Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000154 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000154
Unique NameTCONS_00000154
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1723

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000154 ID=TCONS_00000154|Name=TCONS_00000154|organism=Clytia hemisphaerica|type=transcript|length=1723bp
GTATTTTGATTACCTCTTTTCCTCCctgtaaaatattgaaattaatgAAT
TGATTGAATATCTCTGTAATTTTGTGTAAATAAGCTTTTCAgggattttc
aaaatatttttgcacaCGGATCATGAGAAAATTACACCAATGAGCTTTTG
TTTTGAACACGAGTGCAAAATCTTGACTATTCTCTTGTTCCTTCCTCATT
TACTGCAAGTCTAGGTCTTGTAAACAACATACATCGACACACCTCCAAGA
AGCAAAATGTCTGACACAACTGGAAAGGTTATTAAATGCAGAGCTACTGT
AGCATGGGGTGCAAAAGAACCTCTAAAGATGGAAACCATCGAAGTTGACC
CACCAAAAGCTGGTGAAGTACGTATGAAAGTTTTACACACTGGTGTTTGC
CATACAGATGCTTATACATTAAGCGGTGCTGATCCAGAAGGGGCTTTCCC
AGTTGTACTTGGACATGAAGGAGGTGGTATTGTAGAAAGTATCGGAGAAG
GAGTCACATCAGTAAAACCAGGGGACCATGTCATTCCATTATACATTCCG
CAATGTTACAATTGTAAATTCTGTTTCTCCAACAAGACAAACCTCTGCAG
TAAAGTAAGagCAACACAAGGAAAAGGCCTTATGCCAGATGGTACAGTTA
GATTTCATTGTAATGGCAAAGATTTATTCCATTTCATGGGTTGCAGTACA
TTTACAGAATACACAGTGGTAGCAGAAATTTCTATCGCTAAGGTCGATGA
GAAAGCACCATTAgataaagtttgtttactcggaTGTGGTATCACCACTG
GTTATGGCGCCGCTCTTAACACTGCTAAGGTTGAGAAAGGCTCCAATGTT
GCAGTATGGGGTATGGGAGCTGTTGGATTAGCTGTCCTAATGGGTTGTAA
AAAAGCTGGAGCTGAACGTATCATTGCTGTTGATATCAACCcaacgaaag
aaaaaattgCACGAGAATTTGGTGCCACTGAATTTTTCAACCCTAAAGAC
CATGACAGGCCAACTCAACAGGTTTTGGTGGAGATGACAGACGGTGGTTT
AGATTACACTTTCGAATGTGTCGGTAACATTCACACCATGAGAGCAGCTT
TGGAGGCTTGCCACAAAGGATGGGGTGAATCCATCATCATCGGTGTGGCT
GCATCAGGACAGGAGATTAGCACCAGACCATTCCAATTGGTCACTGGCCG
TGTATGGAAAGGATCTGCTTTCGGAGGATACAAGAGTCGTGACAGCGTAC
CAAAACTCGTCCAAGATTACATGAACGGAGATATGAAGATTGACGAGTTC
ATCACACATCATTTCCCATTGGAAGAAGTCAACGATGCTTTCCATGCCAT
GCACGAAGGAAAAGCcattCGGGCCATtgttaatttgtaaaaatattgga
TGGATATCAGAGGTTGGTTGATAACTTGGTGGTTGTAAATGAAATGGTCA
TATTTGGCGATCTGACCATGtcagtgaaaatatttttaaattcggTTATg
attttgtaatgattttttttaaaccttaCCACATCTCGGTTGCCGTTTgc
ttgtttatgtttttttaagCTAATGTAGATTATGGGAGTATGGTTATTTG
CTCTggaaaatatatgattttgaaaaaatattgaaactctTTGGTTTTGT
ATGTGTATTTCAGAGGACCATAGTTCGCTTTCAGTTCACCTCgcttgatc
tcgcgctccgaaaacaattagaA
Run BLAST on NCBI

transcript from alignment at sc0000001:346302..354514-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000154 ID=TCONS_00000154|Name=TCONS_00000154|organism=Clytia hemisphaerica|type=transcript|length=8213bp|location=Sequence derived from alignment at sc0000001:346302..354514- (Clytia hemisphaerica)
GTATTTTGATTACCTCTTTTCCTCCCTGTAAAATATTGAAATTAATGAAT TGATTGAATATCTCTGTAATTTTGTGTAAATAAGCTTTTCAGGGATTTTC AAAATATTTTTGCACACGGATCATGAGAAAATTACACCAATGAGCTTTTG TTTTGAACACGAGTGCAAAATCTTGACTATTCTCTTGTTCCTTCCTCATT TACTGCAAGTCTAGGTCTTGTAAACAACATACATCGACACACCTCCAAGA AGCAAAATGTCTGACACAACTGGAAAGGTAAAGTCTTTTTCATTTAATCT TCTTATTATGAATCTTTTTGTTCATTATACCTCCATCCTGTGTTATTCCT TCCACTACACTGTGAAGTTTTTGGACAAGTAATTTCATTTATAAAACAAG GTTACAAGTCTGAGAACTATTGATCCAAGCATTTAATTAGTATCGACTGG TAAAGATTAGGCTTCCATAGTATTCCAAAATGCAAAAAAATAGCACTATT CTAAAGGAATCAGAGTTAAGTTTGGAATACTTGACAAATTGGGATAAAAG TAGACAGTTTTTTTCATTAAACAAGTCGTAACAAGTCTGCCTAGATAATA TATTGTGTTTAAAAAAAATTACCTTTTTTACACTGTACTTTATGTCTGTT ACCGGGAAGGGGTAGGTATCAAAATTTAGCAATCCAAGTCTACAAAAGTC CACTGCGTTATGCCACCTCAGACTTTTCTGTAGACCAATTCAACAATACA ATACTGAAATTGAATGATGCAAAATTTGAATTGCTACGTTATGGCTCAAA TACAGAAATCAAAAATGAATCTCACTATACCTCACCATCAGGAGATAAAA TTTAAGGAAAGGAATATGTTAAAGACCTGGCACTCATTTTCTACACTACT TCAAACTTCTTTGCTGCAGATTAAATTGAAACAGGCTTTACTATTGATAC TAGCTTATACTAGATGTCACCCGCGTTTTTTCTACGCAATTAAGGAATTA ACGTCTATTCCACTTTGTGACATTTTCGAATGTTTGCCCAGGTTTTTCAG GTTTTGGATTTTTTGAGGTCCCATCTAATTTTTGAAGCTCCTGCAGAAGT GAAAAAATTGAATTAACGTCAAAGCAAGCTTCTATTTTTCCAAAATCTTC AAAGTGGAACTCACTAAGAAACATAATGAAATATCCTGTTTTTTGGTGAG GTGCTCGCTATGTTGATACAGTTTCTATTTCTATTTGGTTGAGTCACAGG AGGCTTGGTCAATGACCAATACCACAGCGCCTCAGTTACGGTCAGTTGTC AAGAAAGTTCTCTGAAACAATCAAATAAAAATATTTATGCTGCGAATGAA AATATCCTTATTATTTGAGAGACGAACCAACCTGGCTGCCTAAAAAAATC GTAAAGTTATCTCGCGAACATAGCACCAGTTTGTGAGAAATTCATTTGAC TACATGTATCAGCATGTATTTTGATTTATTTTTGATTCAATACACTACCG TAGAATCGTCTAATATCGACACGCGTCTTCTAAAGTCGACACCGGATCTG TAAAATAATCAAAACAAACCTTGAATGAAATTCTTGGTATCATTCTTATC AAACAAGTTCATCCATCAAACTAGAAGAAGTCCAATAAACATTGCAATCC TTTCAATTAAAAAAACAGCCAAATTATAAGCAGTTTTACACAGCACACGA AGCGCATGCAAACTTCCTCGTAACTTTCTCGTGTCCATCATTAAAATTTT ACAACTTTATTACGCTTCAAGTCACGTGATAAAAATAATTTGCGCGCTTA GCCTGGTTTCCCCTTCCTTATTTATCAAAAACACACGCTTTAGGCGCTAA GAGGCTGCACGCCGTGATGGCCAGTATGGCGGTCACATTAAATTCAAAAG GAAACCAGGTTCTTTTTATTTTTTTCGGTTAACGGTAAAAAGGTCTACTA AAAAATTCCTTGCGTGCAAAATGTTGTTTTGATTTATTTGGATATCTTCG TTCCGTTGAATGACAATGAAAGCATGCTAATTACAAATTAGTTTTTAGTG ACTATATACATATCGTTAAAGTTCTTTTCGAAAAAAAACCACTTCACGTT TCTTACATTTCAACAATCTGTGACGTGATAGGGAGAGTACAATTTAGTGA TTGATTGATAACTTTGGTATGTATTTGTTTATGTTTGATTTTTTATTTCG AAGACCAGCCTATAGCTATGTCGAAATAACAAGACGCATGTCGATATTAA ACGACTCTACGGTATTGCATATGTTTTTTCTACATTTTTTTTACATTCTA GGTTATTAAATGCAGAGCTACTGTAGCATGGGGTGCAAAAGAACCTCTAA AGATGGAAACCATCGAAGTTGACCCACCAAAAGCTGGTGAAGTACGTATG AAAGTTTTACACACTGGTGTTTGCCATACAGATGCTTATACATTAAGCGG TGCTGATCCAGAAGGGGCTTTCCCAGTTGTACTTGGACATGAAGGAGGTG GTATTGTAGAAAGTATCGGAGAAGGAGTCACATCAGTAAAACCAGGTATG AATGATGTTATAAGATTTATGGGTGATATGCTGGGGTGATTGTGTTGGGA AAGTTTTTAAATCCTGTCTCAAATTTGTGTTCATTTTGAAGCTTTGAAGT TTGGTATTTTGAAGAAGAGTGAAAAATGAACTAAATCGATTCGTTATTAT TAAGAATCACCCTAGGAATATTGAATGAAATACTGTTTGGAAATCACTAG ATATATATTTGAAGATTTAAATAAAATTGCTATTGACTTGAACTCTTTAT ATATTGAAGGTTTGGTGTATTATATTTATTCTTGATAAATAGAATAGTCA AATTTCATCTGATTGTAAAACACTTCAGATTTTTTTATCAAAAGATCTGT GTGCAAAATTGAGTTCAAATTACACTCGACATTGTGCAATGAAACAACTT TGATAAACATTAAAATTGAATCATCATTTCTCATAATATGCCTCTAATTG TTGCTTAAATTAATCCTGTTAAGGTTCTTATCTAGCATTATCATTTGAAA TCAGGCATTTTTCATAGACAATTTAATTGTCTACATTAATTAAATATTAA AAACAAAATAATTTATGTCACTGTTAAAATTGAAAATTCTAATTTCCCCT TGCAACTGATAAGGCTAACATCTAGGTAATAGTCAAATTTATAAAGATTG AGGTTTCTTTAGATATGCAAAATGATAAGGCTCAGATAAAGAGTTTCTTT AAATACCATTATCAGCTAAATTTTTTAAACAAATATGCGCTCTGAAAAGT TTCCACTAATTAAATAATTTTTGTTTACCTTTTTCAGGGGACCATGTCAT TCCATTATACATTCCGCAATGTTACAATTGTAAATTCTGTTTCTCCAACA AGACAAACCTCTGCAGTAAAGTAAGGTGAGTGCCTTTACATGAACAATGT CTTTCTCAGGGGCCTGAGTTCTACTTTAAAAGAGCCTTGTATCGACCAAC ACCAAAATCAGCAGAAGAAATTGCCTTAAATTTTAGAGTACACAAAGCAG GCTCTTCAAGGTACCGGGTGTGCCACAAATAAGTTACCCTCTTTGAATTT ATATTGCAGGCAGTAGAAAAGAGATTTTTCAAATATTGTTTCGGAATCAT TCAGAGGAAAGCCTAACTTAAAATTTGGTTTATTACTTTTTAATTTTTCT TTTTCTTTCGCCTTTTTCTGTCATTTTTTAAAATTGATACTGAGGTTTTT GAACATAACCTTTGAACTAATGAAGCAAAATTAAAAGTAATACACCAAAT TTTAAGTTAGGCTTTCCTCTGAATGATTCCAAAACAATCTTTGAAAAATC TCTTTTCTACTGCCTCCACTATAAATCCAAAGAGGGTAACTTATTTGTGG TACACCGGTATGAAAGAAACTCGAAGCATTTACTTTTTCTTGGAAGCTTT AATAAAATACCAATTTTAAGTCATTAAAATGGCTTTTATATTATTGGGAA GGAAACTGATTTGCTGTTTACCTGAATTTGCTGAGTCGTCACTAAATGGT TTTGATATTTTTTAATTTAGAGCAACACAAGGAAAAGGCCTTATGCCAGA TGGTACAGTTAGATTTCATTGTAATGGCAAAGATTTATTCCATTTCATGG GTTGCAGTACATTTACAGAATACACAGTGGTAGCAGAAATTTCTATCGCT AAGGTATATTGTGAATTTTATAGTAGTTCTTGGGTAATATGGGGACATAA AAAACATGTTAGATTCTAAGGATGGCGATAAACCATCGTTGAGCAAAATT GCACTTCTAACATAACTTTTGTTACCACTTTTAAGCTTAATTCTGTACGC TAGTGGTTTTGCTCTTTGAAACAGCCTCTTATAGAGATGAGCAATCTCTT ACTAACATATTCATTACAAACAAAGCTTTTCATCTACTTTTGTAAATAAT TTTTCAGGTCGATGAGAAAGCACCATTAGATAAAGTTTGTTTACTCGGAT GTGGTATCACCACTGGTTATGGCGCCGCTCTTAACACTGCTAAGGTATTA TACTGAGATTTGTTGTGGATTGTAGCACCTATTGAACTTAATTCCATCAA CTTTTTAGGTTCCACGTTAATATTGTGTCTTTATTTACAAGTACTCACTG ACAAACCCGATCCTTTTTCATTTGACTGCGTGAAAAGGGTTAATAATTAA TGTACCGTTTTCGTAGGATATCACTTTAGGTTTTCAATCGCAGTGTGTGA AATTTTGAAGAATAAAGCAAAGTTACTCATTAAGAATATTGATCCTTGCA AAAGCAAAAACCGATATTTAGAAGTTCTATTTTCTGAGTGCACTAACACA GAAAAGTCTGCAAAAATACACATTCTTTCTTCAATAGAAGTACGTTACGA TATTCCAAATCATAATTCGGGGATCTTAATTTTGTGGATAAACTCGTAGA TTTGAAAAACCATTTTAACCAACCAAATTTTATTAAACATGAAATTTCGA GAAATCTGTTAACTGTACGCAGTTGTACGTAGTACATAAAACTTCTGCAA TTAGTAAAAATATATCATACTAAAGTTTGAAAAAATCAATTTTTAACTCA CTTAATCCAACTTACTTTAATACTACCATAGTCATTATAAAAAACCCCAG TCTGGCAATGTATTGTTTTAGCTTTTTGTTCAATTTAGTTGCTATTTGCA TAATTTGTGATCACGTTACCAAAATCTCCTATTGGGATTGGTCTATTTTC TAATCACATGATCAAAAAGTTTGCAAATAAATCGATTTTGTTCACGTAAG CACCATCTTTTAACAATGAAAAGAGACAAAAGCCTTCCAGACCAGTGCTT TTATAATGACTATAATTCTACCATAGGTTGAGAAAGGCTCCAATGTTGCA GTATGGGGTATGGGAGCTGTTGGATTAGCTGTCCTAATGGGTTGTAAAAA AGCTGGAGCTGAACGTATCATTGCTGTTGATATCAACCCAACGAAAGAAA AAATTGCACGAGAATTTGGTGCCACTGAATTTTTCAACCCTAAAGACCAT GACAGGCCAACTCAACAGGTACACTTTCGATATTTACTTTTGAGGATAGG ATTATATTACCTGTGAAATAAGAATTTCTAACTTAATTCTCTCAGAAGAT TTGGGTGGTAGAGTAGCAGTTACATGTCTGGAAAGCTCTGAAAATTTCAC GTCAGATTTATAACAAAAAAAGATCTTTGATAAAAATTCGAAACGAAGGG TCTACATACCTTAAGGAATTTTCGAGTTATAAAGTAAAGTTTATAAGGGT TATATATACAACTAAAAGGACCATAAAACTTGTTCCAATCAACGAGACAT TCTTTCGAGTAATAGAGGTTCGAGTTAAAGAGACGCCATTTTATAAGATC TTACCGCAATAATAACATAAAAATTTACTTCCTCTTCTTCAGTGTCTTCT CCACTGTACAAGTTCTTACCACAACAAAAAGATAAAATTTCCCCGCCCTC CCCTTTCAGGTTTTGGTGGAGATGACAGACGGTGGTTTAGATTACACTTT CGAATGTGTCGGTAACATTCACACCATGAGAGCAGCTTTGGAGGCTTGCC ACAAAGGATGGGGTGAATCCATCATCATCGGTGTGGCTGCATCAGGACAG GAGATTAGCACCAGACCATTCCAATTGGTCACTGGCCGTGTATGGAAAGG ATCTGCTTTCGGAGGTATGCGTCTTTTTTTCGTTTGCCTGGTTGGTGAAA ATAATGTTTTGTCGAGCTTATCTTGTGTTCTTTTAGGTAGAAAATTATTC TGTTACCAAAGAATTTTTCACCAAAGTACCAAAAACTTGCCTTTTTTAAT GAACCTGTCCCTTTTGTAAAAATTTTGGTGGAAATTCAATATTCAATTCC TCACAGGAAAAAATGTAAAGCGAATTACATTAACTTTTGGTGAATTCGCG AAAAGCTGAAGTATTTCAACACATTTCAGCTTTACACTGTAAATGCAGTC TGAAAATTACGATGTTTAAAATGCTTTTAATTTATTATCTTTCTGTGTTT ACTGATATATCTTTTAGGGAAGATCAGATGGTTTGGTCTTCAAACATGTA CATTCCTTCCATATTCCTGAGCAAAATTTCAAATCTTTTTTGTCTTTTCT AAAGTCGAGATAATATGGCAACTTGAAATCTCTGGAATTGGGCTTTGCCT CTCGGCTCTCACGTCAAATCTTATTGCTTTCTTGCTAAAACTCAAAAACT CGAAAGATTTACTCGACTTTGAAATAAGAGTCGAGAAGATTTGGAGGTTT CACTTAGAACCATTAAAATCTTATTTTTTTCATATTCACAGGATACAAGA GTCGTGACAGCGTACCAAAACTCGTCCAAGATTACATGAACGGAGATATG AAGATTGACGAGTTCATCACACATCATTTCCCATTGGAAGAAGTCAACGA TGCTTTCCATGCCATGCACGAAGGAAAAGCGTGAGTNCACACATCATTTC CCATTGAAAGAAGTCAACGATGCTTTCCATGCCATGCACGAAGGAAAAGC GTGAGTTATTTTCTCATTTGCCAGTACTAAACTCTTCGTCGCTGGCGAAA AATATAGGGCTTGGCCTAAGACATTTTCTCATTTTCTCTGAATTTCCTTT TGAGGTGCTGGTTTTAGAGCTATTGGATATTTTTCATTTTCTTGAAATTC TGTTGTGGTCAAATCCAAAGGGTTTGGCGCAATGAAGTGTAAGCCCGAAG GACTAGAAGTCAATCTCCTTGGTAGGATTTGAAGCCAACAAATCCTACCA AAGTTGCGCGGCCTTGAGCGGTTCTTACACAAATGACAGATTGAAACTAA AATTTACCGCTAAATTTCGAAAAAAATATCAATCGTAAACAAAGGAATTG CTAGATTCAATCTGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNGGTTAGAGATTGAACTCTAGCCCTTCGGGCTTTAAA ATCAATGGTTTGGCGGGAAACATGCCATTTTCGACTAGACTTCAATCTTC AGAAAGCTGTGGCCAAAATCTTACTGAAAGTTTTTCCAAATTTTTGTTCT ACGACTAATTTATAGACGATTCGAAACGTAGCCAGAATCTATGACGGTTC GGTAAAAACCCGCTATTATACGCTGAAAATTAATTTGATGGTTTTTATTT TTTAGCATTCGGGCCATTGTTAATTTGTAAAAATATTGGATGGATATCAG AGGTTGGTTGATAACTTGGTGGTTGTAAATGAAATGGTCATATTTGGCGA TCTGACCATGTCAGTGAAAATATTTTTAAATTCGGTTATGATTTTGTAAT GATTTTTTTTAAACCTTACCACATCTCGGTTGCCGTTTGCTTGTTTATGT TTTTTTAAGCTAATGTAGATTATGGGAGTATGGTTATTTGCTCTGGAAAA TATATGATTTTGAAAAAATATTGAAACTCTTTGGTTTTGTATGTGTATTT CAGAGGACCATAGTTCGCTTTCAGTTCACCTCGCTTGATCTCGCGCTCCG AAAACAATTAGAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000088XLOC_000088Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000154-exon-sc0000001-1575043694:354238..354514TCONS_00000154-exon-sc0000001-1575043694:354238..354514Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1575043694:351970..352213TCONS_00000154-exon-sc0000001-1575043694:351970..352213Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1575043694:351090..351177TCONS_00000154-exon-sc0000001-1575043694:351090..351177Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1575043694:350312..350444TCONS_00000154-exon-sc0000001-1575043694:350312..350444Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1575043694:349971..350057TCONS_00000154-exon-sc0000001-1575043694:349971..350057Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1575043694:348947..349138TCONS_00000154-exon-sc0000001-1575043694:348947..349138Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1575043694:348301..348505TCONS_00000154-exon-sc0000001-1575043694:348301..348505Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1575043694:347535..347673TCONS_00000154-exon-sc0000001-1575043694:347535..347673Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1575043694:346302..346659TCONS_00000154-exon-sc0000001-1575043694:346302..346659Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1510915933:354238..354514TCONS_00000154-exon-sc0000001-1510915933:354238..354514Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1510915933:351970..352213TCONS_00000154-exon-sc0000001-1510915933:351970..352213Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1510915933:351090..351177TCONS_00000154-exon-sc0000001-1510915933:351090..351177Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1510915933:350312..350444TCONS_00000154-exon-sc0000001-1510915933:350312..350444Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1510915933:349971..350057TCONS_00000154-exon-sc0000001-1510915933:349971..350057Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1510915933:348947..349138TCONS_00000154-exon-sc0000001-1510915933:348947..349138Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1510915933:348301..348505TCONS_00000154-exon-sc0000001-1510915933:348301..348505Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1510915933:347535..347673TCONS_00000154-exon-sc0000001-1510915933:347535..347673Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1510915933:346302..346659TCONS_00000154-exon-sc0000001-1510915933:346302..346659Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1491911889:354238..354514TCONS_00000154-exon-sc0000001-1491911889:354238..354514Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1491911889:351970..352213TCONS_00000154-exon-sc0000001-1491911889:351970..352213Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1491911889:351090..351177TCONS_00000154-exon-sc0000001-1491911889:351090..351177Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1491911889:350312..350444TCONS_00000154-exon-sc0000001-1491911889:350312..350444Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1491911889:349971..350057TCONS_00000154-exon-sc0000001-1491911889:349971..350057Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1491911889:348947..349138TCONS_00000154-exon-sc0000001-1491911889:348947..349138Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1491911889:348301..348505TCONS_00000154-exon-sc0000001-1491911889:348301..348505Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1491911889:347535..347673TCONS_00000154-exon-sc0000001-1491911889:347535..347673Clytia hemisphaericaexon
TCONS_00000154-exon-sc0000001-1491911889:346302..346659TCONS_00000154-exon-sc0000001-1491911889:346302..346659Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:346302..354514 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
613.866 594.743 733.954 782.498 0 0 2.42761 0 1.87118 1.42033 2.66208e-07 1.80588 2.94199 0 239.926 189.621 283.976 159.013 228.254 192.435 340.7 236.829 281.524 289.423 0 0 286.163 353.371 233.17 258.153
Blast
BLAST of TCONS_00000154 vs. Swiss-Prot (Human)
Match: ADHX (Alcohol dehydrogenase class-3 OS=Homo sapiens GN=ADH5 PE=1 SV=4)

HSP 1 Score: 503.442 bits (1295), Expect = 1.073e-174
Identity = 257/371 (69.27%), Postives = 309/371 (83.29%), Query Frame = 2
Query:  275 KVIKCRATVAWGAKEPLKMETIEVDPPKAGEVRMKVLHTGVCHTDAYTLSGADPEGAFPVVLXXXXXXXXXXXXXXXTSVKPGDHVIPLYIPQCYNCKFCFSNKTNLCSKVRATQGKGLMPDGTVRFHCNGKDLFHFMGCSTFTEYTVVAEISIAKVDEKAPLDKVCLLGCGITTGYGAALNTAKVEKGSNVAVWGMGAVGLAVLMGCKKAGAERIIAVDINPTKEKIAREFGATEFFNPKDHDRPTQQVLVEMTDGGLDYTFECVGNIHTMRAALEACHKGWGESIIIGVAASGQEISTRPFQLVTGRVWKGSAFGGYKSRDSVPKLVQDYMNGDMKIDEFITHHFPLEEVNDAFHAMHEGKAIRAIVNL 1387
            +VIKC+A VAW A +PL +E IEV PPKA EVR+K++ T VCHTDAYTLSGADPEG FPV+LGHEG GIVES+GEGVT +K GD VIPLYIPQC  CKFC + KTNLC K+R TQGKGLMPDGT RF C GK + H+MG STF+EYTVVA+IS+AK+D  APLDKVCLLGCGI+TGYGAA+NTAK+E GS  AV+G+G VGLAV+MGCK AGA RII VDIN  K   A+EFGATE  NP+D  +P Q+VL+EMTDGG+DY+FEC+GN+  MRAALEACHKGWG S+++GVAASG+EI+TRPFQLVTGR WKG+AFGG+KS +SVPKLV +YM+  +K+DEF+TH+   +E+N AF  MH GK+IR +V +
Sbjct:    4 EVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVVKI 374          
The following BLAST results are available for this feature:
BLAST of TCONS_00000154 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ADHX1.073e-17469.27Alcohol dehydrogenase class-3 OS=Homo sapiens GN=A... [more]
back to top