Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00000175-protein ID=TCONS_00000175-protein|Name=TCONS_00000175-protein|organism=Clytia hemisphaerica|type=polypeptide|length=233bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term Definition
IPR000594 ThiF_NAD_FAD-bd
Vocabulary: Molecular Function
Term Definition
GO:0008641 small protein activating enzyme activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
molecular_function
GO:0008641 small protein activating enzyme activity
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
20 40 60 80 100 120 140 160 180 200 220 Expect = 3.5E-22 / Score = 78.1 Score = Sequence G3DSA:3.40.50.720 SSF69572
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available GENE3D 3.40.50.720 coord: 2..233 IPR000594 THIF-type NAD/FAD binding fold SUPERFAMILY 69572 Activating enzymes of the ubiquitin-like proteins coord: 7..232
Blast
BLAST of TCONS_00000175-protein vs. Swiss-Prot (Human)
Match:
ULA1 (NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens GN=NAE1 PE=1 SV=1)
HSP 1 Score: 130.568 bits (327), Expect = 3.237e-35
Identity = 86/240 (35.83%), Postives = 133/240 (55.42%), Query Frame = 0
Query: 14 FWILVRALKEFVNQSG--TLPLRGSLPDMFSDSKRYIELQNVYKTKAESDIQKVTDLVRESLEDLQRSLSFIQPDEIQTFCKNAAFIQVQYGLSYHDEIR-QNLAEHKIKDTLEQYQ--------ENGASLYLAFRTLHSSLDQQAPKDLISLSSVTENV--MKSCL---LEEFESPL----NILEEMLRSDLSEFHPMAAVMGGISAQEVIKMITGQFVPVNNVLLVNSVESQTVTMKL 233
FWIL RALKEFV + G LP+RG++PDM +DS +YI+LQNVY+ KA+ D V + V + L+ + ++ I E++ C N+AF++V +R ++LAE DT+ + + +N LYL R + QQ +S V E++ +KSCL L+E+ + + + E R +E H +AA +GG +AQEVIK+IT QFV NN + + + + T +L
Sbjct: 304 FWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRV---------VRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL 534
The following BLAST results are available for this feature:
BLAST of TCONS_00000175-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
M A D H P L Q S A N N S K F W I L V R A L K E F V N Q S G T L P L R G S L P D M F S D S K R Y I E L Q N V Y K T K A E S D I Q K V T D L V R E S L E D L Q R S L S F I Q P D E I Q T F C K N A A F I Q V Q Y G L S Y H D E I R Q N L A E H K I K D T L E Q Y Q E N G A S L Y L A F R T L H S S L D Q Q A P K D L I S L S S V T E N V M K S C L L E E F E S P L N I L E E M L R S D L S E F H P M A A V M G G I S A Q E V I K M I T G Q F V P V N N V L L V N S V E S Q T V T M K L 20 40 60 80 100 120 140 160 180 200 220 Expect = 3.24e-35 / Id = 35.83 Sequence ULA1
Match Name E-value Identity Description
ULA1 3.237e-35 35.83 NEDD8-activating enzyme E1 regulatory subunit OS=H... [more]
back to top
