCATTTTTACATACAATACACTGGTTTAGCTTTAATTG ACATCTGATCGATGTTGAGCATGAAACGGTTCTAATCTAATCAACATTTT TGAGATTTTGAGAGGATGTTTCTTATTGTGAAGATTGAAAATAAGTTATA CTTTTTTGATTAATTTTGTAATAAACTTTGCTGAGTGATGGGCTAGAGAG CATGAGCTCTAAGCATGAGGCCCTCAGCAGTTGGCATGATGGCGTTCTGT GATTTCAAAAAGCATGACACGTGATTGAGTATAAGAATTATTTTGTTTTG GATGATGGAGAAAAATTTCGGTGTGATCGTCTGGTTGTCGTGATGACGTG ATCATAGCTTGTGTCTGACTTTTTTAGGCCTAAAATAAGCACTCTCATAA ATCAGTCAAACTCTCCCTCTTCAAACAAATAATTTACGTTCTTTGTGTTC CAGTTACTTGAAGAGGTTTTTCAGGGTTTTTCCAACGTTTGAAATTAAAG AGGCGATACCTTCGAAAGTTTACTTCCATTATGGCGTAAGTTACGTAACT TAGTCAACTAGAAAGACATCTTTACTTCATCTTTATTTTGAGTATATTAA ACAAATTCTGAGTACGGAGAAGCCTGGGTCCTAGTCAGAAAATCTGCCGT ATACTATCTTCGCTTTCTGGTGTGAATGATGGCACTACTTCCCCCCCCCN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNCTTCTTTCCCCCCCCCCCATCAGAATTTTTAAAGGC AAAAAGTAGTTGAACTCTAGCTTCTGGACTACCTCGGTTCTGGTTTTCTT AGTGAAAAAAACCTGCACACAAATTTAAAAGAAATCGTATGAATGACTTA CCTTGCTGATTTAATCTATGAATTTGTGTTGTCGGTTCGACATTCTGTGT TCCTCGTTGTCGATTCCCTGTAAAGAAAAACAAAATAATTAGAGTCGAAT CTTTATACCTTATCGGCCCTATTTACGCCGGCCCTTATTGGCGTTATTTT TTGGCACGTGGCGTAATAAGAGCTGGCGTAAAAAGGGCCAAGATTTTTCA ATTTTTAGCTAAAAGTGGCGTTAATCTTCGATCATCATTTTTCAACTTAA AGGATTTTAGGTATGATTCGAAGACAAAAATTATCCATTGTTTTACTCCA TATCTAAACCAGTGATTTTGAATGGAATTTTCAATAATTTACTACCGAAA CATGATATTTCAATATAAATTTTAAACATTATTCAGCATTATTTACTAAT TTGAAGCATTAGTAGCCATTTTTACAAATTTTGGCGTTATTAACGGTCCT GATTGGCGTAAGGCCAAAATTGGCCTCTGGCGGAATAAGGGCCGACGTAA AAGGGGCCGGCGTTAAGTTAGGGCCGACGTAAAAATGGCCGATAAGGTAA CTCCAACACGTACGGAAAACTCTTAATTTGTTTAAGTTATAGAAATTTCG AGTTAGGGAGTAAGTTTTATAAGGTATTGTTAATTGAAGGGACAAGAAAA ATTGAGATGAGTAAATCAAATGGGATGTCTGATTTGTTATTGAGCTTCTT TTAATTTTCCACATTGTACTACGCGTTTGACCTTTAGATTAAACAAAAAT GTACGTCTAGTAGAGAGTGAGTTTCTTAGCCACATGCTTACTGGGCCAGC GAATTTCAAAATACCTTTTTCGTAGTAAAAGTATTCCAGAAGAAATTGAC TCCTTAAAAAACTGCATTTTAAAAAGGTCGTCCCGTTAATCACTATTGAA GTATCTCAATGATTNACTGCATTTTAAAAAGGTCAACTCCGTTAATCACT ATTGAAGTATTTCAAATGATGTTTTGTTTATCTTTTTAGACCCTGGAGGT GTCAACCAGCTCGGCGGCGTATTTGTCAATGGCCGCCCATTACCCGATTA TATGCGCCATCGCATTATCGAACTCGCACAATGTGGTGTCCGCCCTTCCG AGATTTCACGCCAACTACTTGTTTCCCACGGATGTGTCAGTAAAATATTG GGGCGATATTATGAAACCGGATCTGTCCGCCCGGGTGCGATTGGCGGCAG TAAACCGAAAGTCGCAACGCCTAAAGTTGTTCATCGAATTGTTAAACTTA AAGAAGAGAACCCGTGCATGTTTGCGTGGGAAATAAGGAACTCATTATTA GCGGAAGGTATATGTGACAACGGGAACGTGCCTTCCGTGAGTTCTATAAA TAGAATATTACGTAATCACGCAGCCGAAAAAGAGACTAAGGAAGCAAAAA TGAAACAAGAAGAGCTTCAAAAACAAAACGGTTTCGGAATGCTTAATAAT TTCAATTTCGGTAATTTCGCTACCGCACCTTTTAATGGACTTAATACGAT AACGGGGACTCAAGACGCCGCTACAAATGCGGCCGCGGCTAACGCCGCTT ATAGCCAGTTTCCGTTTTTTAATACGTCATTTCCGATTCTAACGGGCCCT CTTCAACAGCAAACTACCGCACAACAGTTATTGTCTTTACCGTTAAATCA AATGTCGCCGGAACGCAAATTTAAGACGCCGACAAATGACGGAGTGTCGT ATCAAACAATAGACGACACAACCGGGAATCCCTTCCACGACCATTTACAA GGTTCCGTTGTTACGTCAGCTGCCATAAGCGATTACGCACAAGTTCTGAG TGAAGAGTCACTACGGTCGACCGGGGAACCGGACCTACATACCGGACACG CCCAACATCAACAACAACATCAAGTGAAGGATATATCACCGAACTCTTCA GTGTTAGTTGATGACCATCATCATCACAGGAATGACCTATTGTTATCCAA AGGTAATTCACAAATGAGTTTTAAATCTGTTTTAATTCGCACGTGTTATA TGCACCAAAAATCATGTAAACAAAGTTTCTACATTATCGTCAACATGAAA AGTATGGGCAATCTGACTGGGTCAAAACGCGTACCATACATAAATGCTGT TTTTCATATTGTACCGTACAAATACAAGACTGTGTTCAAAAAAGGGGTCT GGTAAGCGAGAGATTGTATTTTGCACAATTCTATGGTTAGAAATGTTTTC TTTTCACTTGCCGAATTCTAACGGTTCAGAGTTCCGAGTTCGTACATAAA TCGCTAAATTAAAGCACTTAAGATTAATTTCCAGTTTTAAGATCTTGAAG AAACATTATAATAGTAAAGTCTGTCTCAATATAAATTGCAGCGGAGACAA AAAAGACTATAACTTTTGATAGAATTCGAATTTTAGATAGCAGTTTTTTC GCTTGTTGAAAAGACAAACAGGAGTGGAATATTATCATGAAGAAAAAACT TAAAAAATATCGGAAAATGAAGATTGAAAATTAAGAAGAAGAAAATCAAC TTCTTCAATAATCGTCCTATAATTATCATTTTTACATCAAAGAGATTTGT TCCATCGAAAGATACAGTTCAAAATTTATCACTGATTGACTTCAAAAACC ATCAAAAACAACAAAAAAGAGCCCTTTTCAAGTTAACCAGGGCAAAGTTT TAAGCTTTATTTTTTGACTGAATGAAAGTTTAATGAATTTTTCTTTCGCA TTTATGACGTTCTAAGATTAAAGAATTTCTGATATAAAAATTAAGATCAT AGCATTGTTTTACGAGAAGCTGAGTTCTTCTTCATTTTTCATCTTCGTTT TTCGATCTTTTAATTTATTTATCATATTCGAATTCTATCAAAAGTTATAG CCTTTTTTGTCTCCGCTGCAGGTTATATTGGGACAGACTAATAATATAGA GACAGACAGAATAATATCGTATCAAATTATAAGAAATCTTTTAACTTTCG TGAAATATCATTCAATCATCTGCCTCTTTAATTTCAGAAGACCATACGAA ACTTATCCAACACTTAGAGCAGGGAAGTAATCAACTCGGAGCAGCTAACC ACCAAGATGGACCCTCCAATCTCACTCATGTCGACCCTACCGGCCTCTNC TTATCCAACACTTAGAGCAGGCAAGTAACCAACTCGGAGCAGCTAACCAC CAAGATGGACCCTCCAATCTCACCCATGTCGACCCTACCGGCCTCGTAGC GCCGCATCAACATCAACAACAAACACACAGAAAGAAAAGATCGTTAGAAA TATCACCGACAAAGTCAGACTCCAGTAAAGAGGAGAATAATAATTTGAAG CCAGGAAATTCTTTGATGAGTGAACAAATGAGTCCTGATATGAAAAGACG ACGATTTGCAAGTGAAAGTCCTGTTTCATCTGACGTAAGTGTGATATTAA ATTTTATTGCTTTTGAAAGTAATTCCTGATAGACTCTTTTCATAAATTAC GTCACGAACATCACTTGCCTTGTTTTGAAATTATTGCCATGCATAGCAGG CCATATTTTAGAAAGGCAAGGCAGCTTTCGTTGGTGGCCAAAAAGGGCAC TTTTTCTTATGTTTTTCCACTAAAAAGGCTGTTTTTATCAAAATTTTAGT AATTTCAAGAGGGACAGCGTCCGATAGCCGGACGCTTAAAGGGCATGAAA GATGGCCTGCATAGTGATTAACTCCCAGCAGATTTTATTACGAGTTTGGT CAGAAAGGGAAACAATTTTTTGTTAGGAAACAATAGTGAGACACTGTCCT GGTATGAAATAAAGTATGTGTCTGATATGAAACGGGAACATTATGTAAAA ATAAAACCTTTAAAGTGGTCAACGAACCCACGACACTTTCTTTTACTCTC AGTCAGTTTAGTTATCGACAATCTACCTAGAAAAGTCTGAGAAATCTTTC TTCAAAAGCACCCATGTTTTTATTTTGAAATTCGTAAAATCCTTTTAAAA CTTTTTTCTTTACTCTAGATGTTGACACAGAAGATTTCACCCACATGGTA TAAATATGGCGCAATGTTCCCTGGCAACGGTAACCTAGTCAACGTAAACA ACATGAACGCACTTAATCAAATCAACAATTCACTCGGTGCCNTGGCAACG GTAACCTAGTCAACGTAAACAACATGAACGCACTTAATCAAATCAACAAT TCACTTGGTGCCTTCAATAATCTTGGACAATTTTCAAATAATGTTAACGG GATTAACGGATTAACGACTCTAAACGCATATGCTAACAACGTAGCCGCCC TTAACGCCATGACGTCGATGGCGGTGAACGGGAATACGCTAAATGGGTTG AATTTACAGAACTTGAATAATCAAGGCGTGACCGGTTTTACGCCCACCTT TGATGGCGAACGGTCGCTTGGTAATAGTTTGAATAATATATCGAATAATG ATTTCGGTGGATGGCCGAATAATTTTGTCGGGATTTTATCGGATTCGCCG TCGTCTTATCAACAAAATGGCGGCAATATTGGGTCTGGGAATAATTCAAA TCAAATCAATCCCTCGTTTGGATTGAATATGTCCTTCACGCCCACGTCGA AAAATTTAATACAAGGACTTACGAATTCTACGTCGCCGACAAGTGCTTTG TCGAATTTGTTACCAGGGCAACAAAACTTTTTTATACAAAACAGTCCGCA AATGAGTGGAACGGGAAATGGTAGCGGAGTAGCGAATGTAAATCAAAATG GTGGTGGCGGTTACCAACAACAACAAACGCAACAACAAGATGTTTTAAGT TTAAAAATGATGTCATCGCCAAGTTTGCTTATGCGAAATACGAATGTTAA TGTCGGCAACTAAAAACCGAGAAACGACGGGTGTTTCTCTTGAATTATAA TAAGAGTTGACCCTTTTTAGACTGCGATTTACGTTTTGTGTATTTTTATA CAAGATTGTGTTATGCTTTCGCGTAAAAGAAAGCTTGTGTGAAGTTTTTT TCGTTTGTTTATGTACTTCAATGTAAACAATTTTGAATCTTCGTTTTTTT TACCGAGTGACCATTGTTGTGTGTTAAAGTCCATTTTTGTTTGTCTAAAG GCTGGTCTCCGCTTGTGCGTCTTCCACGCTATTGGTCAAAGGAAAAATGA AACAATTCCATTGGCGCGATCTGACGTAACGTTCCAAAAAAGTTGAAATG TAGTCAACTTTCTTTTCAAGCGCGCACTACATTTTTATGACGTAATCTTT TTTACAAGCAAAATTGATTGAAGCCAAAAGGTACAATCGCAGCGCGCGCA AGCAGAGACCGCCTTAAGGGATTCGTAATCGTATAGTGTCGGAAAACTAC TAGATGGTTTTTAATGTTGTGATAAATTGTGTTTTGCGGTATCTGTATTG TTGAGCATGACTGACATTAGAAACATAGAAAGAATATAAATTCTATATTT TTGTACATTTTTGAAGACTTTTATCAAAATATTAGTAAAAATATATACAC CAGTTTTACTTTCATAACATTTATATACAGCATAAGAGAAAATTTCTTGA ACTTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000105XLOC_000105Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000177-exon-sc0000001-1575043694:823304..823905TCONS_00000177-exon-sc0000001-1575043694:823304..823905Clytia hemisphaericaexon
TCONS_00000177-exon-sc0000001-1575043694:820254..821216TCONS_00000177-exon-sc0000001-1575043694:820254..821216Clytia hemisphaericaexon
TCONS_00000177-exon-sc0000001-1575043694:818822..819218TCONS_00000177-exon-sc0000001-1575043694:818822..819218Clytia hemisphaericaexon
TCONS_00000177-exon-sc0000001-1575043694:816700..818237TCONS_00000177-exon-sc0000001-1575043694:816700..818237Clytia hemisphaericaexon
TCONS_00000177-exon-sc0000001-1510915933:823304..823905TCONS_00000177-exon-sc0000001-1510915933:823304..823905Clytia hemisphaericaexon
TCONS_00000177-exon-sc0000001-1510915933:820254..821216TCONS_00000177-exon-sc0000001-1510915933:820254..821216Clytia hemisphaericaexon
TCONS_00000177-exon-sc0000001-1510915933:818822..819218TCONS_00000177-exon-sc0000001-1510915933:818822..819218Clytia hemisphaericaexon
TCONS_00000177-exon-sc0000001-1510915933:816700..818237TCONS_00000177-exon-sc0000001-1510915933:816700..818237Clytia hemisphaericaexon
TCONS_00000177-exon-sc0000001-1491911889:823304..823905TCONS_00000177-exon-sc0000001-1491911889:823304..823905Clytia hemisphaericaexon
TCONS_00000177-exon-sc0000001-1491911889:820254..821216TCONS_00000177-exon-sc0000001-1491911889:820254..821216Clytia hemisphaericaexon
TCONS_00000177-exon-sc0000001-1491911889:818822..819218TCONS_00000177-exon-sc0000001-1491911889:818822..819218Clytia hemisphaericaexon
TCONS_00000177-exon-sc0000001-1491911889:816700..818237TCONS_00000177-exon-sc0000001-1491911889:816700..818237Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:816700..823905 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.0959572 0 0.0712679 8.0283 8.11385 13.2258 12.8301 3.39408 2.5322 6.56681 3.5907 4.61294 2.75618 5.40129 10.6865 4.14623 5.29781 0 0 3.44208 3.15945 0.352248 1.21873 2.55177 3.37584 0.136128 0.130019 0 0
Blast
BLAST of TCONS_00000177 vs. Swiss-Prot (Human)
Match: PAX2 (Paired box protein Pax-2 OS=Homo sapiens GN=PAX2 PE=1 SV=4)

HSP 1 Score: 211.075 bits (536), Expect = 5.989e-59
Identity = 98/123 (79.67%), Postives = 108/123 (87.80%), Query Frame = 2
Query:  608 GGVNQLGGVFVNGRPLPDYMRHRIIELAQCGVRPSEISRQLLVSHGCVSKILGRYYETGSVRPGAIGGSKPKVATPKVVHRIVKLKEENPCMFAWEIRNSLLAEGICDNGNVPSVSSINRILR 976
            GGVNQLGGVFVNGRPLPD +R RI+ELA  GVRP +ISRQL VSHGCVSKILGRYYETGS++PG IGGSKPKVATPKVV +I + K +NP MFAWEIR+ LLAEGICDN  VPSVSSINRI+R
Sbjct:   18 GGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIR 140          
The following BLAST results are available for this feature:
BLAST of TCONS_00000177 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PAX25.989e-5979.67Paired box protein Pax-2 OS=Homo sapiens GN=PAX2 P... [more]
back to top