Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000162 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000162
Unique NameTCONS_00000162
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4887

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000162 ID=TCONS_00000162|Name=TCONS_00000162|organism=Clytia hemisphaerica|type=transcript|length=4887bp
GTCTGTTAAATGACTGCTTTAGGGTCTGTAAATTATTGCTCATTAGTGTT
TCAACTCGTAATCAGTAAAATGAAGTTAACATGGTGCTTCATATCATTTT
GAATATTAATGAATGTCAACTAACTTTTATAGAGAATGAGAACTGtaaaa
attatctttaaatGTGATAAAACGGATTAAAACAGAAACAAATTAATCAA
CCTTTTGTTAATCTTTACAGACTTTATTTAGATGTTCAACCACGCACAGA
CTATATCAAAGATTGCGTTTTTACATGCGAAATATGAAAACATAGTGCAG
AGTTTTTTGCCAAGGCACTCAGGACTTGTCGTTGAGTCGAACCACCCATT
CGACCCAAAAATCTTTATAAACTCAAACTGGATTGTGTCAATTGATTATT
TCCTTCTAGATATGAAATACAGAATGATTACTTTGTTCAAATTTATGGTA
CTACTTTATGCTGGAAGCCAGGTCTTGGCTCAAACCAATATTCGAAAAGA
TGGCTATTGTGTCATGTATGGTCAGATGGCACCAGGAACAGAAATTGTCA
ACCCTTACAATGGACCTGCTAAAAACTTTTCAGAAgaatcttataaaatt
cttGCAGAAACATGCCCACATCTTGCTCATGGAATTAATGAAACTGTTGG
CTGTTGTGGTATTGGTCAACTTAAATCATTGGAAAAGAATTTGAAGACTG
CAGCCACCTTGTTCTCTAGATGTCCCTCTTGCTCTAAGAACTTCTATAAC
ATGTGGTGTGACTTCACTTGTTCACCAAACCAATCAGAATTTATGGATTA
TACCTATGGAATGGCTACTTATTATGTTTCTGATAAGTATGCAAATGATC
TTTATGGCTCTTGCAAGGATGTCACATTTCCTGGAAGCAATGGAAAAGTT
ATGGATTTGATGTGTGGTACAACTGCCAAGTTATGTACAaccgaaaaatt
cttgaaatttgttgGAACACCTGGAAATGGAGCTCCTTTTAATATTATGT
TTAATATTGGACTCAATGTGTCAGGTGTTGAAAACCATGACGCACATATG
GTTGGATGCAATGAAACCTATGCTATTTCAAGTGATAAAAACAGTACTGT
TTGCTCTTGTCAAGATTGTCAACCTTCGTGCCCTGTTCCTCCTTCCCCGC
CACAACCAAAACCAATCAAATACATCATGGGAATCAGAGAAACCTATTTC
ATCACTGGTGTTGTGCTTCTTGTTTGGgtctttgtttttcttgcttttag
tgtatttgaaatctttcgatcTCGTGATTCTTCTCTTGAGGCACGCGCTG
ATGCTGTGCACAGTGGATCGGTATCTTCTAATGGATCAGGCTATCACAAT
TCAACTACAGCCTTGTATGGTGGTTATCAGCAAAACCCTGGAAAATGTGT
TGGTTTGGGAATCAAAGCTGAGGAATTTCTGCAGAAAATCTTCCAGAAAT
GGGGAACGTTATGTGCCAGTCATCCATGGAAAGTCATTCTTGGTTCACTT
TTCTTTATTCTTGTTTGCTCTTTGGGACTCTTGAAATTTACAGTCATCAC
AAACCCAGTTGAGTTATGGTCGTCACCAACTACCCAGGCAAGAATGGAGA
AGAGCTATTATGATGAAAAATTCACCCCATTCTATCGTACAGAACAGGTT
ATCATCACCAGCACTGTAAAAAATAATACAGAAGAATTCTATCCATACCA
AGTTTCATCTCCAACAAACTTTTCTGGGATCATGACTAAAGAAATGCTTT
TTCGAGTTCTTGATCTTCAACTTGATCTGATGAATCTTACTGCTGAATAC
AATGGAGAAACAGTTGCTTTGAATGACATCTGCTATCAACCACTCTACCC
TGATAATAAAGATTGTGCTGTCATGAGTGTTCTTCAGTATTGGCAATTGG
ATGCCAAAAAGTTAAACATGTGTATAACTAATATGGATTCAGACTGTTCT
GCCGGTTTTGGTTCACGTGCTGCTGATTGGCATGACCAATTTTCTGGTTG
TACCAAAAACCCAACTGCCATGGAATTGGAACCACACATGAAATTACCTT
GCATGGGTAAATTTGGTGGACCTGTCACTCCTAAACTTGCACTTGGCGGT
TTTGAGGGCGATGACTACAGCACTGCGACAACACTCATCATTACTTTTGT
TGTCAACAATCACAGAGATGAAAGTAAAAATAAGAAAGCGGAAGCATGGG
AAAAAGTGTTTATTGATTACCTTAAAAAATGGGAGCAAGATCCGGAGTTG
AGTGCTAATCTTACCATAGCATACACAAGTGAAAGATCAATTCAAGATGA
AATCACACGTGCCAGTGAATCTGACGTCCTTACGATTGCTATCAGTTACT
GTCTTATGTTTTTGTATATCGCTGTTGGTCTAGGACAATTTCGATCGCTT
AGTCGTATGTTGATTGATGCAAAAGTCACAGTTGGTATCattggtgtttt
gattgtcttgCTTTCTGTTGCCGCATCATTGGGGGCTTGTTCATACTTTG
GTACACCAGCCACATTGATCATCATTGAAGTCATTCCCTTCTTGGTTCTT
GCTGTTGGTGTGGATAATATCTTTATTTTAGTTCAAGCTCTTCAACGTGA
TATCCGATTGCCAGCTGAAAATACCTCAGAACAAGTTGGACGTGTTGTTG
GTGTTGTGGGTCCAAGCATGCTTCTTTCTTCCCTCTCTGAATCTGTTGCA
TTCGGTTTCGgtgCCCTTTCAACTATGCCTGCAGTTCATACATTCGCCGT
TTTTGCATGCTTTGCtgtatttttcaactttattcTTCAAATGACAATGT
TGGTTGCTGTGGTAACGTTGGACAAAAAGAGACAAGATAACAGCCGTTAT
GACATCTTGTGTTGTGCATCGGGAGATAAAAATGCTCCAAACAGTGAAGA
ATGTTGTGAAGGAGGAGTTCTACACTTTATTGTCAAGAAAATTTATGCAC
CCACTCTTATGTTATACCCAGTCAGAGTTACCGTTatcTTGGTGTTCTCC
ATCTATCTCGGAATCAGCGCCTGTTTCATTACAAATCTCAGTCTTGGAAT
TTCTCAAACCATTGCTCTACCTAGAGACTCTTTCCTAATGAATTATTTTG
GAAACTTGTCAACATACTTGAAAACTGGTGCCCCAGTATACTTCGTAGTC
AAAGATGGATTTGATTACTCAAAGGTTGAAAATCAGAACTTATTGTGTGG
CTCTTCAGGCTGTAATAGTAACTCATTACTTGGAGAAGTGTTTTTCAGTT
CGTTGAATCCCAACTATACATCAGTAGCATTGCCAGCTTCATCTTGGCTT
GATGATTACTTTTCGTGGTTGGACCCTGACGTCAAATGTTGTCGCTTAAG
AAATGGTAGCACTCCACTTAACATGAACTTCTGTCCAGCAACAGATCCAT
TAGAATGGAGGAATTGTACCTCTTGTTTACCGAAAAACGAATCAGCACAG
AGACCACGACCAGCTGAATTCAGGAAATTTTTGCAACAATATTTAAAAGA
TAATCCATCTAAAGATTGTAGTAAAGGAGGTCATGCAGCTTACGGAGGAG
CAGTTAAATTGAACGCACCAGTCGATGGAGAATATAGTGTGGATGCTTCC
TACTTTATGACCTATCATACTGTATCAACAACATCAGATGAATTCACACA
CTCCATGAAATATGCTCGTGAATTGGCTAGCAACATGACAGAGCGTATCA
ACCACGATGTTTTCGCATACAGTGTTTTCTACGTGTTTTATGAACAATAT
TTAACCATTGTCAGTGACACTTGGAAAGATTTATTAATCTGCGCATCTGG
TGTGTTTGCTGTCACCTTCTTGCTTATGGGATTCAACTTTGGATTAGCTT
TCTGTATTATTGTGACGGTTGCCATGATTGTTGTAGACTTAATGGGGTTG
ATGTACCTCTGGAATATAAGCTTGAACGCAGTGTCATTGGTCAATCTTAT
GATGGCTATTGGTATATCAGTGGAATTTTGTGCGCACATTGGCCGGGCAT
TTAGTACCAGTCCTTATTCATCACGTGTCAAGAGAGCAGAAGATGCCCTG
GGCACTGTTGGTAGTAGTgtATTAAGCGGTATCACTATTACAAAGTTCGT
TGGAGTCTTCGTATTGTGGTTTTCGAAATCCGAGCTTTTTGAGATTTACT
ACTTCCGAATGTACATGGGTATAATCATTATGGGATTCCTTCACGGGCTC
GTCTTTCTACCCGTATTTCTCAGTTACGTTGGCCCGGCATCCCGTGCAAC
GGAAGAAGACGTTAAACGTGCCTCCATGGCAACCAACGCCCATCCAGCTG
CAAGGGAAAAGAAATTAATAAGCGcgtaaaaaaacttaaaaagagTGAAG
TTTGTGTAAAATTAGTAAGTATTGATTGTCCGGGGAAGGTGAAAAATTCG
TTGTGTCCGGAAATAAGCCGATCTGAACTTGATTGATCAAAATCTTTGAG
TTTGAATTTATCATTATGAGATGCTAGCTCTTTCTTTTCCTGTCAAAGTC
ATTTCTGAATGAGTGTTATTCATTGATTATCTTAGAGACCTCTGATTAGC
GTTCTAAACTTCATCGGACAATCTGTACTTATagcatttttaatgttttt
tttttaataatataaGTAAATCAACTAAAATGATATAggagataaaattt
tgaattttaactatAAACGTAGAAACTGAAcgtaattaagaattttattt
ttaagttaTTTTGTGCCATTTTTTAAACTGTTAGCAGTGATTGTTTCCAG
TTTTCATTTTAGCGAAAGCCAAGCCAAGATTGAATACTAATGAGTACGGG
TCTTAGATAGATCAAAATACGTCTCTAAAAATTCGAACGGGGAGACAAAG
CTAAGGTTATTTCCActaagagccccccccccccccc
Run BLAST on NCBI

protein sequence of TCONS_00000162-protein

>TCONS_00000162-protein ID=TCONS_00000162-protein|Name=TCONS_00000162-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1365bp
MFNHAQTISKIAFLHAKYENIVQSFLPRHSGLVVESNHPFDPKIFINSNW
IVSIDYFLLDMKYRMITLFKFMVLLYAGSQVLAQTNIRKDGYCVMYGQMA
PGTEIVNPYNGPAKNFSEESYKILAETCPHLAHGINETVGCCGIGQLKSL
EKNLKTAATLFSRCPSCSKNFYNMWCDFTCSPNQSEFMDYTYGMATYYVS
DKYANDLYGSCKDVTFPGSNGKVMDLMCGTTAKLCTTEKFLKFVGTPGNG
APFNIMFNIGLNVSGVENHDAHMVGCNETYAISSDKNSTVCSCQDCQPSC
PVPPSPPQPKPIKYIMGIRETYFITGVVLLVWVFVFLAFSVFEIFRSRDS
SLEARADAVHSGSVSSNGSGYHNSTTALYGGYQQNPGKCVGLGIKAEEFL
QKIFQKWGTLCASHPWKVILGSLFFILVCSLGLLKFTVITNPVELWSSPT
TQARMEKSYYDEKFTPFYRTEQVIITSTVKNNTEEFYPYQVSSPTNFSGI
MTKEMLFRVLDLQLDLMNLTAEYNGETVALNDICYQPLYPDNKDCAVMSV
LQYWQLDAKKLNMCITNMDSDCSAGFGSRAADWHDQFSGCTKNPTAMELE
PHMKLPCMGKFGGPVTPKLALGGFEGDDYSTATTLIITFVVNNHRDESKN
KKAEAWEKVFIDYLKKWEQDPELSANLTIAYTSERSIQDEITRASESDVL
TIAISYCLMFLYIAVGLGQFRSLSRMLIDAKVTVGIIGVLIVLLSVAASL
GACSYFGTPATLIIIEVIPFLVLAVGVDNIFILVQALQRDIRLPAENTSE
QVGRVVGVVGPSMLLSSLSESVAFGFGALSTMPAVHTFAVFACFAVFFNF
ILQMTMLVAVVTLDKKRQDNSRYDILCCASGDKNAPNSEECCEGGVLHFI
VKKIYAPTLMLYPVRVTVILVFSIYLGISACFITNLSLGISQTIALPRDS
FLMNYFGNLSTYLKTGAPVYFVVKDGFDYSKVENQNLLCGSSGCNSNSLL
GEVFFSSLNPNYTSVALPASSWLDDYFSWLDPDVKCCRLRNGSTPLNMNF
CPATDPLEWRNCTSCLPKNESAQRPRPAEFRKFLQQYLKDNPSKDCSKGG
HAAYGGAVKLNAPVDGEYSVDASYFMTYHTVSTTSDEFTHSMKYARELAS
NMTERINHDVFAYSVFYVFYEQYLTIVSDTWKDLLICASGVFAVTFLLMG
FNFGLAFCIIVTVAMIVVDLMGLMYLWNISLNAVSLVNLMMAIGISVEFC
AHIGRAFSTSPYSSRVKRAEDALGTVGSSVLSGITITKFVGVFVLWFSKS
ELFEIYYFRMYMGIIIMGFLHGLVFLPVFLSYVGPASRATEEDVKRASMA
TNAHPAAREKKLISA
Run BLAST on NCBI

transcript from alignment at sc0000001:471270..481845-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000162 ID=TCONS_00000162|Name=TCONS_00000162|organism=Clytia hemisphaerica|type=transcript|length=10576bp|location=Sequence derived from alignment at sc0000001:471270..481845- (Clytia hemisphaerica)
GTCTGTTAAATGACTGCTTTAGGGTCTGTAAATTATTGCTCATTAGTGTT TCAACTCGTAATCAGTAAAATGAAGTTAACATGGTGCTTCATATCATTTT GAATATTAATGAATGTCAACTAACTTTTATAGAGAATGAGAACTGTAAAA ATTATCTTTAAATGTGATAAAACGGATTAAAACAGAAACAAATTAATCAA CCTTTTGTTAATCTTTACAGACTTTATTTAGATGTTCAACCACGCACAGA CTATATCAAAGATTGCGTTTTTACATGCGAAATATGAAAACATAGTGCAG AGTTTTTTGCCAAGGCACTCAGGACTTGTCGTTGAGTCGAACCACCCATT CGACCCAAAAATCTTTATAAACTCAAACTGGATTGTGTCAATTGATTATT TCCTTCTAGATATGAAATACAGAATGATTACTTTGTTCAAATTTATGGTA CTACTTTATGCTGGAAGCCAGGTAATATTTTTTAGCCTATTACAGTTATA AGGTAATTTTTTTGCATCTTATAAATTTTACCATTGCAAGCGCATTGGTT TTACCCATTTCTGAAATCGGCGATTTTTCCTCTAGAGGAGGGTGTATGTG GAGTTATTTGTTACTATAAGTTGCTCTAATGTCGACACCCTTCTTCTAAT TTCAACACCCTTCTTTAGAGATACAGTAGGAATAATTTGGCGACCATCAA ATAATATGCTCTGTTCACATCGCTTGACCAACTCACCTTCAAAACATAAA ACTGGAGTCGGCCCAGTCGTAATAATGCACAGCTGTCAACTTCGCTTTGA AAAAATGAGTGAGAGGCTTCACAAGTCAGAAAAAATTTTCCTGATGATCC AATTTTTCTGAATCGGAAAATCAGGAAATCAAGGGAAATCAGGGATTTTT TTGTCCCAATTTTTCAAATCCAGGAAATTTTGCCATGCCGCTTTTTCAAA ATCTGAATGATTTTTTAAGGGAGGTCGAAAATTTTTAGAGATGCAGGAGA AAATCCTGAAAATGTGGGAGATTTGGCTGAACTTTTTTCCTGCGGGATTT AGGACCACTCATGGTATATACCTCGGAGGGCCGTAAATTAGGTCCAGTTT TAAGGTCAACGCATTTCACTGGATTTATTATAGCAAATTTAAACAGGGTG GCAAGAGATTATATTTTTTGCCAACTGGATTCTTTGGGATTTATTAAATA TAAAAAATTCGACAACATTTGCTACCGACCGACCAACTGAATTTGGGGAT ATNTGGATTCTTTGTGGTTTATTAAATATAAAAAATTCGACAACATTTGC TACCGACCGACCAACTGAATTTGGGGATATTTATGACGCAAACGGAACAT ATTATTGATATACGCCTATGGGAAGGTCGGAATCACTGATTGAAACTATT TTTCTTTGCTTAGTGATGAGAGAGGAATAAATCTTTTGTCTATCAGTGAT TCTGACCTTCCTATTATTTCTACCTCTAAAGAAGGGTGTCAAAATTAGAC CAACTTAGTATTCAATATATCACGTTCTCCTAAACAACTATTCATCGTCC AGATATCCCAGGCTTTGTTTACATTACTGATTGACGCCAGAGAATACCCT GGTGTTGGCTGATACAAGGAACTTCTCAAAACAATACGTCATAAAAAAGT CTGCCCTTATAAAGTTACACTGCAATGCAATGGTTTCAAACCCAGAAACA AATGAAATCTGACGTTTTGTTTTGAATTACGTAATCTTATGCGTTCGAAA AACAGTAACCAATGCCAGGGTATTATCTAGCACTATCAGTAAGCATAAAA AAGCTGATAAATACGCAGTTAACAAGGTTGGCCGCAATCAAATACCACCA TTCCACTTAAGATGGGCCAAACCTCCATCAATTGTTTAAACCTCCCCTGC TCTAGTGTAACTTGTAGAGTTTTATTGGAGACTATAAACCAGCTTTTGCG AGAATAAAAGTCTTCTGGAAAACAAAAAAGAAATCTAAGACACCTGTAAC ATTTTTTCTAAATCGGAGGATGCAAAATTGAAACGGTGGAATTTAAAAAG ATGGAATTTAAAAAGATGGTGATGTGGCAATGTATTATGAGTTTCTTGCT TGTTGCCTTTCTAGACAAGCTCCAAAAGGACAGATTTCAAGTAAAAGCCT TTTAAAACAACACAGTTAAAATGTAGATACCAAAAGAGCGAGTATAAGAA GAAGACATCAGCAAAGATTTTTATTAAACATTTAAAGAAGGGTCTCTGAA TCTCTACATGCATTGAGCATGGGACCTGTGCATTTTCGTATTCCTCACAC AACTTTTGACCAATTTAATCATTCGCCCATTTTTGATTTTCAGAAAAGTT TCCACTCATTTTTCCATTTGCCTGGAAATAATAGAAAATTTTTTAAACCT TAAAATCTGGTTAAAATTTAAAAGTTAAAGTTTTATTTAAAAGTAAATTC AAAATCAATAACTTTCTGCTAAGTTTGATCAATTGATTTTAAAAAATTAG GTCAATTAAATTCTAATAATAATTTTATTTGTTATTTTTCAGGTCTTGGC TCAAACCAATATTCGAAAAGATGGCTATTGTGTCATGTATGGTCAGATGG CACCAGGAACAGAAATTGTCAACCCTTACAATGGACCTGCTAAAAACTTT TCAGAAGAATCTTATAAAATTCTTGCAGAAACATGCCCACATCTTGCTCA TGGAATTAATGAAACTGTTGGCTGTTGTGGTATTGGTCAACTTAAATCAT TGGAAAAGAATTTGAAGACTGCAGCCACCTTGTTCTCTAGATGTCCCTCT TGCTCTAAGAACTTCTATAACATGTGGTGTGACTTCACTTGTTCACCAAA CCAATCAGAATTTATGGATTATACCTATGGAATGGCTACTTATTATGTTT CTGATAAGTATGCAAATGATCTTTATGGCTCTTGCAAGGATGTCACATTT CCTGGAAGCAATGGAAAAGTTATGGATTTGATGTGTGGTACAACTGCCAA GTTATGTACAACCGAAAAATTCTTGAAATTTGTTGGAACACCTGGAAATG GAGCTCCTTTTAATATTATGTTTAATATTGGACTCAATGTGTCAGGTGTT GAAAACCATGACGCACATATGGTTGGATGCAATGAAACCTATGCTATTTC AAGTGATAAAAACAGTACTGTTTGCTCTTGTCAAGATTGTCAACCTTCGT GCCCTGTTCCTCCTTCCCCGCCACAACCAAAACCAATCAAATACATCATG GGAATCAGAGAAACCTATTTCATCACTGGTGTTGTGCTTCTTGTTTGGGT CTTTGTTTTTCTTGCTTTTAGTGTATTTGAAATCTTTCGATCTCGTGATT CTTCTCTTGAGGCACGCGCTGATGCTGTGCACAGTGGATCGGTATCTTCT AATGGATCAGGCTATCACAATTCAACTACAGCCTTGTATGGTGGTTATCA GCAAAACCCTGGAAAATGTGTTGGTTTGGGAATCAAAGCTGAGGAATTTC TGCAGAAAATCTTCCAGAAATGGGGAACGTTATGTGCCAGTCATCCATGG AAAGTCATTCTTGGTTCACTTTTCTTTATTCTTGTTTGCTCTTTGGGACT CTTGAAATTTACAGTCATCACAAACCCAGTTGAGTTATGGTCGTCACCAA CTACCCAGGCAAGAATGGAGAAGAGCTATTATGATGAAAAATTCACCCCA TTCTATCGTACAGAACAGGTTATCATCACCAGCACTGTAAAAAATAATAC AGAAGAATTCTATCCATACCAAGTTTCATCTCCAACAAACTTTTCTGGGA TCATGACTAAAGAAATGCTTTTTCGAGTAAGTATCATATTCTTTTCTCAA AAGGCTTTGAAAACCAATATCTCTTTTCTAGCGATGCTATCAAGCCAAGG TTTACTTCCATCTCATTACTATTTTTCAATAGTAACAATAAATCAAACTT AAAAAACAAACAATATAACATTATTAAAAATACACTTTTCAGGTTCTTGA TCTTCAACTTGATCTGATGAATCTTACTGCTGAATACAATGGAGAAACAG TTGCTTTGAATGACATCTGCTATCAACCACTCTACCCTGATAATAAAGAT TGTGCTGTCATGAGTGTTCTTCAGTATTGGCAATTGGATGCCAAAAAGTT AAACATGTGTATAACTAATATGGATTCAGACTGTTCTGCCGGTTTTGGTT CACGTGCTGCTGATTGGCATGACCAATTTTCTGGTTGTACCAAGTAAGTC TTTATTATGCCAATTTTCACAAGTGCATTTAAAACTGTATGAAATTAAAA TGAAGTTCAATTTTTGGAACGCCATATAATTAGATAAAGTCTTTCATAGA AATTCAAATTAATTTTTCCCTCAATTTTAACTTGAGATTTATGGGAAAAT CAAGTTTTTCTTTCATACATAATAATGCAAAGCAAATTTCTTATGTCTAC AGAAACCCAACTGCCATGGAATTGGAACCACACATGAAATTACCTTGCAT GGGTAAATTTGGTGGACCTGTCACTCCTAAACTTGCACTTGGCGGTTTTG AGGGCGATGACTACAGCACTGCGACAACACTCATCATTACTTTTGTTGTC AACAATCACAGAGATGAAAGTAAAAATAAGAAAGCGGAAGCATGGGAAAA AGTGTTTATTGATTACCTTAAAAAATGGGAGCAAGATCCGGAGTTGAGTG CTAATCTTACCATAGCATACACAAGTGAAAGATCAATTCAAGATGAAATC ACACGTGCCAGTGAATCTGACGTCCTTACGATTGCTATCAGTTACTGTCT TATGTTTTTGTATATCGCTGTTGGTCTAGGACAATTTCGATCGCTTAGTC GTATGTTGGTGAGTATAAAAAATCTTTTTTGAGGAAAGAAAATATTTGAG GAAATTTATATACATACATAGTTTTGATCTAGGTTTGATAGGTCTTAAAA GATTTCAACTTGTAGATTTAATTTAAGAATAAGGTTTTTCTTCTAGATTG ATTTCTCAGTTAATGTTATGCAACACTATTCTCTATTTTCAGATTGATGC AAAAGTCACAGTTGGTATCATTGGTGTTTTGATTGTCTTGCTTTCTGTTG CCGCATCATTGGGGGCTTGTTCATACTTTGGTACACCAGCCACATTGATC ATCATTGAAGTCATTCCCTTCTTGGTTCTTGCTGTTGGTGTGGATAATAT CTTTATTTTAGTTCAAGCTCTTCAACGTGATATCCGATTGCCAGCTGAAA ATACCTCAGAACAAGTTGGACGTGTTGTTGGTGTTGTGGGTCCAAGCATG CTTCTTTCTTCCCTCTCTGAATCTGTTGCATTCGGTTTCGGTAAGTTTTG ATTGTGGCAATTTTTTATTATCTCATGAATTTTTTTGTGTGCTCAACAAT GGCTGAGACAATTATATTTCTAACAAAGTTTTTTCTTTACTCAATAAGGG AATTTCCTTTTTTAAGGGTTTATGAATAAAAAATGTTGTATCCAGAATGT ATCTAAAATGAAACGGTTTATTTGAAAATGATATTGATTTTCTTTTTCAG GTGCCCTTTCAACTATGCCTGCAGTTCATACATTCGCCGTTTTTGCATGC TTTGCTGTATTTTTCAACTTTATTCTTCAAATGACAATGTTGGTTGCTGT GGTAACGTTGGACAAAAAGAGACAAGATAACAGCCGTTATGACATCTTGT GTTGTGCATCGGGAGATAAAAATGCTCCAAACAGTGAAGAATGTTGTGAA GGAGGAGTTCTACACTTTATTGTCAAGAAAATTTATGCACCCACTCTTAT GTTATACCCAGTCAGAGTTACCGTTGTAAGTATCTTGATTGTCTTTTTCT GCAGCAATTTCCAACTTTCACGGTCCAACTTTCATTGAATTCACTTCCGT ACCTGGTCTCATTGGAATCCTTCTGATTTTTATCTCTGTGAATTAAGGAA TGTCCTAATATGACTTGGACTTAATAAATAAATTAAGTTATATTAGAAGA CATTCCATGACTAATATAAAAATGATCACAGTGCTATTGCCTTTATCAGA CATTTTACTGGCCTATTTGGTATTGTTTATTTCCAGTTATACAGCAATAA CTGTTGCTCATTACTCATAATCATTAGCCAAGTAATATATTTAATTCAAA GAATAATCTTATTGAGACTTCACTGACCCAAAATGTATTCAATTTTATTT TCAGATCTTGGTGTTCTCCATCTATCTCGGAATCAGCGCCTGTTTCATTA CAAATCTCAGTCTTGGAATTTCTCAAACCATTGCTCTACCTAGAGACTCT TTCCTAATGAATTATTTTGGAAACTTGTCAACATACTTGAAAACTGGTGC CCCAGTATACTTCGTAGTCAAAGATGGATTTGATTACTCAAAGGTTGAAA ATCAGAACTTATTGTGTGGCTCTTCAGGCTGTAATAGTAACTCATTACTT GGAGAAGTGTTTTTCAGTTCGTTGAATCCCAACTATACATCAGTAGCATT GCCAGCTTCATCTTGGCTTGATGATTACTTTTCGTGGTTGGACCCTGACG TCAAATGTTGTCGCTTAAGAAATGGTAGCACTCCACTTAACATGAACTTC TGTCCAGCAACAGATCCATTAGAATGGAGGAATTGTACCTCTTGTTTACC GAAAAACGAATCAGCACAGAGACCACGACCAGCTGAATTCAGGAAATTTT TGCAACAATATTTAAAAGATAATCCATCTAAAGATTGTAGTAAAGGAGGT CATGCAGCTTACGGAGGAGCAGTTAAATTGAACGCACCAGTCGATGGAGA ATATAGTGTGGATGCTTCCTACTTTATGACCTATCATACTGTATCAACAA CATCAGATGAATTCACACACTCCATGAAATATGCTCGTGAATTGGCTAGC AACATGACAGAGCGTATCAACCACGATGTTTTCGCATACAGTGTTTTCTA CGTGTTTTATGAACAATATTTAACCATTGTCAGTGACACTTGGAAAGATT TATTAATCTGCGCATCTGGTGTGTTTGCTGTCACCTTCTTGCTTATGGGA TTCAACTTTGGATTAGCTTTCTGTATTATTGTGACGGTTGCCATGATTGT TGTAGACTTAATGGGGTTGATGTACCTCTGGAATATAAGCTTGAACGCAG TGTCATTGGTCAATCTTATGATGGCTATTGGTATATCAGTGGAATTTTGT GCGCACATTGGCCGGGCATTTAGTACCAGTCCTTATTCATCACGTGTCAA GAGAGCAGAAGATGCCCTGGGCACTGTTGGTAGTAGTGTAAGTATTTTTT ATATTTTTGCAAAATCTTATATGATGTTTTGATGAACCCATCATCAAGTT TAGAGCTTGTAATTTTCAAATGTGCTGTTTATGGCTATGTATTAGAGGCT TGTCGCAACATTTAGGATGTGCATCTTTCAGAAATTCTTCCCTATCAATC TGGGGCAAACATTATGAAATGCCACATTCTTATATTTGAAATCTCAACAA AAATTTTTTGTGGTTTGGCTTGAGGTGTTGAAATCTCATGCAATCTCCGT TTGTTTTTGTTACTCAATAACATTTGATATTTTCATGTCATCTCGTGATC TTGTTACCGATTCTTTTGTTATCGTCATGCTAAAAGGTTTTGTAATTATA ACCTCACCCTATGTTTGTCTTGGATACATGTTTCATCACTTTAAATAACT CTCAAAGAAAAATTGACAACTTGTTTAACACAATTTTTTATAAGCAACTA TGTTGGTCTAATTTTTCATCTCGTAATTAAAAGCTTTTTAGATAATTTAA CCATTGCAAACGATAGCTTTTGACCCAAAAAGCATAATGTAGTATAATAT CAGGGTTGTTAAAAAATATAAGAAAATAGCCAGAATGTGTGACCCGAAAA TTGTAGTTGCTTATAAAAAAAGGTTTTATTCTTCTTTTGTTTTAGGTATT AAGCGGTATCACTATTACAAAGTTCGTTGGAGTCTTCGTATTGTGGTTTT CGAAATCCGAGCTTTTTGAGGTGAGTGTCAACATTTTAAAACATGCCTGT TTGTTTTCTTGAAATATGACCTGTTCCAATGGGTTTTATTTTNTTTAAAC ATGCCTGTATGTTTTCTTGAAATATGACCTGTTCCAATGGGTTTTATTTT TGTTTTATTTTCTGACACTCGTGAGATTGGCCCAATCAAGAAATTGAATC TATCGTTGCTAAAATGTAACATGCTCAAACTAAGATAAATCTTATCAGAT TCCACAGTGTTCAAAGTTTTTCCGTTTCAAACGGATTTCTGTCTCAGCGA GGTACAAAAAGAGGCTTTTCCGTCTCCGAATTCAACAAAATTTCCATAAA ACATGAAGAATCTGGCCAGATTTATTGTTTGAAAACCATTTCCGTCTGTG ATGAAAGATTTGCTTTGACCACTGATTCCAATGGGTTTTTATTTTAAAAG AAAGAATGCCATCATCTGGAAGCTTATCAGAGATTGATCAAGAAGTTGAA TCTATTGTTGCATAAATGCTCAAACTATAGTAAATCTTATAAAGGGTTTG AAATTTTGACGACCAGTCGAGAGATAAACAAAGTATCTGTACAAAGAAAC AGAATATCTATCAACCTCAAACATGACAAATAAATCAAGCTTAAACATGT TTTTATATTTACAAAGTCATATGTTTGATTGACCCCCAAAGCACTAAAGA GAGAAAAAGGCCCACATAAGAAATGCCACACACATCACGCGATAATGTAT CAAATTCTTATCATCAAATTCGATATTCTTTTCTTTACATAAATTGGTTG CAAATGGCTAGAAGCTAACCTTTGCACTTTTTGTCGGTCGAACCCGAGTT TGTTCGAATGACGTTTTGATGCCGCCCGATTTTTGAAAATCGGAAGTTTT AGGGTAAAAAAATTGAGGAAAGAATTCGAAGGGAATTTTTGGCTCTGTGT CATATCCACTACCTTTTTGGATAAACCTTTGCTATAATAACGAAACTTGG TCTATAAATAAGAAGCAAAAAGCTCATTACCTTAAAGGGAAGAAATTTTG GAATCGGCCGAAACCCACAAAATTCATTTTTTCCCGCCATCTGCCGAATT AAATTCCTGTGAAATTTAAATTATTGCATTCATTCCCTAAATGTGTGCTA TTTCAGGCCTTAGAACAGGTCTTTTCTTATTTGATAGCGTTTTTGGACCA AAAATATTATTCATCCGCCAAATTGAATTCCCCCTTAAAAAACTTTTCCA TCCATCTTTCCTAAGGCATGCTTCACTATACTTTTCATAAATTACGTTAC GAACATCACGTTTTGAAATTATTGCCATGGTGATTAACTCCCAGTGGATT TTATTAAAAGTACATGTTTTTTTCTTTTATAAGCATAACGTTTATAAGCA TATGCAGGCTCAGTTTTGGGTACCTAAACAATGGCTCTATTGTTTGAAAA CAATAGAATGCTAAGCATAATGCGAGCCTGATGTAGGGGCAGGCGCTTAT TAAAAAAAAACATGTACTTTCTTTTCAAAAGAAATTATTTAATGTCTAAA GCGACATAATCACCATGGTAATTGTTTGAAAACGAGGCAAGTGATGTTCG TGACATAATTTATGAAAAGGTCTATTAAATTAGGGAAATCTGAAGAAAAA CTGAACAGTACCATTTATCGTACAACATTATCTATATCACTGTATAACTA TTATATTCCTGTATAATTTCTATCTTCCATGTACAACGCTGATATTACTT ATACCCTTATAGCTATTATAAACGACTTCAATGTCAAATTCATTCATAAT AATTCCACCTTTCTTTTTATTCTCGTTCACAGATTTACTACTTCCGAATG TACATGGGTATAATCATTATGGGATTCCTTCACGGGCTCGTCTTTCTACC CGTATTTCTCAGTTACGTTGGCCCGGCATCCCGTGCAACGGAAGAAGACG TTAAACGTGCCTCCATGGCAACCAACGCCCATCCAGCTGCAAGGGAAAAG AAATTAATAAGCGCGTAAAAAAACTTAAAAAGAGTGAAGTTTGTGTAAAA TTAGTAAGTATTGATTGTCCGGGGAAGGTGAAAAATTCGTTGTGTCCGGA AATAAGCCGATCTGAACTTGATTGATCAAAATCTTTGAGTTTGAATTTAT CATTATGAGATGCTAGCTCTTTCTTTTCCTGTCAAAGTCATTTCTGAATG AGTGTTATTCATTGATTATCTTAGAGACCTCTGATTAGCGTTCTAAACTT CATCGGACAATCTGTACTTATAGCATTTTTAATGTTTTTTTTTTAATAAT ATAAGTAAATCAACTAAAATGATATAGGAGATAAAATTTTGAATTTTAAC TATAAACGTAGAAACTGAACGTAATTAAGAATTTTATTTTTAAGTTATTT TGTGCCATTTTTTAAACTGTTAGCAGTGATTGTTTCCAGTTTTCATTTTA GCGAAAGCCAAGCCAAGATTGAATACTAATGAGTACGGGTCTTAGATAGA TCAAAATACGTCTCTAAAAATTCGAACGGGGAGACAAAGCTAAGGTTATT TCCACTAAGAGCCCCCCCCCCCCCCC

Coding sequence (CDS) from alignment at sc0000001:471270..481845-

>TCONS_00000162 ID=TCONS_00000162|Name=TCONS_00000162|organism=Clytia hemisphaerica|type=CDS|length=36882bp|location=Sequence derived from alignment at sc0000001:471270..481845- (Clytia hemisphaerica)
ATTTACTACTTCCGAATGTACATGGGTATAATCATTATGGGATTCCTTCA
CGGGCTCGTCTTTCTACCCGTATTTCTCAGTTACGTTGGCCCGGCATCCC
GTGCAACGGAAGAAGACGTTAAACGTGCCTCCATGGCAACCAACGCCCAT
CCAGCTGCAAGGGAAAAGAAATTAATAAGCGCGTAAGTATTAAGCGGTAT
CACTATTACAAAGTTCGTTGGAGTCTTCGTATTGTGGTTTTCGAAATCCG
AGCTTTTTGAGATCTTGGTGTTCTCCATCTATCTCGGAATCAGCGCCTGT
TTCATTACAAATCTCAGTCTTGGAATTTCTCAAACCATTGCTCTACCTAG
AGACTCTTTCCTAATGAATTATTTTGGAAACTTGTCAACATACTTGAAAA
CTGGTGCCCCAGTATACTTCGTAGTCAAAGATGGATTTGATTACTCAAAG
GTTGAAAATCAGAACTTATTGTGTGGCTCTTCAGGCTGTAATAGTAACTC
ATTACTTGGAGAAGTGTTTTTCAGTTCGTTGAATCCCAACTATACATCAG
TAGCATTGCCAGCTTCATCTTGGCTTGATGATTACTTTTCGTGGTTGGAC
CCTGACGTCAAATGTTGTCGCTTAAGAAATGGTAGCACTCCACTTAACAT
GAACTTCTGTCCAGCAACAGATCCATTAGAATGGAGGAATTGTACCTCTT
GTTTACCGAAAAACGAATCAGCACAGAGACCACGACCAGCTGAATTCAGG
AAATTTTTGCAACAATATTTAAAAGATAATCCATCTAAAGATTGTAGTAA
AGGAGGTCATGCAGCTTACGGAGGAGCAGTTAAATTGAACGCACCAGTCG
ATGGAGAATATAGTGTGGATGCTTCCTACTTTATGACCTATCATACTGTA
TCAACAACATCAGATGAATTCACACACTCCATGAAATATGCTCGTGAATT
GGCTAGCAACATGACAGAGCGTATCAACCACGATGTTTTCGCATACAGTG
TTTTCTACGTGTTTTATGAACAATATTTAACCATTGTCAGTGACACTTGG
AAAGATTTATTAATCTGCGCATCTGGTGTGTTTGCTGTCACCTTCTTGCT
TATGGGATTCAACTTTGGATTAGCTTTCTGTATTATTGTGACGGTTGCCA
TGATTGTTGTAGACTTAATGGGGTTGATGTACCTCTGGAATATAAGCTTG
AACGCAGTGTCATTGGTCAATCTTATGATGGCTATTGGTATATCAGTGGA
ATTTTGTGCGCACATTGGCCGGGCATTTAGTACCAGTCCTTATTCATCAC
GTGTCAAGAGAGCAGAAGATGCCCTGGGCACTGTTGGTAGTAGTGTGCCC
TTTCAACTATGCCTGCAGTTCATACATTCGCCGTTTTTGCATGCTTTGCT
GTATTTTTCAACTTTATTCTTCAAATGACAATGTTGGTTGCTGTGGTAAC
GTTGGACAAAAAGAGACAAGATAACAGCCGTTATGACATCTTGTGTTGTG
CATCGGGAGATAAAAATGCTCCAAACAGTGAAGAATGTTGTGAAGGAGGA
GTTCTACACTTTATTGTCAAGAAAATTTATGCACCCACTCTTATGTTATA
CCCAGTCAGAGTTACCGTTATTGATGCAAAAGTCACAGTTGGTATCATTG
GTGTTTTGATTGTCTTGCTTTCTGTTGCCGCATCATTGGGGGCTTGTTCA
TACTTTGGTACACCAGCCACATTGATCATCATTGAAGTCATTCCCTTCTT
GGTTCTTGCTGTTGGTGTGGATAATATCTTTATTTTAGTTCAAGCTCTTC
AACGTGATATCCGATTGCCAGCTGAAAATACCTCAGAACAAGTTGGACGT
GTTGTTGGTGTTGTGGGTCCAAGCATGCTTCTTTCTTCCCTCTCTGAATC
TGTTGCATTCGGTTTCGAAACCCAACTGCCATGGAATTGGAACCACACAT
GAAATTACCTTGCATGGGTAAATTTGGTGGACCTGTCACTCCTAAACTTG
CACTTGGCGGTTTTGAGGGCGATGACTACAGCACTGCGACAACACTCATC
ATTACTTTTGTTGTCAACAATCACAGAGATGAAAGTAAAAATAAGAAAGC
GGAAGCATGGGAAAAAGTGTTTATTGATTACCTTAAAAAATGGGAGCAAG
ATCCGGAGTTGAGTGCTAATCTTACCATAGCATACACAAGTGAAAGATCA
ATTCAAGATGAAATCACACGTGCCAGTGAATCTGACGTCCTTACGATTGC
TATCAGTTACTGTCTTATGTTTTTGTATATCGCTGTTGGTCTAGGACAAT
TTCGATCGCTTAGTCGTATGTTGGTTCTTGATCTTCAACTTGATCTGATG
AATCTTACTGCTGAATACAATGGAGAAACAGTTGCTTTGAATGACATCTG
CTATCAACCACTCTACCCTGATAATAAAGATTGTGCTGTCATGAGTGTTC
TTCAGTATTGGCAATTGGATGCCAAAAAGTTAAACATGTGTATAACTAAT
ATGGATTCAGACTGTTCTGCCGGTTTTGGTTCACGTGCTGCTGATTGGCA
TGACCAATTTTCTGGTTGTACCAAGTCTTGGCTCAAACCAATATTCGAAA
AGATGGCTATTGTGTCATGTATGGTCAGATGGCACCAGGAACAGAAATTG
TCAACCCTTACAATGGACCTGCTAAAAACTTTTCAGAAGAATCTTATAAA
ATTCTTGCAGAAACATGCCCACATCTTGCTCATGGAATTAATGAAACTGT
TGGCTGTTGTGGTATTGGTCAACTTAAATCATTGGAAAAGAATTTGAAGA
CTGCAGCCACCTTGTTCTCTAGATGTCCCTCTTGCTCTAAGAACTTCTAT
AACATGTGGTGTGACTTCACTTGTTCACCAAACCAATCAGAATTTATGGA
TTATACCTATGGAATGGCTACTTATTATGTTTCTGATAAGTATGCAAATG
ATCTTTATGGCTCTTGCAAGGATGTCACATTTCCTGGAAGCAATGGAAAA
GTTATGGATTTGATGTGTGGTACAACTGCCAAGTTATGTACAACCGAAAA
ATTCTTGAAATTTGTTGGAACACCTGGAAATGGAGCTCCTTTTAATATTA
TGTTTAATATTGGACTCAATGTGTCAGGTGTTGAAAACCATGACGCACAT
ATGGTTGGATGCAATGAAACCTATGCTATTTCAAGTGATAAAAACAGTAC
TGTTTGCTCTTGTCAAGATTGTCAACCTTCGTGCCCTGTTCCTCCTTCCC
CGCCACAACCAAAACCAATCAAATACATCATGGGAATCAGAGAAACCTAT
TTCATCACTGGTGTTGTGCTTCTTGTTTGGGTCTTTGTTTTTCTTGCTTT
TAGTGTATTTGAAATCTTTCGATCTCGTGATTCTTCTCTTGAGGCACGCG
CTGATGCTGTGCACAGTGGATCGGTATCTTCTAATGGATCAGGCTATCAC
AATTCAACTACAGCCTTGTATGGTGGTTATCAGCAAAACCCTGGAAAATG
TGTTGGTTTGGGAATCAAAGCTGAGGAATTTCTGCAGAAAATCTTCCAGA
AATGGGGAACGTTATGTGCCAGTCATCCATGGAAAGTCATTCTTGGTTCA
CTTTTCTTTATTCTTGTTTGCTCTTTGGGACTCTTGAAATTTACAGTCAT
CACAAACCCAGTTGAGTTATGGTCGTCACCAACTACCCAGGCAAGAATGG
AGAAGAGCTATTATGATGAAAAATTCACCCCATTCTATCGTACAGAACAG
GTTATCATCACCAGCACTGTAAAAAATAATACAGAAGAATTCTATCCATA
CCAAGTTTCATCTCCAACAAACTTTTCTGGGATCATGACTAAAGAAATGC
TTTTTCGAATGTTCAACCACGCACAGACTATATCAAAGATTGCGTTTTTA
CATGCGAAATATGAAAACATAGTGCAGAGTTTTTTGCCAAGGCACTCAGG
ACTTGTCGTTGAGTCGAACCACCCATTCGACCCAAAAATCTTTATAAACT
CAAACTGGATTGTGTCAATTGATTATTTCCTTCTAGATATGAAATACAGA
ATGATTACTTTGTTCAAATTTATGGTACTACTTTATGCTGGAAGCCAGAT
TTACTACTTCCGAATGTACATGGGTATAATCATTATGGGATTCCTTCACG
GGCTCGTCTTTCTACCCGTATTTCTCAGTTACGTTGGCCCGGCATCCCGT
GCAACGGAAGAAGACGTTAAACGTGCCTCCATGGCAACCAACGCCCATCC
AGCTGCAAGGGAAAAGAAATTAATAAGCGCGTAAGTATTAAGCGGTATCA
CTATTACAAAGTTCGTTGGAGTCTTCGTATTGTGGTTTTCGAAATCCGAG
CTTTTTGAGATCTTGGTGTTCTCCATCTATCTCGGAATCAGCGCCTGTTT
CATTACAAATCTCAGTCTTGGAATTTCTCAAACCATTGCTCTACCTAGAG
ACTCTTTCCTAATGAATTATTTTGGAAACTTGTCAACATACTTGAAAACT
GGTGCCCCAGTATACTTCGTAGTCAAAGATGGATTTGATTACTCAAAGGT
TGAAAATCAGAACTTATTGTGTGGCTCTTCAGGCTGTAATAGTAACTCAT
TACTTGGAGAAGTGTTTTTCAGTTCGTTGAATCCCAACTATACATCAGTA
GCATTGCCAGCTTCATCTTGGCTTGATGATTACTTTTCGTGGTTGGACCC
TGACGTCAAATGTTGTCGCTTAAGAAATGGTAGCACTCCACTTAACATGA
ACTTCTGTCCAGCAACAGATCCATTAGAATGGAGGAATTGTACCTCTTGT
TTACCGAAAAACGAATCAGCACAGAGACCACGACCAGCTGAATTCAGGAA
ATTTTTGCAACAATATTTAAAAGATAATCCATCTAAAGATTGTAGTAAAG
GAGGTCATGCAGCTTACGGAGGAGCAGTTAAATTGAACGCACCAGTCGAT
GGAGAATATAGTGTGGATGCTTCCTACTTTATGACCTATCATACTGTATC
AACAACATCAGATGAATTCACACACTCCATGAAATATGCTCGTGAATTGG
CTAGCAACATGACAGAGCGTATCAACCACGATGTTTTCGCATACAGTGTT
TTCTACGTGTTTTATGAACAATATTTAACCATTGTCAGTGACACTTGGAA
AGATTTATTAATCTGCGCATCTGGTGTGTTTGCTGTCACCTTCTTGCTTA
TGGGATTCAACTTTGGATTAGCTTTCTGTATTATTGTGACGGTTGCCATG
ATTGTTGTAGACTTAATGGGGTTGATGTACCTCTGGAATATAAGCTTGAA
CGCAGTGTCATTGGTCAATCTTATGATGGCTATTGGTATATCAGTGGAAT
TTTGTGCGCACATTGGCCGGGCATTTAGTACCAGTCCTTATTCATCACGT
GTCAAGAGAGCAGAAGATGCCCTGGGCACTGTTGGTAGTAGTGTGCCCTT
TCAACTATGCCTGCAGTTCATACATTCGCCGTTTTTGCATGCTTTGCTGT
ATTTTTCAACTTTATTCTTCAAATGACAATGTTGGTTGCTGTGGTAACGT
TGGACAAAAAGAGACAAGATAACAGCCGTTATGACATCTTGTGTTGTGCA
TCGGGAGATAAAAATGCTCCAAACAGTGAAGAATGTTGTGAAGGAGGAGT
TCTACACTTTATTGTCAAGAAAATTTATGCACCCACTCTTATGTTATACC
CAGTCAGAGTTACCGTTATTGATGCAAAAGTCACAGTTGGTATCATTGGT
GTTTTGATTGTCTTGCTTTCTGTTGCCGCATCATTGGGGGCTTGTTCATA
CTTTGGTACACCAGCCACATTGATCATCATTGAAGTCATTCCCTTCTTGG
TTCTTGCTGTTGGTGTGGATAATATCTTTATTTTAGTTCAAGCTCTTCAA
CGTGATATCCGATTGCCAGCTGAAAATACCTCAGAACAAGTTGGACGTGT
TGTTGGTGTTGTGGGTCCAAGCATGCTTCTTTCTTCCCTCTCTGAATCTG
TTGCATTCGGTTTCGAAACCCAACTGCCATGGAATTGGAACCACACATGA
AATTACCTTGCATGGGTAAATTTGGTGGACCTGTCACTCCTAAACTTGCA
CTTGGCGGTTTTGAGGGCGATGACTACAGCACTGCGACAACACTCATCAT
TACTTTTGTTGTCAACAATCACAGAGATGAAAGTAAAAATAAGAAAGCGG
AAGCATGGGAAAAAGTGTTTATTGATTACCTTAAAAAATGGGAGCAAGAT
CCGGAGTTGAGTGCTAATCTTACCATAGCATACACAAGTGAAAGATCAAT
TCAAGATGAAATCACACGTGCCAGTGAATCTGACGTCCTTACGATTGCTA
TCAGTTACTGTCTTATGTTTTTGTATATCGCTGTTGGTCTAGGACAATTT
CGATCGCTTAGTCGTATGTTGGTTCTTGATCTTCAACTTGATCTGATGAA
TCTTACTGCTGAATACAATGGAGAAACAGTTGCTTTGAATGACATCTGCT
ATCAACCACTCTACCCTGATAATAAAGATTGTGCTGTCATGAGTGTTCTT
CAGTATTGGCAATTGGATGCCAAAAAGTTAAACATGTGTATAACTAATAT
GGATTCAGACTGTTCTGCCGGTTTTGGTTCACGTGCTGCTGATTGGCATG
ACCAATTTTCTGGTTGTACCAAGTCTTGGCTCAAACCAATATTCGAAAAG
ATGGCTATTGTGTCATGTATGGTCAGATGGCACCAGGAACAGAAATTGTC
AACCCTTACAATGGACCTGCTAAAAACTTTTCAGAAGAATCTTATAAAAT
TCTTGCAGAAACATGCCCACATCTTGCTCATGGAATTAATGAAACTGTTG
GCTGTTGTGGTATTGGTCAACTTAAATCATTGGAAAAGAATTTGAAGACT
GCAGCCACCTTGTTCTCTAGATGTCCCTCTTGCTCTAAGAACTTCTATAA
CATGTGGTGTGACTTCACTTGTTCACCAAACCAATCAGAATTTATGGATT
ATACCTATGGAATGGCTACTTATTATGTTTCTGATAAGTATGCAAATGAT
CTTTATGGCTCTTGCAAGGATGTCACATTTCCTGGAAGCAATGGAAAAGT
TATGGATTTGATGTGTGGTACAACTGCCAAGTTATGTACAACCGAAAAAT
TCTTGAAATTTGTTGGAACACCTGGAAATGGAGCTCCTTTTAATATTATG
TTTAATATTGGACTCAATGTGTCAGGTGTTGAAAACCATGACGCACATAT
GGTTGGATGCAATGAAACCTATGCTATTTCAAGTGATAAAAACAGTACTG
TTTGCTCTTGTCAAGATTGTCAACCTTCGTGCCCTGTTCCTCCTTCCCCG
CCACAACCAAAACCAATCAAATACATCATGGGAATCAGAGAAACCTATTT
CATCACTGGTGTTGTGCTTCTTGTTTGGGTCTTTGTTTTTCTTGCTTTTA
GTGTATTTGAAATCTTTCGATCTCGTGATTCTTCTCTTGAGGCACGCGCT
GATGCTGTGCACAGTGGATCGGTATCTTCTAATGGATCAGGCTATCACAA
TTCAACTACAGCCTTGTATGGTGGTTATCAGCAAAACCCTGGAAAATGTG
TTGGTTTGGGAATCAAAGCTGAGGAATTTCTGCAGAAAATCTTCCAGAAA
TGGGGAACGTTATGTGCCAGTCATCCATGGAAAGTCATTCTTGGTTCACT
TTTCTTTATTCTTGTTTGCTCTTTGGGACTCTTGAAATTTACAGTCATCA
CAAACCCAGTTGAGTTATGGTCGTCACCAACTACCCAGGCAAGAATGGAG
AAGAGCTATTATGATGAAAAATTCACCCCATTCTATCGTACAGAACAGGT
TATCATCACCAGCACTGTAAAAAATAATACAGAAGAATTCTATCCATACC
AAGTTTCATCTCCAACAAACTTTTCTGGGATCATGACTAAAGAAATGCTT
TTTCGAATGTTCAACCACGCACAGACTATATCAAAGATTGCGTTTTTACA
TGCGAAATATGAAAACATAGTGCAGAGTTTTTTGCCAAGGCACTCAGGAC
TTGTCGTTGAGTCGAACCACCCATTCGACCCAAAAATCTTTATAAACTCA
AACTGGATTGTGTCAATTGATTATTTCCTTCTAGATATGAAATACAGAAT
GATTACTTTGTTCAAATTTATGGTACTACTTTATGCTGGAAGCCAGATTT
ACTACTTCCGAATGTACATGGGTATAATCATTATGGGATTCCTTCACGGG
CTCGTCTTTCTACCCGTATTTCTCAGTTACGTTGGCCCGGCATCCCGTGC
AACGGAAGAAGACGTTAAACGTGCCTCCATGGCAACCAACGCCCATCCAG
CTGCAAGGGAAAAGAAATTAATAAGCGCGTAAGTATTAAGCGGTATCACT
ATTACAAAGTTCGTTGGAGTCTTCGTATTGTGGTTTTCGAAATCCGAGCT
TTTTGAGATCTTGGTGTTCTCCATCTATCTCGGAATCAGCGCCTGTTTCA
TTACAAATCTCAGTCTTGGAATTTCTCAAACCATTGCTCTACCTAGAGAC
TCTTTCCTAATGAATTATTTTGGAAACTTGTCAACATACTTGAAAACTGG
TGCCCCAGTATACTTCGTAGTCAAAGATGGATTTGATTACTCAAAGGTTG
AAAATCAGAACTTATTGTGTGGCTCTTCAGGCTGTAATAGTAACTCATTA
CTTGGAGAAGTGTTTTTCAGTTCGTTGAATCCCAACTATACATCAGTAGC
ATTGCCAGCTTCATCTTGGCTTGATGATTACTTTTCGTGGTTGGACCCTG
ACGTCAAATGTTGTCGCTTAAGAAATGGTAGCACTCCACTTAACATGAAC
TTCTGTCCAGCAACAGATCCATTAGAATGGAGGAATTGTACCTCTTGTTT
ACCGAAAAACGAATCAGCACAGAGACCACGACCAGCTGAATTCAGGAAAT
TTTTGCAACAATATTTAAAAGATAATCCATCTAAAGATTGTAGTAAAGGA
GGTCATGCAGCTTACGGAGGAGCAGTTAAATTGAACGCACCAGTCGATGG
AGAATATAGTGTGGATGCTTCCTACTTTATGACCTATCATACTGTATCAA
CAACATCAGATGAATTCACACACTCCATGAAATATGCTCGTGAATTGGCT
AGCAACATGACAGAGCGTATCAACCACGATGTTTTCGCATACAGTGTTTT
CTACGTGTTTTATGAACAATATTTAACCATTGTCAGTGACACTTGGAAAG
ATTTATTAATCTGCGCATCTGGTGTGTTTGCTGTCACCTTCTTGCTTATG
GGATTCAACTTTGGATTAGCTTTCTGTATTATTGTGACGGTTGCCATGAT
TGTTGTAGACTTAATGGGGTTGATGTACCTCTGGAATATAAGCTTGAACG
CAGTGTCATTGGTCAATCTTATGATGGCTATTGGTATATCAGTGGAATTT
TGTGCGCACATTGGCCGGGCATTTAGTACCAGTCCTTATTCATCACGTGT
CAAGAGAGCAGAAGATGCCCTGGGCACTGTTGGTAGTAGTGTGCCCTTTC
AACTATGCCTGCAGTTCATACATTCGCCGTTTTTGCATGCTTTGCTGTAT
TTTTCAACTTTATTCTTCAAATGACAATGTTGGTTGCTGTGGTAACGTTG
GACAAAAAGAGACAAGATAACAGCCGTTATGACATCTTGTGTTGTGCATC
GGGAGATAAAAATGCTCCAAACAGTGAAGAATGTTGTGAAGGAGGAGTTC
TACACTTTATTGTCAAGAAAATTTATGCACCCACTCTTATGTTATACCCA
GTCAGAGTTACCGTTATTGATGCAAAAGTCACAGTTGGTATCATTGGTGT
TTTGATTGTCTTGCTTTCTGTTGCCGCATCATTGGGGGCTTGTTCATACT
TTGGTACACCAGCCACATTGATCATCATTGAAGTCATTCCCTTCTTGGTT
CTTGCTGTTGGTGTGGATAATATCTTTATTTTAGTTCAAGCTCTTCAACG
TGATATCCGATTGCCAGCTGAAAATACCTCAGAACAAGTTGGACGTGTTG
TTGGTGTTGTGGGTCCAAGCATGCTTCTTTCTTCCCTCTCTGAATCTGTT
GCATTCGGTTTCGAAACCCAACTGCCATGGAATTGGAACCACACATGAAA
TTACCTTGCATGGGTAAATTTGGTGGACCTGTCACTCCTAAACTTGCACT
TGGCGGTTTTGAGGGCGATGACTACAGCACTGCGACAACACTCATCATTA
CTTTTGTTGTCAACAATCACAGAGATGAAAGTAAAAATAAGAAAGCGGAA
GCATGGGAAAAAGTGTTTATTGATTACCTTAAAAAATGGGAGCAAGATCC
GGAGTTGAGTGCTAATCTTACCATAGCATACACAAGTGAAAGATCAATTC
AAGATGAAATCACACGTGCCAGTGAATCTGACGTCCTTACGATTGCTATC
AGTTACTGTCTTATGTTTTTGTATATCGCTGTTGGTCTAGGACAATTTCG
ATCGCTTAGTCGTATGTTGGTTCTTGATCTTCAACTTGATCTGATGAATC
TTACTGCTGAATACAATGGAGAAACAGTTGCTTTGAATGACATCTGCTAT
CAACCACTCTACCCTGATAATAAAGATTGTGCTGTCATGAGTGTTCTTCA
GTATTGGCAATTGGATGCCAAAAAGTTAAACATGTGTATAACTAATATGG
ATTCAGACTGTTCTGCCGGTTTTGGTTCACGTGCTGCTGATTGGCATGAC
CAATTTTCTGGTTGTACCAAGTCTTGGCTCAAACCAATATTCGAAAAGAT
GGCTATTGTGTCATGTATGGTCAGATGGCACCAGGAACAGAAATTGTCAA
CCCTTACAATGGACCTGCTAAAAACTTTTCAGAAGAATCTTATAAAATTC
TTGCAGAAACATGCCCACATCTTGCTCATGGAATTAATGAAACTGTTGGC
TGTTGTGGTATTGGTCAACTTAAATCATTGGAAAAGAATTTGAAGACTGC
AGCCACCTTGTTCTCTAGATGTCCCTCTTGCTCTAAGAACTTCTATAACA
TGTGGTGTGACTTCACTTGTTCACCAAACCAATCAGAATTTATGGATTAT
ACCTATGGAATGGCTACTTATTATGTTTCTGATAAGTATGCAAATGATCT
TTATGGCTCTTGCAAGGATGTCACATTTCCTGGAAGCAATGGAAAAGTTA
TGGATTTGATGTGTGGTACAACTGCCAAGTTATGTACAACCGAAAAATTC
TTGAAATTTGTTGGAACACCTGGAAATGGAGCTCCTTTTAATATTATGTT
TAATATTGGACTCAATGTGTCAGGTGTTGAAAACCATGACGCACATATGG
TTGGATGCAATGAAACCTATGCTATTTCAAGTGATAAAAACAGTACTGTT
TGCTCTTGTCAAGATTGTCAACCTTCGTGCCCTGTTCCTCCTTCCCCGCC
ACAACCAAAACCAATCAAATACATCATGGGAATCAGAGAAACCTATTTCA
TCACTGGTGTTGTGCTTCTTGTTTGGGTCTTTGTTTTTCTTGCTTTTAGT
GTATTTGAAATCTTTCGATCTCGTGATTCTTCTCTTGAGGCACGCGCTGA
TGCTGTGCACAGTGGATCGGTATCTTCTAATGGATCAGGCTATCACAATT
CAACTACAGCCTTGTATGGTGGTTATCAGCAAAACCCTGGAAAATGTGTT
GGTTTGGGAATCAAAGCTGAGGAATTTCTGCAGAAAATCTTCCAGAAATG
GGGAACGTTATGTGCCAGTCATCCATGGAAAGTCATTCTTGGTTCACTTT
TCTTTATTCTTGTTTGCTCTTTGGGACTCTTGAAATTTACAGTCATCACA
AACCCAGTTGAGTTATGGTCGTCACCAACTACCCAGGCAAGAATGGAGAA
GAGCTATTATGATGAAAAATTCACCCCATTCTATCGTACAGAACAGGTTA
TCATCACCAGCACTGTAAAAAATAATACAGAAGAATTCTATCCATACCAA
GTTTCATCTCCAACAAACTTTTCTGGGATCATGACTAAAGAAATGCTTTT
TCGAATGTTCAACCACGCACAGACTATATCAAAGATTGCGTTTTTACATG
CGAAATATGAAAACATAGTGCAGAGTTTTTTGCCAAGGCACTCAGGACTT
GTCGTTGAGTCGAACCACCCATTCGACCCAAAAATCTTTATAAACTCAAA
CTGGATTGTGTCAATTGATTATTTCCTTCTAGATATGAAATACAGAATGA
TTACTTTGTTCAAATTTATGGTACTACTTTATGCTGGAAGCCAGATTTAC
TACTTCCGAATGTACATGGGTATAATCATTATGGGATTCCTTCACGGGCT
CGTCTTTCTACCCGTATTTCTCAGTTACGTTGGCCCGGCATCCCGTGCAA
CGGAAGAAGACGTTAAACGTGCCTCCATGGCAACCAACGCCCATCCAGCT
GCAAGGGAAAAGAAATTAATAAGCGCGTAAGTATTAAGCGGTATCACTAT
TACAAAGTTCGTTGGAGTCTTCGTATTGTGGTTTTCGAAATCCGAGCTTT
TTGAGATCTTGGTGTTCTCCATCTATCTCGGAATCAGCGCCTGTTTCATT
ACAAATCTCAGTCTTGGAATTTCTCAAACCATTGCTCTACCTAGAGACTC
TTTCCTAATGAATTATTTTGGAAACTTGTCAACATACTTGAAAACTGGTG
CCCCAGTATACTTCGTAGTCAAAGATGGATTTGATTACTCAAAGGTTGAA
AATCAGAACTTATTGTGTGGCTCTTCAGGCTGTAATAGTAACTCATTACT
TGGAGAAGTGTTTTTCAGTTCGTTGAATCCCAACTATACATCAGTAGCAT
TGCCAGCTTCATCTTGGCTTGATGATTACTTTTCGTGGTTGGACCCTGAC
GTCAAATGTTGTCGCTTAAGAAATGGTAGCACTCCACTTAACATGAACTT
CTGTCCAGCAACAGATCCATTAGAATGGAGGAATTGTACCTCTTGTTTAC
CGAAAAACGAATCAGCACAGAGACCACGACCAGCTGAATTCAGGAAATTT
TTGCAACAATATTTAAAAGATAATCCATCTAAAGATTGTAGTAAAGGAGG
TCATGCAGCTTACGGAGGAGCAGTTAAATTGAACGCACCAGTCGATGGAG
AATATAGTGTGGATGCTTCCTACTTTATGACCTATCATACTGTATCAACA
ACATCAGATGAATTCACACACTCCATGAAATATGCTCGTGAATTGGCTAG
CAACATGACAGAGCGTATCAACCACGATGTTTTCGCATACAGTGTTTTCT
ACGTGTTTTATGAACAATATTTAACCATTGTCAGTGACACTTGGAAAGAT
TTATTAATCTGCGCATCTGGTGTGTTTGCTGTCACCTTCTTGCTTATGGG
ATTCAACTTTGGATTAGCTTTCTGTATTATTGTGACGGTTGCCATGATTG
TTGTAGACTTAATGGGGTTGATGTACCTCTGGAATATAAGCTTGAACGCA
GTGTCATTGGTCAATCTTATGATGGCTATTGGTATATCAGTGGAATTTTG
TGCGCACATTGGCCGGGCATTTAGTACCAGTCCTTATTCATCACGTGTCA
AGAGAGCAGAAGATGCCCTGGGCACTGTTGGTAGTAGTGTGCCCTTTCAA
CTATGCCTGCAGTTCATACATTCGCCGTTTTTGCATGCTTTGCTGTATTT
TTCAACTTTATTCTTCAAATGACAATGTTGGTTGCTGTGGTAACGTTGGA
CAAAAAGAGACAAGATAACAGCCGTTATGACATCTTGTGTTGTGCATCGG
GAGATAAAAATGCTCCAAACAGTGAAGAATGTTGTGAAGGAGGAGTTCTA
CACTTTATTGTCAAGAAAATTTATGCACCCACTCTTATGTTATACCCAGT
CAGAGTTACCGTTATTGATGCAAAAGTCACAGTTGGTATCATTGGTGTTT
TGATTGTCTTGCTTTCTGTTGCCGCATCATTGGGGGCTTGTTCATACTTT
GGTACACCAGCCACATTGATCATCATTGAAGTCATTCCCTTCTTGGTTCT
TGCTGTTGGTGTGGATAATATCTTTATTTTAGTTCAAGCTCTTCAACGTG
ATATCCGATTGCCAGCTGAAAATACCTCAGAACAAGTTGGACGTGTTGTT
GGTGTTGTGGGTCCAAGCATGCTTCTTTCTTCCCTCTCTGAATCTGTTGC
ATTCGGTTTCGAAACCCAACTGCCATGGAATTGGAACCACACATGAAATT
ACCTTGCATGGGTAAATTTGGTGGACCTGTCACTCCTAAACTTGCACTTG
GCGGTTTTGAGGGCGATGACTACAGCACTGCGACAACACTCATCATTACT
TTTGTTGTCAACAATCACAGAGATGAAAGTAAAAATAAGAAAGCGGAAGC
ATGGGAAAAAGTGTTTATTGATTACCTTAAAAAATGGGAGCAAGATCCGG
AGTTGAGTGCTAATCTTACCATAGCATACACAAGTGAAAGATCAATTCAA
GATGAAATCACACGTGCCAGTGAATCTGACGTCCTTACGATTGCTATCAG
TTACTGTCTTATGTTTTTGTATATCGCTGTTGGTCTAGGACAATTTCGAT
CGCTTAGTCGTATGTTGGTTCTTGATCTTCAACTTGATCTGATGAATCTT
ACTGCTGAATACAATGGAGAAACAGTTGCTTTGAATGACATCTGCTATCA
ACCACTCTACCCTGATAATAAAGATTGTGCTGTCATGAGTGTTCTTCAGT
ATTGGCAATTGGATGCCAAAAAGTTAAACATGTGTATAACTAATATGGAT
TCAGACTGTTCTGCCGGTTTTGGTTCACGTGCTGCTGATTGGCATGACCA
ATTTTCTGGTTGTACCAAGTCTTGGCTCAAACCAATATTCGAAAAGATGG
CTATTGTGTCATGTATGGTCAGATGGCACCAGGAACAGAAATTGTCAACC
CTTACAATGGACCTGCTAAAAACTTTTCAGAAGAATCTTATAAAATTCTT
GCAGAAACATGCCCACATCTTGCTCATGGAATTAATGAAACTGTTGGCTG
TTGTGGTATTGGTCAACTTAAATCATTGGAAAAGAATTTGAAGACTGCAG
CCACCTTGTTCTCTAGATGTCCCTCTTGCTCTAAGAACTTCTATAACATG
TGGTGTGACTTCACTTGTTCACCAAACCAATCAGAATTTATGGATTATAC
CTATGGAATGGCTACTTATTATGTTTCTGATAAGTATGCAAATGATCTTT
ATGGCTCTTGCAAGGATGTCACATTTCCTGGAAGCAATGGAAAAGTTATG
GATTTGATGTGTGGTACAACTGCCAAGTTATGTACAACCGAAAAATTCTT
GAAATTTGTTGGAACACCTGGAAATGGAGCTCCTTTTAATATTATGTTTA
ATATTGGACTCAATGTGTCAGGTGTTGAAAACCATGACGCACATATGGTT
GGATGCAATGAAACCTATGCTATTTCAAGTGATAAAAACAGTACTGTTTG
CTCTTGTCAAGATTGTCAACCTTCGTGCCCTGTTCCTCCTTCCCCGCCAC
AACCAAAACCAATCAAATACATCATGGGAATCAGAGAAACCTATTTCATC
ACTGGTGTTGTGCTTCTTGTTTGGGTCTTTGTTTTTCTTGCTTTTAGTGT
ATTTGAAATCTTTCGATCTCGTGATTCTTCTCTTGAGGCACGCGCTGATG
CTGTGCACAGTGGATCGGTATCTTCTAATGGATCAGGCTATCACAATTCA
ACTACAGCCTTGTATGGTGGTTATCAGCAAAACCCTGGAAAATGTGTTGG
TTTGGGAATCAAAGCTGAGGAATTTCTGCAGAAAATCTTCCAGAAATGGG
GAACGTTATGTGCCAGTCATCCATGGAAAGTCATTCTTGGTTCACTTTTC
TTTATTCTTGTTTGCTCTTTGGGACTCTTGAAATTTACAGTCATCACAAA
CCCAGTTGAGTTATGGTCGTCACCAACTACCCAGGCAAGAATGGAGAAGA
GCTATTATGATGAAAAATTCACCCCATTCTATCGTACAGAACAGGTTATC
ATCACCAGCACTGTAAAAAATAATACAGAAGAATTCTATCCATACCAAGT
TTCATCTCCAACAAACTTTTCTGGGATCATGACTAAAGAAATGCTTTTTC
GAATGTTCAACCACGCACAGACTATATCAAAGATTGCGTTTTTACATGCG
AAATATGAAAACATAGTGCAGAGTTTTTTGCCAAGGCACTCAGGACTTGT
CGTTGAGTCGAACCACCCATTCGACCCAAAAATCTTTATAAACTCAAACT
GGATTGTGTCAATTGATTATTTCCTTCTAGATATGAAATACAGAATGATT
ACTTTGTTCAAATTTATGGTACTACTTTATGCTGGAAGCCAGATTTACTA
CTTCCGAATGTACATGGGTATAATCATTATGGGATTCCTTCACGGGCTCG
TCTTTCTACCCGTATTTCTCAGTTACGTTGGCCCGGCATCCCGTGCAACG
GAAGAAGACGTTAAACGTGCCTCCATGGCAACCAACGCCCATCCAGCTGC
AAGGGAAAAGAAATTAATAAGCGCGTAAGTATTAAGCGGTATCACTATTA
CAAAGTTCGTTGGAGTCTTCGTATTGTGGTTTTCGAAATCCGAGCTTTTT
GAGATCTTGGTGTTCTCCATCTATCTCGGAATCAGCGCCTGTTTCATTAC
AAATCTCAGTCTTGGAATTTCTCAAACCATTGCTCTACCTAGAGACTCTT
TCCTAATGAATTATTTTGGAAACTTGTCAACATACTTGAAAACTGGTGCC
CCAGTATACTTCGTAGTCAAAGATGGATTTGATTACTCAAAGGTTGAAAA
TCAGAACTTATTGTGTGGCTCTTCAGGCTGTAATAGTAACTCATTACTTG
GAGAAGTGTTTTTCAGTTCGTTGAATCCCAACTATACATCAGTAGCATTG
CCAGCTTCATCTTGGCTTGATGATTACTTTTCGTGGTTGGACCCTGACGT
CAAATGTTGTCGCTTAAGAAATGGTAGCACTCCACTTAACATGAACTTCT
GTCCAGCAACAGATCCATTAGAATGGAGGAATTGTACCTCTTGTTTACCG
AAAAACGAATCAGCACAGAGACCACGACCAGCTGAATTCAGGAAATTTTT
GCAACAATATTTAAAAGATAATCCATCTAAAGATTGTAGTAAAGGAGGTC
ATGCAGCTTACGGAGGAGCAGTTAAATTGAACGCACCAGTCGATGGAGAA
TATAGTGTGGATGCTTCCTACTTTATGACCTATCATACTGTATCAACAAC
ATCAGATGAATTCACACACTCCATGAAATATGCTCGTGAATTGGCTAGCA
ACATGACAGAGCGTATCAACCACGATGTTTTCGCATACAGTGTTTTCTAC
GTGTTTTATGAACAATATTTAACCATTGTCAGTGACACTTGGAAAGATTT
ATTAATCTGCGCATCTGGTGTGTTTGCTGTCACCTTCTTGCTTATGGGAT
TCAACTTTGGATTAGCTTTCTGTATTATTGTGACGGTTGCCATGATTGTT
GTAGACTTAATGGGGTTGATGTACCTCTGGAATATAAGCTTGAACGCAGT
GTCATTGGTCAATCTTATGATGGCTATTGGTATATCAGTGGAATTTTGTG
CGCACATTGGCCGGGCATTTAGTACCAGTCCTTATTCATCACGTGTCAAG
AGAGCAGAAGATGCCCTGGGCACTGTTGGTAGTAGTGTGCCCTTTCAACT
ATGCCTGCAGTTCATACATTCGCCGTTTTTGCATGCTTTGCTGTATTTTT
CAACTTTATTCTTCAAATGACAATGTTGGTTGCTGTGGTAACGTTGGACA
AAAAGAGACAAGATAACAGCCGTTATGACATCTTGTGTTGTGCATCGGGA
GATAAAAATGCTCCAAACAGTGAAGAATGTTGTGAAGGAGGAGTTCTACA
CTTTATTGTCAAGAAAATTTATGCACCCACTCTTATGTTATACCCAGTCA
GAGTTACCGTTATTGATGCAAAAGTCACAGTTGGTATCATTGGTGTTTTG
ATTGTCTTGCTTTCTGTTGCCGCATCATTGGGGGCTTGTTCATACTTTGG
TACACCAGCCACATTGATCATCATTGAAGTCATTCCCTTCTTGGTTCTTG
CTGTTGGTGTGGATAATATCTTTATTTTAGTTCAAGCTCTTCAACGTGAT
ATCCGATTGCCAGCTGAAAATACCTCAGAACAAGTTGGACGTGTTGTTGG
TGTTGTGGGTCCAAGCATGCTTCTTTCTTCCCTCTCTGAATCTGTTGCAT
TCGGTTTCGAAACCCAACTGCCATGGAATTGGAACCACACATGAAATTAC
CTTGCATGGGTAAATTTGGTGGACCTGTCACTCCTAAACTTGCACTTGGC
GGTTTTGAGGGCGATGACTACAGCACTGCGACAACACTCATCATTACTTT
TGTTGTCAACAATCACAGAGATGAAAGTAAAAATAAGAAAGCGGAAGCAT
GGGAAAAAGTGTTTATTGATTACCTTAAAAAATGGGAGCAAGATCCGGAG
TTGAGTGCTAATCTTACCATAGCATACACAAGTGAAAGATCAATTCAAGA
TGAAATCACACGTGCCAGTGAATCTGACGTCCTTACGATTGCTATCAGTT
ACTGTCTTATGTTTTTGTATATCGCTGTTGGTCTAGGACAATTTCGATCG
CTTAGTCGTATGTTGGTTCTTGATCTTCAACTTGATCTGATGAATCTTAC
TGCTGAATACAATGGAGAAACAGTTGCTTTGAATGACATCTGCTATCAAC
CACTCTACCCTGATAATAAAGATTGTGCTGTCATGAGTGTTCTTCAGTAT
TGGCAATTGGATGCCAAAAAGTTAAACATGTGTATAACTAATATGGATTC
AGACTGTTCTGCCGGTTTTGGTTCACGTGCTGCTGATTGGCATGACCAAT
TTTCTGGTTGTACCAAGTCTTGGCTCAAACCAATATTCGAAAAGATGGCT
ATTGTGTCATGTATGGTCAGATGGCACCAGGAACAGAAATTGTCAACCCT
TACAATGGACCTGCTAAAAACTTTTCAGAAGAATCTTATAAAATTCTTGC
AGAAACATGCCCACATCTTGCTCATGGAATTAATGAAACTGTTGGCTGTT
GTGGTATTGGTCAACTTAAATCATTGGAAAAGAATTTGAAGACTGCAGCC
ACCTTGTTCTCTAGATGTCCCTCTTGCTCTAAGAACTTCTATAACATGTG
GTGTGACTTCACTTGTTCACCAAACCAATCAGAATTTATGGATTATACCT
ATGGAATGGCTACTTATTATGTTTCTGATAAGTATGCAAATGATCTTTAT
GGCTCTTGCAAGGATGTCACATTTCCTGGAAGCAATGGAAAAGTTATGGA
TTTGATGTGTGGTACAACTGCCAAGTTATGTACAACCGAAAAATTCTTGA
AATTTGTTGGAACACCTGGAAATGGAGCTCCTTTTAATATTATGTTTAAT
ATTGGACTCAATGTGTCAGGTGTTGAAAACCATGACGCACATATGGTTGG
ATGCAATGAAACCTATGCTATTTCAAGTGATAAAAACAGTACTGTTTGCT
CTTGTCAAGATTGTCAACCTTCGTGCCCTGTTCCTCCTTCCCCGCCACAA
CCAAAACCAATCAAATACATCATGGGAATCAGAGAAACCTATTTCATCAC
TGGTGTTGTGCTTCTTGTTTGGGTCTTTGTTTTTCTTGCTTTTAGTGTAT
TTGAAATCTTTCGATCTCGTGATTCTTCTCTTGAGGCACGCGCTGATGCT
GTGCACAGTGGATCGGTATCTTCTAATGGATCAGGCTATCACAATTCAAC
TACAGCCTTGTATGGTGGTTATCAGCAAAACCCTGGAAAATGTGTTGGTT
TGGGAATCAAAGCTGAGGAATTTCTGCAGAAAATCTTCCAGAAATGGGGA
ACGTTATGTGCCAGTCATCCATGGAAAGTCATTCTTGGTTCACTTTTCTT
TATTCTTGTTTGCTCTTTGGGACTCTTGAAATTTACAGTCATCACAAACC
CAGTTGAGTTATGGTCGTCACCAACTACCCAGGCAAGAATGGAGAAGAGC
TATTATGATGAAAAATTCACCCCATTCTATCGTACAGAACAGGTTATCAT
CACCAGCACTGTAAAAAATAATACAGAAGAATTCTATCCATACCAAGTTT
CATCTCCAACAAACTTTTCTGGGATCATGACTAAAGAAATGCTTTTTCGA
ATGTTCAACCACGCACAGACTATATCAAAGATTGCGTTTTTACATGCGAA
ATATGAAAACATAGTGCAGAGTTTTTTGCCAAGGCACTCAGGACTTGTCG
TTGAGTCGAACCACCCATTCGACCCAAAAATCTTTATAAACTCAAACTGG
ATTGTGTCAATTGATTATTTCCTTCTAGATATGAAATACAGAATGATTAC
TTTGTTCAAATTTATGGTACTACTTTATGCTGGAAGCCAGATTTACTACT
TCCGAATGTACATGGGTATAATCATTATGGGATTCCTTCACGGGCTCGTC
TTTCTACCCGTATTTCTCAGTTACGTTGGCCCGGCATCCCGTGCAACGGA
AGAAGACGTTAAACGTGCCTCCATGGCAACCAACGCCCATCCAGCTGCAA
GGGAAAAGAAATTAATAAGCGCGTAAGTATTAAGCGGTATCACTATTACA
AAGTTCGTTGGAGTCTTCGTATTGTGGTTTTCGAAATCCGAGCTTTTTGA
GATCTTGGTGTTCTCCATCTATCTCGGAATCAGCGCCTGTTTCATTACAA
ATCTCAGTCTTGGAATTTCTCAAACCATTGCTCTACCTAGAGACTCTTTC
CTAATGAATTATTTTGGAAACTTGTCAACATACTTGAAAACTGGTGCCCC
AGTATACTTCGTAGTCAAAGATGGATTTGATTACTCAAAGGTTGAAAATC
AGAACTTATTGTGTGGCTCTTCAGGCTGTAATAGTAACTCATTACTTGGA
GAAGTGTTTTTCAGTTCGTTGAATCCCAACTATACATCAGTAGCATTGCC
AGCTTCATCTTGGCTTGATGATTACTTTTCGTGGTTGGACCCTGACGTCA
AATGTTGTCGCTTAAGAAATGGTAGCACTCCACTTAACATGAACTTCTGT
CCAGCAACAGATCCATTAGAATGGAGGAATTGTACCTCTTGTTTACCGAA
AAACGAATCAGCACAGAGACCACGACCAGCTGAATTCAGGAAATTTTTGC
AACAATATTTAAAAGATAATCCATCTAAAGATTGTAGTAAAGGAGGTCAT
GCAGCTTACGGAGGAGCAGTTAAATTGAACGCACCAGTCGATGGAGAATA
TAGTGTGGATGCTTCCTACTTTATGACCTATCATACTGTATCAACAACAT
CAGATGAATTCACACACTCCATGAAATATGCTCGTGAATTGGCTAGCAAC
ATGACAGAGCGTATCAACCACGATGTTTTCGCATACAGTGTTTTCTACGT
GTTTTATGAACAATATTTAACCATTGTCAGTGACACTTGGAAAGATTTAT
TAATCTGCGCATCTGGTGTGTTTGCTGTCACCTTCTTGCTTATGGGATTC
AACTTTGGATTAGCTTTCTGTATTATTGTGACGGTTGCCATGATTGTTGT
AGACTTAATGGGGTTGATGTACCTCTGGAATATAAGCTTGAACGCAGTGT
CATTGGTCAATCTTATGATGGCTATTGGTATATCAGTGGAATTTTGTGCG
CACATTGGCCGGGCATTTAGTACCAGTCCTTATTCATCACGTGTCAAGAG
AGCAGAAGATGCCCTGGGCACTGTTGGTAGTAGTGTGCCCTTTCAACTAT
GCCTGCAGTTCATACATTCGCCGTTTTTGCATGCTTTGCTGTATTTTTCA
ACTTTATTCTTCAAATGACAATGTTGGTTGCTGTGGTAACGTTGGACAAA
AAGAGACAAGATAACAGCCGTTATGACATCTTGTGTTGTGCATCGGGAGA
TAAAAATGCTCCAAACAGTGAAGAATGTTGTGAAGGAGGAGTTCTACACT
TTATTGTCAAGAAAATTTATGCACCCACTCTTATGTTATACCCAGTCAGA
GTTACCGTTATTGATGCAAAAGTCACAGTTGGTATCATTGGTGTTTTGAT
TGTCTTGCTTTCTGTTGCCGCATCATTGGGGGCTTGTTCATACTTTGGTA
CACCAGCCACATTGATCATCATTGAAGTCATTCCCTTCTTGGTTCTTGCT
GTTGGTGTGGATAATATCTTTATTTTAGTTCAAGCTCTTCAACGTGATAT
CCGATTGCCAGCTGAAAATACCTCAGAACAAGTTGGACGTGTTGTTGGTG
TTGTGGGTCCAAGCATGCTTCTTTCTTCCCTCTCTGAATCTGTTGCATTC
GGTTTCGAAACCCAACTGCCATGGAATTGGAACCACACATGAAATTACCT
TGCATGGGTAAATTTGGTGGACCTGTCACTCCTAAACTTGCACTTGGCGG
TTTTGAGGGCGATGACTACAGCACTGCGACAACACTCATCATTACTTTTG
TTGTCAACAATCACAGAGATGAAAGTAAAAATAAGAAAGCGGAAGCATGG
GAAAAAGTGTTTATTGATTACCTTAAAAAATGGGAGCAAGATCCGGAGTT
GAGTGCTAATCTTACCATAGCATACACAAGTGAAAGATCAATTCAAGATG
AAATCACACGTGCCAGTGAATCTGACGTCCTTACGATTGCTATCAGTTAC
TGTCTTATGTTTTTGTATATCGCTGTTGGTCTAGGACAATTTCGATCGCT
TAGTCGTATGTTGGTTCTTGATCTTCAACTTGATCTGATGAATCTTACTG
CTGAATACAATGGAGAAACAGTTGCTTTGAATGACATCTGCTATCAACCA
CTCTACCCTGATAATAAAGATTGTGCTGTCATGAGTGTTCTTCAGTATTG
GCAATTGGATGCCAAAAAGTTAAACATGTGTATAACTAATATGGATTCAG
ACTGTTCTGCCGGTTTTGGTTCACGTGCTGCTGATTGGCATGACCAATTT
TCTGGTTGTACCAAGTCTTGGCTCAAACCAATATTCGAAAAGATGGCTAT
TGTGTCATGTATGGTCAGATGGCACCAGGAACAGAAATTGTCAACCCTTA
CAATGGACCTGCTAAAAACTTTTCAGAAGAATCTTATAAAATTCTTGCAG
AAACATGCCCACATCTTGCTCATGGAATTAATGAAACTGTTGGCTGTTGT
GGTATTGGTCAACTTAAATCATTGGAAAAGAATTTGAAGACTGCAGCCAC
CTTGTTCTCTAGATGTCCCTCTTGCTCTAAGAACTTCTATAACATGTGGT
GTGACTTCACTTGTTCACCAAACCAATCAGAATTTATGGATTATACCTAT
GGAATGGCTACTTATTATGTTTCTGATAAGTATGCAAATGATCTTTATGG
CTCTTGCAAGGATGTCACATTTCCTGGAAGCAATGGAAAAGTTATGGATT
TGATGTGTGGTACAACTGCCAAGTTATGTACAACCGAAAAATTCTTGAAA
TTTGTTGGAACACCTGGAAATGGAGCTCCTTTTAATATTATGTTTAATAT
TGGACTCAATGTGTCAGGTGTTGAAAACCATGACGCACATATGGTTGGAT
GCAATGAAACCTATGCTATTTCAAGTGATAAAAACAGTACTGTTTGCTCT
TGTCAAGATTGTCAACCTTCGTGCCCTGTTCCTCCTTCCCCGCCACAACC
AAAACCAATCAAATACATCATGGGAATCAGAGAAACCTATTTCATCACTG
GTGTTGTGCTTCTTGTTTGGGTCTTTGTTTTTCTTGCTTTTAGTGTATTT
GAAATCTTTCGATCTCGTGATTCTTCTCTTGAGGCACGCGCTGATGCTGT
GCACAGTGGATCGGTATCTTCTAATGGATCAGGCTATCACAATTCAACTA
CAGCCTTGTATGGTGGTTATCAGCAAAACCCTGGAAAATGTGTTGGTTTG
GGAATCAAAGCTGAGGAATTTCTGCAGAAAATCTTCCAGAAATGGGGAAC
GTTATGTGCCAGTCATCCATGGAAAGTCATTCTTGGTTCACTTTTCTTTA
TTCTTGTTTGCTCTTTGGGACTCTTGAAATTTACAGTCATCACAAACCCA
GTTGAGTTATGGTCGTCACCAACTACCCAGGCAAGAATGGAGAAGAGCTA
TTATGATGAAAAATTCACCCCATTCTATCGTACAGAACAGGTTATCATCA
CCAGCACTGTAAAAAATAATACAGAAGAATTCTATCCATACCAAGTTTCA
TCTCCAACAAACTTTTCTGGGATCATGACTAAAGAAATGCTTTTTCGAAT
GTTCAACCACGCACAGACTATATCAAAGATTGCGTTTTTACATGCGAAAT
ATGAAAACATAGTGCAGAGTTTTTTGCCAAGGCACTCAGGACTTGTCGTT
GAGTCGAACCACCCATTCGACCCAAAAATCTTTATAAACTCAAACTGGAT
TGTGTCAATTGATTATTTCCTTCTAGATATGAAATACAGAATGATTACTT
TGTTCAAATTTATGGTACTACTTTATGCTGGAAGCCAGATTTACTACTTC
CGAATGTACATGGGTATAATCATTATGGGATTCCTTCACGGGCTCGTCTT
TCTACCCGTATTTCTCAGTTACGTTGGCCCGGCATCCCGTGCAACGGAAG
AAGACGTTAAACGTGCCTCCATGGCAACCAACGCCCATCCAGCTGCAAGG
GAAAAGAAATTAATAAGCGCGTAAGTATTAAGCGGTATCACTATTACAAA
GTTCGTTGGAGTCTTCGTATTGTGGTTTTCGAAATCCGAGCTTTTTGAGA
TCTTGGTGTTCTCCATCTATCTCGGAATCAGCGCCTGTTTCATTACAAAT
CTCAGTCTTGGAATTTCTCAAACCATTGCTCTACCTAGAGACTCTTTCCT
AATGAATTATTTTGGAAACTTGTCAACATACTTGAAAACTGGTGCCCCAG
TATACTTCGTAGTCAAAGATGGATTTGATTACTCAAAGGTTGAAAATCAG
AACTTATTGTGTGGCTCTTCAGGCTGTAATAGTAACTCATTACTTGGAGA
AGTGTTTTTCAGTTCGTTGAATCCCAACTATACATCAGTAGCATTGCCAG
CTTCATCTTGGCTTGATGATTACTTTTCGTGGTTGGACCCTGACGTCAAA
TGTTGTCGCTTAAGAAATGGTAGCACTCCACTTAACATGAACTTCTGTCC
AGCAACAGATCCATTAGAATGGAGGAATTGTACCTCTTGTTTACCGAAAA
ACGAATCAGCACAGAGACCACGACCAGCTGAATTCAGGAAATTTTTGCAA
CAATATTTAAAAGATAATCCATCTAAAGATTGTAGTAAAGGAGGTCATGC
AGCTTACGGAGGAGCAGTTAAATTGAACGCACCAGTCGATGGAGAATATA
GTGTGGATGCTTCCTACTTTATGACCTATCATACTGTATCAACAACATCA
GATGAATTCACACACTCCATGAAATATGCTCGTGAATTGGCTAGCAACAT
GACAGAGCGTATCAACCACGATGTTTTCGCATACAGTGTTTTCTACGTGT
TTTATGAACAATATTTAACCATTGTCAGTGACACTTGGAAAGATTTATTA
ATCTGCGCATCTGGTGTGTTTGCTGTCACCTTCTTGCTTATGGGATTCAA
CTTTGGATTAGCTTTCTGTATTATTGTGACGGTTGCCATGATTGTTGTAG
ACTTAATGGGGTTGATGTACCTCTGGAATATAAGCTTGAACGCAGTGTCA
TTGGTCAATCTTATGATGGCTATTGGTATATCAGTGGAATTTTGTGCGCA
CATTGGCCGGGCATTTAGTACCAGTCCTTATTCATCACGTGTCAAGAGAG
CAGAAGATGCCCTGGGCACTGTTGGTAGTAGTGTGCCCTTTCAACTATGC
CTGCAGTTCATACATTCGCCGTTTTTGCATGCTTTGCTGTATTTTTCAAC
TTTATTCTTCAAATGACAATGTTGGTTGCTGTGGTAACGTTGGACAAAAA
GAGACAAGATAACAGCCGTTATGACATCTTGTGTTGTGCATCGGGAGATA
AAAATGCTCCAAACAGTGAAGAATGTTGTGAAGGAGGAGTTCTACACTTT
ATTGTCAAGAAAATTTATGCACCCACTCTTATGTTATACCCAGTCAGAGT
TACCGTTATTGATGCAAAAGTCACAGTTGGTATCATTGGTGTTTTGATTG
TCTTGCTTTCTGTTGCCGCATCATTGGGGGCTTGTTCATACTTTGGTACA
CCAGCCACATTGATCATCATTGAAGTCATTCCCTTCTTGGTTCTTGCTGT
TGGTGTGGATAATATCTTTATTTTAGTTCAAGCTCTTCAACGTGATATCC
GATTGCCAGCTGAAAATACCTCAGAACAAGTTGGACGTGTTGTTGGTGTT
GTGGGTCCAAGCATGCTTCTTTCTTCCCTCTCTGAATCTGTTGCATTCGG
TTTCGAAACCCAACTGCCATGGAATTGGAACCACACATGAAATTACCTTG
CATGGGTAAATTTGGTGGACCTGTCACTCCTAAACTTGCACTTGGCGGTT
TTGAGGGCGATGACTACAGCACTGCGACAACACTCATCATTACTTTTGTT
GTCAACAATCACAGAGATGAAAGTAAAAATAAGAAAGCGGAAGCATGGGA
AAAAGTGTTTATTGATTACCTTAAAAAATGGGAGCAAGATCCGGAGTTGA
GTGCTAATCTTACCATAGCATACACAAGTGAAAGATCAATTCAAGATGAA
ATCACACGTGCCAGTGAATCTGACGTCCTTACGATTGCTATCAGTTACTG
TCTTATGTTTTTGTATATCGCTGTTGGTCTAGGACAATTTCGATCGCTTA
GTCGTATGTTGGTTCTTGATCTTCAACTTGATCTGATGAATCTTACTGCT
GAATACAATGGAGAAACAGTTGCTTTGAATGACATCTGCTATCAACCACT
CTACCCTGATAATAAAGATTGTGCTGTCATGAGTGTTCTTCAGTATTGGC
AATTGGATGCCAAAAAGTTAAACATGTGTATAACTAATATGGATTCAGAC
TGTTCTGCCGGTTTTGGTTCACGTGCTGCTGATTGGCATGACCAATTTTC
TGGTTGTACCAAGTCTTGGCTCAAACCAATATTCGAAAAGATGGCTATTG
TGTCATGTATGGTCAGATGGCACCAGGAACAGAAATTGTCAACCCTTACA
ATGGACCTGCTAAAAACTTTTCAGAAGAATCTTATAAAATTCTTGCAGAA
ACATGCCCACATCTTGCTCATGGAATTAATGAAACTGTTGGCTGTTGTGG
TATTGGTCAACTTAAATCATTGGAAAAGAATTTGAAGACTGCAGCCACCT
TGTTCTCTAGATGTCCCTCTTGCTCTAAGAACTTCTATAACATGTGGTGT
GACTTCACTTGTTCACCAAACCAATCAGAATTTATGGATTATACCTATGG
AATGGCTACTTATTATGTTTCTGATAAGTATGCAAATGATCTTTATGGCT
CTTGCAAGGATGTCACATTTCCTGGAAGCAATGGAAAAGTTATGGATTTG
ATGTGTGGTACAACTGCCAAGTTATGTACAACCGAAAAATTCTTGAAATT
TGTTGGAACACCTGGAAATGGAGCTCCTTTTAATATTATGTTTAATATTG
GACTCAATGTGTCAGGTGTTGAAAACCATGACGCACATATGGTTGGATGC
AATGAAACCTATGCTATTTCAAGTGATAAAAACAGTACTGTTTGCTCTTG
TCAAGATTGTCAACCTTCGTGCCCTGTTCCTCCTTCCCCGCCACAACCAA
AACCAATCAAATACATCATGGGAATCAGAGAAACCTATTTCATCACTGGT
GTTGTGCTTCTTGTTTGGGTCTTTGTTTTTCTTGCTTTTAGTGTATTTGA
AATCTTTCGATCTCGTGATTCTTCTCTTGAGGCACGCGCTGATGCTGTGC
ACAGTGGATCGGTATCTTCTAATGGATCAGGCTATCACAATTCAACTACA
GCCTTGTATGGTGGTTATCAGCAAAACCCTGGAAAATGTGTTGGTTTGGG
AATCAAAGCTGAGGAATTTCTGCAGAAAATCTTCCAGAAATGGGGAACGT
TATGTGCCAGTCATCCATGGAAAGTCATTCTTGGTTCACTTTTCTTTATT
CTTGTTTGCTCTTTGGGACTCTTGAAATTTACAGTCATCACAAACCCAGT
TGAGTTATGGTCGTCACCAACTACCCAGGCAAGAATGGAGAAGAGCTATT
ATGATGAAAAATTCACCCCATTCTATCGTACAGAACAGGTTATCATCACC
AGCACTGTAAAAAATAATACAGAAGAATTCTATCCATACCAAGTTTCATC
TCCAACAAACTTTTCTGGGATCATGACTAAAGAAATGCTTTTTCGAATGT
TCAACCACGCACAGACTATATCAAAGATTGCGTTTTTACATGCGAAATAT
GAAAACATAGTGCAGAGTTTTTTGCCAAGGCACTCAGGACTTGTCGTTGA
GTCGAACCACCCATTCGACCCAAAAATCTTTATAAACTCAAACTGGATTG
TGTCAATTGATTATTTCCTTCTAGATATGAAATACAGAATGATTACTTTG
TTCAAATTTATGGTACTACTTTATGCTGGAAGCCAGATTTACTACTTCCG
AATGTACATGGGTATAATCATTATGGGATTCCTTCACGGGCTCGTCTTTC
TACCCGTATTTCTCAGTTACGTTGGCCCGGCATCCCGTGCAACGGAAGAA
GACGTTAAACGTGCCTCCATGGCAACCAACGCCCATCCAGCTGCAAGGGA
AAAGAAATTAATAAGCGCGTAAGTATTAAGCGGTATCACTATTACAAAGT
TCGTTGGAGTCTTCGTATTGTGGTTTTCGAAATCCGAGCTTTTTGAGATC
TTGGTGTTCTCCATCTATCTCGGAATCAGCGCCTGTTTCATTACAAATCT
CAGTCTTGGAATTTCTCAAACCATTGCTCTACCTAGAGACTCTTTCCTAA
TGAATTATTTTGGAAACTTGTCAACATACTTGAAAACTGGTGCCCCAGTA
TACTTCGTAGTCAAAGATGGATTTGATTACTCAAAGGTTGAAAATCAGAA
CTTATTGTGTGGCTCTTCAGGCTGTAATAGTAACTCATTACTTGGAGAAG
TGTTTTTCAGTTCGTTGAATCCCAACTATACATCAGTAGCATTGCCAGCT
TCATCTTGGCTTGATGATTACTTTTCGTGGTTGGACCCTGACGTCAAATG
TTGTCGCTTAAGAAATGGTAGCACTCCACTTAACATGAACTTCTGTCCAG
CAACAGATCCATTAGAATGGAGGAATTGTACCTCTTGTTTACCGAAAAAC
GAATCAGCACAGAGACCACGACCAGCTGAATTCAGGAAATTTTTGCAACA
ATATTTAAAAGATAATCCATCTAAAGATTGTAGTAAAGGAGGTCATGCAG
CTTACGGAGGAGCAGTTAAATTGAACGCACCAGTCGATGGAGAATATAGT
GTGGATGCTTCCTACTTTATGACCTATCATACTGTATCAACAACATCAGA
TGAATTCACACACTCCATGAAATATGCTCGTGAATTGGCTAGCAACATGA
CAGAGCGTATCAACCACGATGTTTTCGCATACAGTGTTTTCTACGTGTTT
TATGAACAATATTTAACCATTGTCAGTGACACTTGGAAAGATTTATTAAT
CTGCGCATCTGGTGTGTTTGCTGTCACCTTCTTGCTTATGGGATTCAACT
TTGGATTAGCTTTCTGTATTATTGTGACGGTTGCCATGATTGTTGTAGAC
TTAATGGGGTTGATGTACCTCTGGAATATAAGCTTGAACGCAGTGTCATT
GGTCAATCTTATGATGGCTATTGGTATATCAGTGGAATTTTGTGCGCACA
TTGGCCGGGCATTTAGTACCAGTCCTTATTCATCACGTGTCAAGAGAGCA
GAAGATGCCCTGGGCACTGTTGGTAGTAGTGTGCCCTTTCAACTATGCCT
GCAGTTCATACATTCGCCGTTTTTGCATGCTTTGCTGTATTTTTCAACTT
TATTCTTCAAATGACAATGTTGGTTGCTGTGGTAACGTTGGACAAAAAGA
GACAAGATAACAGCCGTTATGACATCTTGTGTTGTGCATCGGGAGATAAA
AATGCTCCAAACAGTGAAGAATGTTGTGAAGGAGGAGTTCTACACTTTAT
TGTCAAGAAAATTTATGCACCCACTCTTATGTTATACCCAGTCAGAGTTA
CCGTTATTGATGCAAAAGTCACAGTTGGTATCATTGGTGTTTTGATTGTC
TTGCTTTCTGTTGCCGCATCATTGGGGGCTTGTTCATACTTTGGTACACC
AGCCACATTGATCATCATTGAAGTCATTCCCTTCTTGGTTCTTGCTGTTG
GTGTGGATAATATCTTTATTTTAGTTCAAGCTCTTCAACGTGATATCCGA
TTGCCAGCTGAAAATACCTCAGAACAAGTTGGACGTGTTGTTGGTGTTGT
GGGTCCAAGCATGCTTCTTTCTTCCCTCTCTGAATCTGTTGCATTCGGTT
TCGAAACCCAACTGCCATGGAATTGGAACCACACATGAAATTACCTTGCA
TGGGTAAATTTGGTGGACCTGTCACTCCTAAACTTGCACTTGGCGGTTTT
GAGGGCGATGACTACAGCACTGCGACAACACTCATCATTACTTTTGTTGT
CAACAATCACAGAGATGAAAGTAAAAATAAGAAAGCGGAAGCATGGGAAA
AAGTGTTTATTGATTACCTTAAAAAATGGGAGCAAGATCCGGAGTTGAGT
GCTAATCTTACCATAGCATACACAAGTGAAAGATCAATTCAAGATGAAAT
CACACGTGCCAGTGAATCTGACGTCCTTACGATTGCTATCAGTTACTGTC
TTATGTTTTTGTATATCGCTGTTGGTCTAGGACAATTTCGATCGCTTAGT
CGTATGTTGGTTCTTGATCTTCAACTTGATCTGATGAATCTTACTGCTGA
ATACAATGGAGAAACAGTTGCTTTGAATGACATCTGCTATCAACCACTCT
ACCCTGATAATAAAGATTGTGCTGTCATGAGTGTTCTTCAGTATTGGCAA
TTGGATGCCAAAAAGTTAAACATGTGTATAACTAATATGGATTCAGACTG
TTCTGCCGGTTTTGGTTCACGTGCTGCTGATTGGCATGACCAATTTTCTG
GTTGTACCAAGTCTTGGCTCAAACCAATATTCGAAAAGATGGCTATTGTG
TCATGTATGGTCAGATGGCACCAGGAACAGAAATTGTCAACCCTTACAAT
GGACCTGCTAAAAACTTTTCAGAAGAATCTTATAAAATTCTTGCAGAAAC
ATGCCCACATCTTGCTCATGGAATTAATGAAACTGTTGGCTGTTGTGGTA
TTGGTCAACTTAAATCATTGGAAAAGAATTTGAAGACTGCAGCCACCTTG
TTCTCTAGATGTCCCTCTTGCTCTAAGAACTTCTATAACATGTGGTGTGA
CTTCACTTGTTCACCAAACCAATCAGAATTTATGGATTATACCTATGGAA
TGGCTACTTATTATGTTTCTGATAAGTATGCAAATGATCTTTATGGCTCT
TGCAAGGATGTCACATTTCCTGGAAGCAATGGAAAAGTTATGGATTTGAT
GTGTGGTACAACTGCCAAGTTATGTACAACCGAAAAATTCTTGAAATTTG
TTGGAACACCTGGAAATGGAGCTCCTTTTAATATTATGTTTAATATTGGA
CTCAATGTGTCAGGTGTTGAAAACCATGACGCACATATGGTTGGATGCAA
TGAAACCTATGCTATTTCAAGTGATAAAAACAGTACTGTTTGCTCTTGTC
AAGATTGTCAACCTTCGTGCCCTGTTCCTCCTTCCCCGCCACAACCAAAA
CCAATCAAATACATCATGGGAATCAGAGAAACCTATTTCATCACTGGTGT
TGTGCTTCTTGTTTGGGTCTTTGTTTTTCTTGCTTTTAGTGTATTTGAAA
TCTTTCGATCTCGTGATTCTTCTCTTGAGGCACGCGCTGATGCTGTGCAC
AGTGGATCGGTATCTTCTAATGGATCAGGCTATCACAATTCAACTACAGC
CTTGTATGGTGGTTATCAGCAAAACCCTGGAAAATGTGTTGGTTTGGGAA
TCAAAGCTGAGGAATTTCTGCAGAAAATCTTCCAGAAATGGGGAACGTTA
TGTGCCAGTCATCCATGGAAAGTCATTCTTGGTTCACTTTTCTTTATTCT
TGTTTGCTCTTTGGGACTCTTGAAATTTACAGTCATCACAAACCCAGTTG
AGTTATGGTCGTCACCAACTACCCAGGCAAGAATGGAGAAGAGCTATTAT
GATGAAAAATTCACCCCATTCTATCGTACAGAACAGGTTATCATCACCAG
CACTGTAAAAAATAATACAGAAGAATTCTATCCATACCAAGTTTCATCTC
CAACAAACTTTTCTGGGATCATGACTAAAGAAATGCTTTTTCGAATGTTC
AACCACGCACAGACTATATCAAAGATTGCGTTTTTACATGCGAAATATGA
AAACATAGTGCAGAGTTTTTTGCCAAGGCACTCAGGACTTGTCGTTGAGT
CGAACCACCCATTCGACCCAAAAATCTTTATAAACTCAAACTGGATTGTG
TCAATTGATTATTTCCTTCTAGATATGAAATACAGAATGATTACTTTGTT
CAAATTTATGGTACTACTTTATGCTGGAAGCCAGATTTACTACTTCCGAA
TGTACATGGGTATAATCATTATGGGATTCCTTCACGGGCTCGTCTTTCTA
CCCGTATTTCTCAGTTACGTTGGCCCGGCATCCCGTGCAACGGAAGAAGA
CGTTAAACGTGCCTCCATGGCAACCAACGCCCATCCAGCTGCAAGGGAAA
AGAAATTAATAAGCGCGTAAGTATTAAGCGGTATCACTATTACAAAGTTC
GTTGGAGTCTTCGTATTGTGGTTTTCGAAATCCGAGCTTTTTGAGATCTT
GGTGTTCTCCATCTATCTCGGAATCAGCGCCTGTTTCATTACAAATCTCA
GTCTTGGAATTTCTCAAACCATTGCTCTACCTAGAGACTCTTTCCTAATG
AATTATTTTGGAAACTTGTCAACATACTTGAAAACTGGTGCCCCAGTATA
CTTCGTAGTCAAAGATGGATTTGATTACTCAAAGGTTGAAAATCAGAACT
TATTGTGTGGCTCTTCAGGCTGTAATAGTAACTCATTACTTGGAGAAGTG
TTTTTCAGTTCGTTGAATCCCAACTATACATCAGTAGCATTGCCAGCTTC
ATCTTGGCTTGATGATTACTTTTCGTGGTTGGACCCTGACGTCAAATGTT
GTCGCTTAAGAAATGGTAGCACTCCACTTAACATGAACTTCTGTCCAGCA
ACAGATCCATTAGAATGGAGGAATTGTACCTCTTGTTTACCGAAAAACGA
ATCAGCACAGAGACCACGACCAGCTGAATTCAGGAAATTTTTGCAACAAT
ATTTAAAAGATAATCCATCTAAAGATTGTAGTAAAGGAGGTCATGCAGCT
TACGGAGGAGCAGTTAAATTGAACGCACCAGTCGATGGAGAATATAGTGT
GGATGCTTCCTACTTTATGACCTATCATACTGTATCAACAACATCAGATG
AATTCACACACTCCATGAAATATGCTCGTGAATTGGCTAGCAACATGACA
GAGCGTATCAACCACGATGTTTTCGCATACAGTGTTTTCTACGTGTTTTA
TGAACAATATTTAACCATTGTCAGTGACACTTGGAAAGATTTATTAATCT
GCGCATCTGGTGTGTTTGCTGTCACCTTCTTGCTTATGGGATTCAACTTT
GGATTAGCTTTCTGTATTATTGTGACGGTTGCCATGATTGTTGTAGACTT
AATGGGGTTGATGTACCTCTGGAATATAAGCTTGAACGCAGTGTCATTGG
TCAATCTTATGATGGCTATTGGTATATCAGTGGAATTTTGTGCGCACATT
GGCCGGGCATTTAGTACCAGTCCTTATTCATCACGTGTCAAGAGAGCAGA
AGATGCCCTGGGCACTGTTGGTAGTAGTGTGCCCTTTCAACTATGCCTGC
AGTTCATACATTCGCCGTTTTTGCATGCTTTGCTGTATTTTTCAACTTTA
TTCTTCAAATGACAATGTTGGTTGCTGTGGTAACGTTGGACAAAAAGAGA
CAAGATAACAGCCGTTATGACATCTTGTGTTGTGCATCGGGAGATAAAAA
TGCTCCAAACAGTGAAGAATGTTGTGAAGGAGGAGTTCTACACTTTATTG
TCAAGAAAATTTATGCACCCACTCTTATGTTATACCCAGTCAGAGTTACC
GTTATTGATGCAAAAGTCACAGTTGGTATCATTGGTGTTTTGATTGTCTT
GCTTTCTGTTGCCGCATCATTGGGGGCTTGTTCATACTTTGGTACACCAG
CCACATTGATCATCATTGAAGTCATTCCCTTCTTGGTTCTTGCTGTTGGT
GTGGATAATATCTTTATTTTAGTTCAAGCTCTTCAACGTGATATCCGATT
GCCAGCTGAAAATACCTCAGAACAAGTTGGACGTGTTGTTGGTGTTGTGG
GTCCAAGCATGCTTCTTTCTTCCCTCTCTGAATCTGTTGCATTCGGTTTC
GAAACCCAACTGCCATGGAATTGGAACCACACATGAAATTACCTTGCATG
GGTAAATTTGGTGGACCTGTCACTCCTAAACTTGCACTTGGCGGTTTTGA
GGGCGATGACTACAGCACTGCGACAACACTCATCATTACTTTTGTTGTCA
ACAATCACAGAGATGAAAGTAAAAATAAGAAAGCGGAAGCATGGGAAAAA
GTGTTTATTGATTACCTTAAAAAATGGGAGCAAGATCCGGAGTTGAGTGC
TAATCTTACCATAGCATACACAAGTGAAAGATCAATTCAAGATGAAATCA
CACGTGCCAGTGAATCTGACGTCCTTACGATTGCTATCAGTTACTGTCTT
ATGTTTTTGTATATCGCTGTTGGTCTAGGACAATTTCGATCGCTTAGTCG
TATGTTGGTTCTTGATCTTCAACTTGATCTGATGAATCTTACTGCTGAAT
ACAATGGAGAAACAGTTGCTTTGAATGACATCTGCTATCAACCACTCTAC
CCTGATAATAAAGATTGTGCTGTCATGAGTGTTCTTCAGTATTGGCAATT
GGATGCCAAAAAGTTAAACATGTGTATAACTAATATGGATTCAGACTGTT
CTGCCGGTTTTGGTTCACGTGCTGCTGATTGGCATGACCAATTTTCTGGT
TGTACCAAGTCTTGGCTCAAACCAATATTCGAAAAGATGGCTATTGTGTC
ATGTATGGTCAGATGGCACCAGGAACAGAAATTGTCAACCCTTACAATGG
ACCTGCTAAAAACTTTTCAGAAGAATCTTATAAAATTCTTGCAGAAACAT
GCCCACATCTTGCTCATGGAATTAATGAAACTGTTGGCTGTTGTGGTATT
GGTCAACTTAAATCATTGGAAAAGAATTTGAAGACTGCAGCCACCTTGTT
CTCTAGATGTCCCTCTTGCTCTAAGAACTTCTATAACATGTGGTGTGACT
TCACTTGTTCACCAAACCAATCAGAATTTATGGATTATACCTATGGAATG
GCTACTTATTATGTTTCTGATAAGTATGCAAATGATCTTTATGGCTCTTG
CAAGGATGTCACATTTCCTGGAAGCAATGGAAAAGTTATGGATTTGATGT
GTGGTACAACTGCCAAGTTATGTACAACCGAAAAATTCTTGAAATTTGTT
GGAACACCTGGAAATGGAGCTCCTTTTAATATTATGTTTAATATTGGACT
CAATGTGTCAGGTGTTGAAAACCATGACGCACATATGGTTGGATGCAATG
AAACCTATGCTATTTCAAGTGATAAAAACAGTACTGTTTGCTCTTGTCAA
GATTGTCAACCTTCGTGCCCTGTTCCTCCTTCCCCGCCACAACCAAAACC
AATCAAATACATCATGGGAATCAGAGAAACCTATTTCATCACTGGTGTTG
TGCTTCTTGTTTGGGTCTTTGTTTTTCTTGCTTTTAGTGTATTTGAAATC
TTTCGATCTCGTGATTCTTCTCTTGAGGCACGCGCTGATGCTGTGCACAG
TGGATCGGTATCTTCTAATGGATCAGGCTATCACAATTCAACTACAGCCT
TGTATGGTGGTTATCAGCAAAACCCTGGAAAATGTGTTGGTTTGGGAATC
AAAGCTGAGGAATTTCTGCAGAAAATCTTCCAGAAATGGGGAACGTTATG
TGCCAGTCATCCATGGAAAGTCATTCTTGGTTCACTTTTCTTTATTCTTG
TTTGCTCTTTGGGACTCTTGAAATTTACAGTCATCACAAACCCAGTTGAG
TTATGGTCGTCACCAACTACCCAGGCAAGAATGGAGAAGAGCTATTATGA
TGAAAAATTCACCCCATTCTATCGTACAGAACAGGTTATCATCACCAGCA
CTGTAAAAAATAATACAGAAGAATTCTATCCATACCAAGTTTCATCTCCA
ACAAACTTTTCTGGGATCATGACTAAAGAAATGCTTTTTCGAATGTTCAA
CCACGCACAGACTATATCAAAGATTGCGTTTTTACATGCGAAATATGAAA
ACATAGTGCAGAGTTTTTTGCCAAGGCACTCAGGACTTGTCGTTGAGTCG
AACCACCCATTCGACCCAAAAATCTTTATAAACTCAAACTGGATTGTGTC
AATTGATTATTTCCTTCTAGATATGAAATACAGAATGATTACTTTGTTCA
AATTTATGGTACTACTTTATGCTGGAAGCCAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000094XLOC_000094Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000162-exon-sc0000001-1575043694:481375..481845TCONS_00000162-exon-sc0000001-1575043694:481375..481845Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1575043694:478020..479303TCONS_00000162-exon-sc0000001-1575043694:478020..479303Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1575043694:477603..477853TCONS_00000162-exon-sc0000001-1575043694:477603..477853Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1575043694:476988..477393TCONS_00000162-exon-sc0000001-1575043694:476988..477393Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1575043694:476506..476803TCONS_00000162-exon-sc0000001-1575043694:476506..476803Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1575043694:476021..476295TCONS_00000162-exon-sc0000001-1575043694:476021..476295Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1575043694:474559..475641TCONS_00000162-exon-sc0000001-1575043694:474559..475641Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1575043694:473826..473900TCONS_00000162-exon-sc0000001-1575043694:473826..473900Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1575043694:471270..472013TCONS_00000162-exon-sc0000001-1575043694:471270..472013Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1510915933:481375..481845TCONS_00000162-exon-sc0000001-1510915933:481375..481845Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1510915933:478020..479303TCONS_00000162-exon-sc0000001-1510915933:478020..479303Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1510915933:477603..477853TCONS_00000162-exon-sc0000001-1510915933:477603..477853Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1510915933:476988..477393TCONS_00000162-exon-sc0000001-1510915933:476988..477393Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1510915933:476506..476803TCONS_00000162-exon-sc0000001-1510915933:476506..476803Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1510915933:476021..476295TCONS_00000162-exon-sc0000001-1510915933:476021..476295Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1510915933:474559..475641TCONS_00000162-exon-sc0000001-1510915933:474559..475641Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1510915933:473826..473900TCONS_00000162-exon-sc0000001-1510915933:473826..473900Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1510915933:471270..472013TCONS_00000162-exon-sc0000001-1510915933:471270..472013Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1491911889:481375..481845TCONS_00000162-exon-sc0000001-1491911889:481375..481845Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1491911889:478020..479303TCONS_00000162-exon-sc0000001-1491911889:478020..479303Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1491911889:477603..477853TCONS_00000162-exon-sc0000001-1491911889:477603..477853Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1491911889:476988..477393TCONS_00000162-exon-sc0000001-1491911889:476988..477393Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1491911889:476506..476803TCONS_00000162-exon-sc0000001-1491911889:476506..476803Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1491911889:476021..476295TCONS_00000162-exon-sc0000001-1491911889:476021..476295Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1491911889:474559..475641TCONS_00000162-exon-sc0000001-1491911889:474559..475641Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1491911889:473826..473900TCONS_00000162-exon-sc0000001-1491911889:473826..473900Clytia hemisphaericaexon
TCONS_00000162-exon-sc0000001-1491911889:471270..472013TCONS_00000162-exon-sc0000001-1491911889:471270..472013Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000162-proteinTCONS_00000162-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:471270..481845 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
49.9934 47.7605 101.343 111.909 142.764 104.175 138.572 168.899 246.131 214.249 492.478 209.763 203.01 214.463 167.972 243.851 139.354 207.127 174.226 223.104 404.349 444.523 104.834 129.596 424.911 405.152 100.58 99.4843 336.443 272.123
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR004765NP_C_type
IPR032190NPC1_N
IPR003392Ptc/Disp
IPR000731SSD
Vocabulary: Molecular Function
TermDefinition
GO:0005319lipid transporter activity
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005319 lipid transporter activity
Blast
BLAST of TCONS_00000162 vs. Swiss-Prot (Human)
Match: NPC1 (Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2)

HSP 1 Score: 802.357 bits (2071), Expect = 0.000e+0
Identity = 463/968 (47.83%), Postives = 642/968 (66.32%), Query Frame = 1
Query: 1420 EEFLQKIFQKWGTLCASHPWKVILGSLFFILVCSLGLLKFTVITNPVELWSSPTTQARMEKSYYDEKFTPFYRTEQVIITSTVKNNTEEFYPYQVSSPTNFSGIMTKEMLFRVLDLQLDLMNLTAEYNGETVALNDICYQPLYPDNKDCAVMSVLQYWQ-----LDAKKLNMCITNMDSDCSAGFGSRAADWHDQFSGCTKNPTAMELEPHMKLPCMGKFGGPVTPKLALGGFEGDDYSTATTLIITFVVNNH-RDESKNKKAEAWEKVFIDYLKKWEQDPELSANLTIAYTSERSIQDEITRASESDVLTIAISYCLMFLYIAVGLGQFRSLSRMLIDAKVTXXXXXXXXXXXXXXXXXXXCSYFGTPATLIIIEVIPFLVLAVGVDNIFILVQALQRDIRLPAENTSEQVGRVVGVVGPSMLLSSLSESVAFGFGALSTMPXXXXXXXXXXXXXXXXXILQMTMLVAVVTLDKKRQDNSRYDILCCASGDKNAPNSEECCEGGVLHFIVKKIYAPTLMLYPVRVTVILVFSIYLGISACFITNLSLGISQTIALPRDSFLMNYFGNLSTYLKTGAPVYFVVKDGFDYSKVENQXXXXXXXXXXXXXXXXEVFFSSLNPNYTSVALPASSWLDDYFSWLDPDVKCCRLRNGSTPLNMNFCPAT--DPLEWRNCTSCLPKN-ESAQRPRPAEFRKFLQQYLKDNPSKDCSKGGHAAYGGAVKLNAPVDGEYSVDASYFMTYHTVSTTSDEFTHSMKYARELASNMTERIN-----HDVFAYSVFYVFYEQYLTIVSDTWKDLLICASGVFAVTFLLMGFNFGLAFCIIVTVAMIVVDLMGLMYLWNISLNAVSLVNLMMAIGISVEFCAHIGRAFSTSPYSSRVKRAEDALGTVGSSVLSGITITKFVGVFVLWFSKSELFEIYYFRMYMGIIIMGFLHGLVFLPVFLSYVGPA-----SRATEEDVK 4266
            E  L+++F +WG+ C  +P  VI  SL FI  CS GL+   V TNPV+LWS+P++QAR+EK Y+D+ F PF+RTEQ+II + + +    + PY   +   F   +  ++L +VLDLQ+ + N+TA Y+ ETV L DIC  PL P N +C ++SVL Y+Q     LD KK +                  AD+H  F  C + P ++     +  PC+G FGGPV P L LGG++  +Y+ AT L+ITF VNN+  D  K ++A+AWEK FI+++K ++     + NLTI++T+ERSI+DE+ R S+SDV T+ ISY +MFLYI++ LG  +S  R+L+D+KV++GI G+LIVL SVA SLG  SY G P TLI+IEVIPFLVLAVGVDNIFILVQA QRD RL  E   +Q+GRV+G V PSM LSS SE+VAF  GALS MPAVHTF++FA  AVF +F+LQ+T  V+++ LD KRQ+ +R DI CC  G ++   S +  E  +  F  K  Y+P L+   +R  VI +F   L  S   +  + +G+ Q++++P DS++++YF ++S YL  G PVYFV+++G DY+  + QN++CG  GCN++SL+ ++F ++   NYT +    SSW+DDYF W+ P   CCR+ N    +   FC A+  DP     C  C P   E  QRP+  +F +FL  +L DNP+  C KGGHAAY  AV  N  +     V A+YFMTYHTV  TS +F  ++K AR +ASN+TE +      + VF YSVFYVFYEQYLTI+ DT  +L +    +F VT +L+G     A  +  T+AM++V++ G+M+LW ISLNAVSLVNL+M+ GISVEFC+HI RAF+ S   SRV+RAE+AL  +GSSV SGIT+TKF G+ VL F+KS++F+I+YFRMY+ ++++G  HGL+FLPV LSY+GP+     S ATEE  K
Sbjct:  332 EGCLRRLFTRWGSFCVRNPGCVIFFSLVFITACSSGLVFVRVTTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLIIRAPLTDK-HIYQPYPSGADVPFGPPLDIQILHQVLDLQIAIENITASYDNETVTLQDICLAPLSPYNTNCTILSVLNYFQNSHSVLDHKKGDDFFV-------------YADYHTHFLYCVRAPASLNDTSLLHDPCLGTFGGPVFPWLVLGGYDDQNYNNATALVITFPVNNYYNDTEKLQRAQAWEKEFINFVKNYK-----NPNLTISFTAERSIEDELNRESDSDVFTVVISYAIMFLYISLALGHMKSCRRLLVDSKVSLGIAGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLVLAVGVDNIFILVQAYQRDERLQGETLDQQLGRVLGEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRGAEDG-TSVQASESCLFRFF-KNSYSPLLLKDWMRPIVIAIFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQSSCCRVDN----ITDQFCNASVVDP----ACVRCRPLTPEGKQRPQGGDFMRFLPMFLSDNPNPKCGKGGHAAYSSAV--NILLGHGTRVGATYFMTYHTVLQTSADFIDALKKARLIASNVTETMGINGSAYRVFPYSVFYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGCELWSAVIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSMKGSRVERAEEALAHMGSSVFSGITLTKFGGIVVLAFAKSQIFQIFYFRMYLAMVLLGATHGLIFLPVLLSYIGPSVNKAKSCATEERYK 1268          

HSP 2 Score: 121.324 bits (303), Expect = 2.470e-27
Identity = 75/223 (33.63%), Postives = 116/223 (52.02%), Query Frame = 1
Query:  466 SQVLAQTNIRKDGYCVMYGQ--MAPGTEIVN-PYNGPAKNFSEESYKILAETCPHLAHGINETVGCCGIGQLKSLEKNLKTAATLFSRCPSCSKNFYNMWCDFTCSPNQSEFMDYT----------------YGMATYYVSDKYANDLYGSCKDVTFPGSNGKVMDLMCGTTAKLCTTEKFLKFVGTPGNG-APFNI--MFNIGLNVSGVENHDAHMVGCNET 1068
            +QV +Q+       CV YG+  +A G +  N  Y+GP K   ++ Y ++ E CP    G N ++ CC + QL++L+ NL+      SRCPSC  N  N++C+ TCSP QS+F++ T                     YYV   +AN +Y +C+DV  P SN K + L+CG  A  C    +++++    NG APF I  +F+    V G+E  +    GC+E+
Sbjct:   18 AQVFSQS-------CVWYGECGIAYGDKRYNCEYSGPPKPLPKDGYDLVQELCPGFFFG-NVSL-CCDVRQLQTLKDNLQLPLQFLSRCPSCFYNLLNLFCELTCSPRQSQFLNVTATEDYVDPVTNQTKTNVKELQYYVGQSFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFS-DFPVHGMEPMNNATKGCDES 230          
The following BLAST results are available for this feature:
BLAST of TCONS_00000162 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NPC12.470e-2747.83Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE... [more]
back to top