Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000175 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000175
Unique NameTCONS_00000175
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2085

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000175 ID=TCONS_00000175|Name=TCONS_00000175|organism=Clytia hemisphaerica|type=transcript|length=2085bp
AAACGCTGTAGCACAAGAATTGGTTAAGAGACGATTCTTTAAAAAGTTAT
TATTCTACTGTGTTTTCGAAGTTTTCAATTCTCCTTCCTGCTATTCACAA
TTACAGTAGTTTGTTTTTTGTATCGTTTCAGAATGTTAGAacatgaaaag
aaaagaatcttcaactgacaataacaataaaaaacacCACAGTGAAGTAA
TGGAATGTGAAACACTGgaaaatccaaagaaaaaaatccaaaaacaagAT
CCTATACAAAAGGAACAAAAATATGATCGGCAATTACGTTTATGGGGGAA
TGATGGCCAAACAGCATTGGAGAATGCTCGGATTTGCTTGATTAATGCTA
CAGCAACGGCAACCGAAACTTTAAAATGTCTTGTTTTACCAGGAATTGGT
AAATTTTACATTGTGGATGATCATTTGGTCAATGATGACGATCTAAGTAG
TAATTTCTTTGTTGATCCCGAATCTATTGGGAAACCACGTGCTAAAGTAG
CCTGTGAGTTGCTTCAAGAGTTGAATCCAGATACCAGTGGTAATTGGATT
AAAGAGAATGCGGCAAACCTGTTAGATAATGACCCAGAATTTTACCGTAA
ATTTACCGCAGTTATTTGCTCACGCGTTTCAGAACATGATTTATTGAAAC
TCAGTCATTATTTTTGGGAACATGATATTCCGTTATTTATTGTGGACAGT
GTTGGAATGTTTGGTTATTTAAGATTGGTTTACAAAGAGCATGTCATCAT
TAAAGCACATCCTGATAATACTCATTCCGATTTGAGATTAGAAAGCCCTT
GAACGGTGGCAAGAACAAACAGATCAAAAATGGCccaaaaattacaaaga
aaaatgccaaattaaagaaattgtgaGAAGTTTAAACTTGAAAAACGAGG
ATGGCGTTCCTGTGCATGAAGAGAATTTTGAAGAAGCGTTGACAAATGTG
AATAATGTTTTTTCTGGTACGTTTGTACCATCTGATGTTCGTAACGTTCT
TGATAATCCAATGGCTGATCATCCCCTCCAATCTGCAAACAATTCAAAAT
TCTGGATTCTCGTTAGAGCTCTCAAAGAGTTTGTTAACCAGAGTGGTACA
CTACCTTTACGTGGCTCTTTACCAGACATGTTCTCAGATTCGAAACGCTA
TATTGAGTTACAGAACGTTTATAAAACTAAAGCTGAAAGTGATATACAGA
AAGTGACCGATCTTGTTCGAGAATCATTAGAAGACCTCCAAAGGTCTTTG
AGTTTTATTCAACCTGACGAGATCCAAACGTTCTGTAAAAACGCTGCGTT
TATTCAAGTGCAGTATGGGCTCTCCTATCACGACGAGATTCGTCAGAATT
TAGCAGAGCATAAAATCAAAGACACCCTTGAACAATATCAAGAAAATGGA
GCTAGCTTGTATCTAGCCTTCCGTACATTACATTCATCCCTTGACCAACA
AGCACCTAAAGATTTAATCTCTTTGTCATCTGTCACTGAAAACGTCATGA
AAAGCTGTTTGTTAGAAGAGTTTGAATCACCTTTAAACATTTTAGAAGAA
ATGTTACGTTCAGACCTCTCTGAATTCCACCCTATGGCGGCTGTGATGGG
TGGAATAAGCGCCCAAGAGGTCATTAAAATGATCACAGGGCAATTTGTTC
CTGTCAATAATGTTTTGTTGGTTAATAGTGTGGAATCTCAAACTGTGACA
ATGAAACTTTAGAAATAGTACTTGAAATAATGTTTATATTTCGGTGGGTT
TTTAAAAACTCTTGTGTAAGTTCTTGTCTTGTTTGTGTAGAATTTTTAAA
GTCACCTTTAGTTTCTATTAACAGGATCACCCAGTCAAGTTAACAATCAA
CTTAGTTTGGAGcagaaaatttatcattttgggGGACCTTTTTCACAGAA
GTTAGGTCCCATATTCGGGACATCAATTTCGACTGTCATCTTTGgcaatt
tttcattgaaatttcttTCGTAGGGTTATTTTAATTCGTAGtatttaacc
ctttgagtgccagggtccttttttctaagttttttttaaaaaatcgctag
ttcaaactttaagggcttatatctcctgatctaga
Run BLAST on NCBI

protein sequence of TCONS_00000175-protein

>TCONS_00000175-protein ID=TCONS_00000175-protein|Name=TCONS_00000175-protein|organism=Clytia hemisphaerica|type=polypeptide|length=233bp
MADHPLQSANNSKFWILVRALKEFVNQSGTLPLRGSLPDMFSDSKRYIEL
QNVYKTKAESDIQKVTDLVRESLEDLQRSLSFIQPDEIQTFCKNAAFIQV
QYGLSYHDEIRQNLAEHKIKDTLEQYQENGASLYLAFRTLHSSLDQQAPK
DLISLSSVTENVMKSCLLEEFESPLNILEEMLRSDLSEFHPMAAVMGGIS
AQEVIKMITGQFVPVNNVLLVNSVESQTVTMKL
Run BLAST on NCBI

transcript from alignment at sc0000001:754747..756932-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000175 ID=TCONS_00000175|Name=TCONS_00000175|organism=Clytia hemisphaerica|type=transcript|length=2186bp|location=Sequence derived from alignment at sc0000001:754747..756932- (Clytia hemisphaerica)
AAACGCTGTAGCACAAGAATTGGTTAAGAGACGATTCTTTAAAAAGTTAT TATTCTACTGTGTTTTCGAAGTTTTCAATTCTCCTTCCTGCTATTCACAA TTACAGTAGTTTGTTTTTTGTATCGTTTCAGAATGTTAGAACATGAAAAG AAAAGAATCTTCAACTGACAATAACAATAAAAAACACCACAGTGAAGTAA TGGAATGTGAAACACTGGAAAATCCAAAGAAAAAAATCCAAAAACAAGAT CCTATACAAAAGGAACAAAAATATGATCGGCAATTACGTTTATGGGGGAA TGATGGCCAAACAGCATTGGAGAATGCTCGGATTTGCTTGATTAATGCTA CAGCAACGGCAACCGAAACTTTAAAATGTCTTGTTTTACCAGGAATTGGT AAATTTTACATTGTGGATGATCATTTGGTCAATGATGACGATCTAAGTAG TAATTTCTTTGTTGATCCCGAATCTATTGGGAAACCACGTGCTAAAGTAG CCTGTGAGTTGCTTCAAGAGTTGAATCCAGATACCAGTGGTAATTGGATT AAAGAGAATGCGGCAAACCTGTTAGATAATGACCCAGAATTTTACCGTAA ATTTACCGCAGTTATTTGCTCACGCGTTTCAGAACATGATTTATTGAAAC TCAGTCATTATTTTTGGGAACATGATATTCCGTTATTTATTGTGGACAGT GTTGGAATGTTTGGTTATTTAAGATTGGTTTACAAAGAGCATGTCATCAT TAAAGCACATCCTGATAATACTCATTCCGATTTGAGATTAGATTGCCCGT TTCCGGAGCTAGTTGATTATTTCAATAAAATGGACTTATCTACTATGGAT AATCTGGAGCATTCACACACACCATTCCTTGTGGTTCTTTACAAAGCCCT TGAACGGTGGCAAGAACAAACAGATCAAAAATGGCCCAAAAATTACAAAG AAAAATGCCAAATTAAAGAAATTGTGAGAAGTTTAAACTTGAAAAACGAG GATGGCGTTCCTGTGCATGAAGAGAATTTTGAAGAAGCGTTGACAAATGT GAATAATGTTTTTTCTGGTACGTTTGTACCATCTGATGTTCGTAACGTTC TTGATAATCCAATGGCTGATCATCCCCTCCAATCTGCAAACAATTCAAAA TTCTGGATTCTCGTTAGAGCTCTCAAAGAGTTTGTTAACCAGAGTGGTAC ACTACCTTTACGTGGCTCTTTACCAGACATGTTCTCAGATTCGAAACGCT ATATTGAGTTACAGAACGTTTATAAAACTAAAGCTGAAAGTGATATACAG AAAGTGACCGATCTTGTTCGAGAATCATTAGAAGACCTCCAAAGGTCTTT GAGTTTTATTCAACCTGACGAGATCCAAACGTTCTGTAAAAACGCTGCGT TTATTCAAGTGCAGTATGGGCTCTCCTATCACGACGAGATTCGTCAGAAT TTAGCAGAGCATAAAATCAAAGACACCCTTGAACAATATCAAGAAAATGG AGCTAGCTTGTATCTAGCCTTCCGTACATTACATTCATCCCTTGACCAAC AAGCACCTAAAGATTTAATCTCTTTGTCATCTGTCACTGAAAACGTCATG AAAAGCTGTTTGTTAGAAGAGTTTGAATCACCTTTAAACATTTTAGAAGA AATGTTACGTTCAGACCTCTCTGAATTCCACCCTATGGCGGCTGTGATGG GTGGAATAAGCGCCCAAGAGGTCATTAAAATGATCACAGGGCAATTTGTT CCTGTCAATAATGTTTTGTTGGTTAATAGTGTGGAATCTCAAACTGTGAC AATGAAACTTTAGAAATAGTACTTGAAATAATGTTTATATTTCGGTGGGT TTTTAAAAACTCTTGTGTAAGTTCTTGTCTTGTTTGTGTAGAATTTTTAA AGTCACCTTTAGTTTCTATTAACAGGATCACCCAGTCAAGTTAACAATCA ACTTAGTTTGGAGCAGAAAATTTATCATTTTGGGGGACCTTTTTCACAGA AGTTAGGTCCCATATTCGGGACATCAATTTCGACTGTCATCTTTGGCAAT TTTTCATTGAAATTTCTTTCGTAGGGTTATTTTAATTCGTAGTATTTAAC CCTTTGAGTGCCAGGGTCCTTTTTTCTAAGTTTTTTTTAAAAAATCGCTA GTTCAAACTTTAAGGGCTTATATCTCCTGATCTAGA

Coding sequence (CDS) from alignment at sc0000001:754747..756932-

>TCONS_00000175 ID=TCONS_00000175|Name=TCONS_00000175|organism=Clytia hemisphaerica|type=CDS|length=702bp|location=Sequence derived from alignment at sc0000001:754747..756932- (Clytia hemisphaerica)
ATGGCTGATCATCCCCTCCAATCTGCAAACAATTCAAAATTCTGGATTCT
CGTTAGAGCTCTCAAAGAGTTTGTTAACCAGAGTGGTACACTACCTTTAC
GTGGCTCTTTACCAGACATGTTCTCAGATTCGAAACGCTATATTGAGTTA
CAGAACGTTTATAAAACTAAAGCTGAAAGTGATATACAGAAAGTGACCGA
TCTTGTTCGAGAATCATTAGAAGACCTCCAAAGGTCTTTGAGTTTTATTC
AACCTGACGAGATCCAAACGTTCTGTAAAAACGCTGCGTTTATTCAAGTG
CAGTATGGGCTCTCCTATCACGACGAGATTCGTCAGAATTTAGCAGAGCA
TAAAATCAAAGACACCCTTGAACAATATCAAGAAAATGGAGCTAGCTTGT
ATCTAGCCTTCCGTACATTACATTCATCCCTTGACCAACAAGCACCTAAA
GATTTAATCTCTTTGTCATCTGTCACTGAAAACGTCATGAAAAGCTGTTT
GTTAGAAGAGTTTGAATCACCTTTAAACATTTTAGAAGAAATGTTACGTT
CAGACCTCTCTGAATTCCACCCTATGGCGGCTGTGATGGGTGGAATAAGC
GCCCAAGAGGTCATTAAAATGATCACAGGGCAATTTGTTCCTGTCAATAA
TGTTTTGTTGGTTAATAGTGTGGAATCTCAAACTGTGACAATGAAACTTT
AG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000103XLOC_000103Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000175-proteinTCONS_00000175-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000175-exon-sc0000001-1575043694:756142..756932TCONS_00000175-exon-sc0000001-1575043694:756142..756932Clytia hemisphaericaexon
TCONS_00000175-exon-sc0000001-1575043694:754747..756040TCONS_00000175-exon-sc0000001-1575043694:754747..756040Clytia hemisphaericaexon
TCONS_00000175-exon-sc0000001-1510915933:756142..756932TCONS_00000175-exon-sc0000001-1510915933:756142..756932Clytia hemisphaericaexon
TCONS_00000175-exon-sc0000001-1510915933:754747..756040TCONS_00000175-exon-sc0000001-1510915933:754747..756040Clytia hemisphaericaexon
TCONS_00000175-exon-sc0000001-1491911889:756142..756932TCONS_00000175-exon-sc0000001-1491911889:756142..756932Clytia hemisphaericaexon
TCONS_00000175-exon-sc0000001-1491911889:754747..756040TCONS_00000175-exon-sc0000001-1491911889:754747..756040Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:754747..756932 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.24499 1.07892 0 3.80081 1.66614 1.80471 1.71739 2.55001 0 0.79618 0 0.23765 1.65821 1.62659 0 1.17143 2.11965 0.301098 0 1.04103 0.214501 2.20761e-09 0 1.01815 1.1617 2.8125 1.67464 1.35772e-09 0 7.96749e-09
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000594ThiF_NAD_FAD-bd
Vocabulary: Molecular Function
TermDefinition
GO:0008641small protein activating enzyme activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0008641 small protein activating enzyme activity
Blast
BLAST of TCONS_00000175 vs. Swiss-Prot (Human)
Match: ULA1 (NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens GN=NAE1 PE=1 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 4.793e-100
Identity = 95/176 (53.98%), Postives = 127/176 (72.16%), Query Frame = 2
Query:  272 YDRQLRLWGNDGQTALENARICLINATATATETLKCLVLPGIGKFYIVDDHLVNDDDLSSNFFVDPESIGKPRAKVACELLQELNPDTSGNWIKENAANLLDNDPEFYRKFTAVICSRVSEHDLLKLSHYFWEHDIPLFIVDSVGMFGYLRLVYKEHVIIKAHPDNTHSDLRLESP 799
            YDRQLRLWG+ GQ ALE+A +CLINATAT TE LK LVLPGIG F I+D + V+ +D  +NFF+   SIGK RA+ A E LQELN D SG++++E+  NLLDNDP F+ +FT V+ +++ E   L+L+   W   IPL I  + G+ GY+R++ KEH +I++HPDN   DLRL+ P
Sbjct:   13 YDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKP 188          

HSP 2 Score: 177.948 bits (450), Expect = 4.793e-100
Identity = 113/307 (36.81%), Postives = 174/307 (56.68%), Query Frame = 3
Query:  792 KALERWQEQTDQKWPKNYKEKCQIKEIVRSLNLKNEDGVPVHEENFEEALTNVNNVFSGTFVPSDVRNVLDNPMADHPLQ-SANNSKFWILVRALKEFVNQ--SGTLPLRGSLPDMFSDSKRYIELQNVYKTKAESDIQKVTDLVRESLEDLQRSLSFIQPDEIQTFCKNAAFIQVQYGLSYHDEIR-QNLAEHKIKDTLEQYQ--------ENGASLYLAFRTLHSSLDQQAPKDLISLSSVTENV--MKSCL---LEEFESPLNI----LEEMLRSDLSEFHPMAAVMGGISAQEVIKMITGQFV 1649
            K L +W  +T+ + PK YKEK   ++++R   LKNE+G P  EENFEEA+ NVN   + T +PS + ++ ++   D  +  +     FWIL RALKEFV +   G LP+RG++PDM +DS +YI+LQNVY+ KA+ D   V + V + L+ + ++   I   E++  C N+AF++V         +R ++LAE    DT+ + +        +N   LYL  R +     QQ     +S   V E++  +KSCL   L+E+   + +    + E  R   +E H +AA +GG +AQEVIK+IT QFV
Sbjct:  220 KYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFND---DRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRV---------VRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFV 514          
The following BLAST results are available for this feature:
BLAST of TCONS_00000175 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ULA14.793e-10053.98NEDD8-activating enzyme E1 regulatory subunit OS=H... [more]
back to top