Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000122 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000122
Unique NameTCONS_00000122
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3479

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000122 ID=TCONS_00000122|Name=TCONS_00000122|organism=Clytia hemisphaerica|type=transcript|length=3479bp
TCCAAGTCGGTTAGAAATTCTCCATCATTTTTCCTATAATAAAGACTTAT
GGGGTAAAATTATTACATTATTGGCGTGTACTCTGCATAGATTTAAGTCT
CTGAATTTCTTTTCTACTTTAGAATTTAATAATGGTAGATCATGGGGGAG
GACTGGTGGAagatcttgaaaagaaaactggctTAACTGCTGATCAGatT
GTACCGCTTATTACATTATTCTTTGCCTTCTGGGTTGGTCACATCTTCCG
AATATGGTTAAGTCCACAGcgaatttcaagtcaaaaacgACACTTCATAT
CAATGGCTCTTGGAATTATCATGCTATCAATAGTTTTTGGGGAaCAAGCA
TTCCATCTGCTGTATTCATGTCTCATCTCATACACACTGATGCGTTTTGT
TGACACTAGTGTTGTACACGTatGGGTTATGGGTAGTGCAATGTTATATT
TATCATTGATACATTTTAAGAGAATGATGCTGCAAGATGATAATTATGTT
GTGGATATTTCTGGACCATTGATGCTTGCCACTATAAAGATAACTTACGT
TGGCTGTGGAATACATGATAAATATCATCCACGTACAACATCAGATGATG
CTCGTATCATTTTAAAaAAGTTTCCTTCTCCTTTGGAATACCTTGGctac
attttcaatttttcatcagTGTTTACCGGACCACCTCCAGAATACCAAGA
TTATATGGATTTCATAGATGGAAAACAATATGATAAATATAAGGACGAGT
TGAAAGGGAAGCAACCTTCACCTATGCTCGTATCCATCCAAAAATTCATT
CTTGGATATATGGCTATTGGAATGTACGGTTTTGTCAGCTCAATATTCAA
GCCTGACTTTTATAAAAcACCAGAGCTATACGAAAGTTCTTTTTGGTTCA
AAGTAATGTTCGCTGAAATCATGGTTTATCATCACAAATTTAAGTATTAT
GGTGCTTTCGGATTAGGTGAAAGTATATGTAATGCTTCTGGATTGGGATT
CAGCGGTGTAGATGAAGACCGCAACCCAACATGGGATAAATTGAAAACAT
TAAGGCCACTTCAAATTGAGTATGCAACAAATATTCGTGGCTATGTGGAT
TGTTGGAATTTGACTGTAAATGTTTGGCTTAAAAAATGTGTTTATTCTCG
TCTGAAAGTAATACCATTCCTTGGTACTTGGGTATTCTCGGCATTATGGC
ATGGTTTCTATTCTGGTTATTACACATTCTTTATACCACTTGGGTTTGCG
CTGTTCCTCACTCGAAAGGTCCGAAGAACAATTCGTCCGTACTTTTTATC
GTCGCcatctttgaaattattttatgacgtcatcacttggTTCGTCACTA
GACTCTTGTTAAATTTCTACGCCGTTGGATTCGCAACATTGAACTATGCA
ATCACCTTCAAATTTTGGAACTCTGCAAGTCATTATGGAACCGCCATTTT
ACTTCTTGGCACCTTATTGGTTATTGTGTTTCAAACGCAACAGCAGAAAA
AAGATCACAATCAGAACGACCAATCACCTTCCATCTCTACCAACGGTCAT
CCCCATGTAACCAATGGCAACCATAATGGGTCCAGATGAAAATACCAGTT
GTGTTAGCTTCTTGGATGGTTGATTTGTTGAGTATTAAAAAGTTTAAGAT
TAGTTTGACTGTCAGGTTCTTTTTAacacagttgacgctctctaattcaa
caTTCTACTATTTAATACCATCGATGTTAATACGCTCCATtgttcgataa
tattgaaattctcctaGACGAGGCTTTGCCATTCGATATTCCCTTATTGC
ATGAAAATGCCATACcttttgaaaattgagttagCTCTCTAATATTTTCT
CGAAAGCCATTGTATCTTATTTGCGATGATTATGGGGCTTCAGGTACGCA
GTGATCTAATTCTACTTTTATCTCCTATTTCTCTGTGACATTCTGGTGTA
TGTCGTTTAACCACAAGaacaaaatttctcaaaatggcCATTTCTTTTTA
TATCCATATAGGgagtggacgaacatttccagtgGGTAATCCAAGATGAA
TTTCCAGGGgctgttttttcatttttctaagggggtaaaaagttattcta
aaatttccagggggtaaaagactgattttagttcgtccaccctcactttt
aagatatgaaaagaattttttaaggtacttttgccattttccagggggta
tccacgcatttcaataattttttttttaattgaaaaggtttatccacccc
ccccccccaacggTTTTTTAATGGGACAGCCCATTGTGAATTTTAGGGTA
TCAAGCTcgttaaaattttgttttttttaatcaaatatttttgatagtTG
TACATAATAGTTATCTTTAACAAATTAAGTcgagtattttttttttagtt
cacaaaatttttgataataatAGTATTTTTTTGGGATAGTTTTGATACag
ttaatattttttctttgttttatatttacaactttgttttgtttatgcTG
GTTTATGATATATTTAACCTTGTTTTAGTGCAGTTTTCATGCGATTAAGC
ACCTAAGTTTACGGTTAAGACCATtgaaagaagaatgaaaaatgaaagaa
aaataatcaaagaatggtgtaaggaagccgaaaaaatgaGTGCTTAAATC
AAGGGAGACAGCGCAAAATGGAAAgtccgaaaaaaaatatattttaaaac
gGTCATTGTAAAAGTACGAGCGGATAATAAAGGCCCATGTGTCTccacgg
tggcctgcaaacctgtaaagctttattattataAGAAGAAAACAAGGCAT
TTAAAGTTCCAAAACGAAATAAAAACGCTAAAAACGTTTTCTACGTTGTG
AAATTATggcttaaaattttcaattctcaAAAAAGGTCCAAagtaatatt
ttctttaaaaaataattattgttTGGAGACAATTTTTCATTCGTGGGTAA
TAGACGATATTGGCTTAACataaaaactcagatttgatccccgagaattc
cccacaatgctttgcgcggaaaataTTTCACCGCGAACTTTTTCCGccca
aagcattgtggggaatttgGTCTTTACttcttaagaaatattttaGGTTC
TCTCACGTTTTAGGATTTAAAGAATTGAAAGTTACTGCCTaagtttattt
tgtttttttttgaaaatttttgttgttattttcccggtttttttgttgtt
ttttctgttttatttacaATGTTTATTCATGTAcagtttatttttttatg
atatatttatatatttttttctatcttctatgttaaaattttggaacaaa
tttattttgaataaaggGGCCAATAACATATTCTCTTTATCTAGTTATTA
ATGTATATTTAGCAATGTTTATATTGGTTTACAGTTAAATTtctttagaa
tttcttttgatattcgGCAATGTTATCTGCGTTTCAATATTGTATTTGTT
GACCAAATGTGGCCATGGTAATAATCCAC
Run BLAST on NCBI

transcript from alignment at sc0000001:2342121..2360221+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000122 ID=TCONS_00000122|Name=TCONS_00000122|organism=Clytia hemisphaerica|type=transcript|length=18101bp|location=Sequence derived from alignment at sc0000001:2342121..2360221+ (Clytia hemisphaerica)
TCCAAGTCGGTTAGAAATTCTCCATCATTTTTCCTATAATAAAGACTTAT GGGGTAAAATTATTACATTATTGGCGTGTACTCTGCATAGATTTAAGTCT CTGAATTTCTGtgagtattttttttatttactttcccattttctttataa aaatcacaACCCAAAAGGGNATGAAATAAGAGCACGTTTTTggaatcaaa atggtagccgacatcataacaaaaaaaaattttggtcaacGTCAGGTGAA ACCGCTTTTTGCCTTTTTGCAGCTTCCAAGTCGGTTAGAAATTCTCCATC ATTTTTCCTATAATAAAGACTTATGGAGTAAAATTATTACATTATTGGCG CGTACTCTTCATAGATTTAAGTCTCTGAATTTCTGtgagtatttttttta tttcttttcccattttctttataaaaatcactacTAAAGTGATCCTTGCC CTAAACATACCCCCAGTTTCGGGTCATGTTTCTGTACCAAAATAGCAAAA CATTcttttggctgaaatattgaTGATTGGGTCAATTTTGGGCCACAAAA CTTTAGATATTTGCTTCTGAAAACCTGGCATGAACATGACATGTGCAAGC CAGGTTTGGGTCATGTTTTTCTaggaattttcaaattcaaaattgcCAAG TGGCATgagaatacacctttcccgtaatttgtaaaactaatgcgcgcgca ttattttgatgctctccaccgtttggtctctggaggtaaacaaaccggtt tttgcctgcgttcccttagggaaagttggttttttgagcttttcttaagt tctgtcgaacaaaatcccctcaaattttagtatgttcaatctattcatgN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtataca caacggtggagcgcacattttcccgggcaatttctgagaaatttgaatta cgggaaaggtgtatttggGCTATACCGTGAGTATTGTCTTTAAGCTAGTT CTGGTTTTTACCAACTGACGAACCAtcctgttgtttttttattttgctga aattcTAATTCAAGTGTAAGCAGATATTCATTAAGGACCAGAATAAACTC TTTGGACCAGTGGTTGtaatcaataaaatcaatcaTCAATTTAAAATGAT AATAGATATCGATAACtaacagtcagggaaatccctcaattgcagtatac tgcaattgcggttgTTTTCATTTGTGGTTAGCCTAGAAAGGCTTATAACG gctacatatagtgctggtcAACCAAGTTAAACAAACATCCACTGTAAAAA ACATACAagaagaaagcttttctttaataaaagaatctgatctacggaaa aaatattttgtctatgcgttaaaaagatatgatgaattatgtacaaaaat tgcctgttttctccttgaatcttgaattctgtttctttaatatactgcaa ttgcggtatatgaaaaatgtaaaagtgacatttataccccaattgcagta aaaaattactaccgcaattgagggatttccctgactgactAATCGATTGA TCAGTTATTGATTCAAATCTATAATCGTTCGCTAATAATCAATATTCATA ATTTTGTTGACTTCCATTAGCTATCCATTGCTATCAATCCAATCGATGTG ATCAATTAATAATCGATGGATGTTATCAATCGATACCATCAATTTGGAAT CGAATTTTCCTTTAGGCTTACAATCTTTTGTCTAGCAATGAATTATTGAT ACTGCAAGGTAATCAATATTAATTGATAGATAATCAAAATTAATCGATTG CTCATCAATATCCATTGTTGACTAATCAATCGCTAAtcaatatttacaat ttttttgacCTCGATAGCTATTGATTATAGATTTTAATCGATAACTGATA GCTGACACGATAGCTGACATTTTATGTCTCTGTTCTACCCTTTTTAAACC CCCTAGGGACAGTTTGTGTTTAAAGTCttcttaaaagtaaaaaaaaggtc tgtctcaaaattcagtaaagtttaaaaaaagtatgTATGTTTTTGACCAC AGAAGGAGGCAATCCTTTCTATTCCTTAATTAATTGCTCCATTCTCCTTT GGCTACTCTCTTTAATTGCTTAGCAACCATTTTGTACTGAGAAAATCCAA CCACAACTCTGCACATCATAGCTGAATGCTCTACCTTGCACTATGGTTCT TTTGTATTGTAAGGTTTACCATTATTTGTTAACTCTTATTAAAGGCTTTC GGGGAAAACATACTTTTATTgcttgaaaatccttttttcaaaagttacaa gttaaaagagtgaaaagaaaaagtgtgattcatgatatgcaccattgcaa tgtcttccattccacccaatagttgattggttgaaagtgacgtattgact gattatacgtcacttacaaccaatcagctgttgggtccatgatgtaatgt cagaagacattgcagtggtgcatatcatgaatagctaGATTTGAGTAGTG GCCAAAGCTTATCTTTCAAAATTGTAAACTCTGATATTTATTTCACCAGA atattttagtatcctttaattcCCCCATATATTTTGTGTTCAAAATATTA ATGGAGAAAACAGACAAATTAGCAAATTATCAGGAAAAAGCATACTCAAA GCAGatggaaatttttgatttatagCATTAGGGAGGTATTAGAGGGGGTT TATGTaagttgtttgaaaaattttgatagttttttgGAGAACAATATAAT TAATATATTTGCAGTTTCTACTTTAGAATTTAATAATGGTAGATCATGGG GGAGGACTGGTGGAagatcttgaaaagaaaactggctTAACTGCTGATCA GGTAAATCTGGTAAATCTCATGCCATATTCCTATAACATTTATTTGGAAT AATGTTTAATCATCTTTCGGATAACAGTCTACATGGTCATTAAAATGACA TTCACAGTTAGAATTTAACACAACATAAATAATCTTGTATATATAGTATG TCATGACAtgatatacactttttttatataagaacaagtaAAATGTTGTT GAGGctcagctgttcttatttttttggcactttgagcctcaaattgttct tatcagcctgttcttatttatatttataaggTGTAATTGAGGTGTTTTGG gtgttatacccaattttttactactttgacccatAAATTGCATGAAACTG AGTAATTTCAGACtgagcattgttcttaaattgttctttttttggcgatt ttgagcctcattattcttataaaaaagtgtgattgaaaatattcttgaaa tcAAAACTCTCTCTCCTTTTAATTGGACATTTTTTCCTAGAGAAGAGTgt gtcaaaattttaaaataagagaatcattcattcatttcattgttttagat TGTACCGCTTATTACATTATTCTTTGCCTTCTGGGTTGGTCACATCTTCC GAATATGGTTAAGTCCACAGcgaatttcaagtcaaaaacgACACTTCATA TCAATGGCTCTTGGAATTATCATGCTATCAATAGTTTTTGGGGAGTAAGA CTTTATAAATTACTAGTATCAATCATAGCCCCGGCAATAACCACATCTTT GTGATAATAATCCAAAtaacaacaaaatttatttgattaGACCTTTTCTA CAGTTGAAATTGCAGAAGACAATATATGGTACAAGCAtgggttttgcttt gtttttgataggCTGGCTCAAGGAAAAATTAGCTCTGGCGAAATCTAGAT TCTAGACcggcgaattcttagcaagccCAATGTATTGATTGGCATGAATA TGTACTTGAGGCAGCGAATGGAATTGTTAGACTGGAGAATCTTTTTTGTG CCTTGGACCGACGAAATTCGCTGATTGCCGGGCCTTAAGACCCCTGGATA CAAGTTTTCTATATAAGATATGTAAGACAAAGttattttaaatatatttt ctccattttagaCAAGCATTCCATCTGCTGTATTCATGTCTCATCTCATA CACACTGATGCGTTTTGTTGACACTAGTGTTGTACACGTGTAAGTAACAC AAAAAATGTTAACGTTTTATACCCTTTGTAAATATGGGAAATCATATGCA ATTGGAAGAGGGGAGCCAAATGAATTAAAATTCTCTTagattttgaggaa aaaaattattttgttaccAAAGCTTGAAAACTGAAATGATCTCTGATTAA CTGCTGTTTAACATTTCTCTCTCAGAATAGCGCTCTCATTCAAAATTACa acatttctttttaaaattgtgtAATCTTATTtctacttcttctttttcag atGGGTTATGGGTAGTGCAATGTTATATTTATCATTGATACATTTTAAGA GAATGATGCTGCAAGATGATAATTATGTTGTGGATATTTCTGGGTAAGAC CACTGACCTTTAAATATCCTTGGactaagctatatccgccatctttgatc ataGTTTTTTTTGANATTTCTGGGTAAGACcaatgacctttatatatcct tggactaagctatatccgccatctttgatcatagttttttttgaaattgg tattgaaaagaagccattgcaatgttaaaaattaacgtctaacggcgcta catcatcaaaagtatcagaggaaaagtagatctagcgctatCAATGTatt ttcaccgctattgagtagtgccgccaatagggctcagatcaaagattttt ggttggcccggattgagtaacttggtagGGATATATAAGGTTCAGTGGGT AAGACCCTTTACCTTGTTCTTTATTTATTTAAtagattggttgaaaaaat attGTACACCAGTAGTGAATGTAGTCTATTAGTTCTACTTTACTTCGAAA GACAATACGGGCACGCTTCGCACAGTAAGCTCGAGCCTGACTACACAATT GTATCATTGGGGATATAAAATGTTATATGCACAACACTAATAGCGTTTTT CAAGCTGTCtatcatttttattgcattGCTACTCAAATTTTTCTGATGAT TTATATGTTATTTCTTCTTAGACCATTGATGCTTGCCACTATAAAGATAA CTTACGTTGGCTGTGGAATACATGATAGTAAGATGTcatttaaagcattt taaactttattctcaacttcagttgagctacaatctgacaatgtctgtct gtctgtgtgtgtgtgtgtgtgtctgtctgtcacaaaaactttagggcagc ctgtagACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNCTCTGCTTTTTTACACCCTAGTAGGGTTTGGTTTACACCAAAAG AGGAACCACTACTGGAGAGAACccatttttgtgttgtttttgttttaact gCAATAACATCAACAGTGGGGAAAGCTCTTACAGTCTTAGTCTCTATCAA CTTCCTTGCCCTAGATCacaatttgaataaaatctcCCCCCTTCAAGTGC ACGATGAATTTTTCCCCACTTTCAAGGTAGAATAGGATATTTTACAGACA CTTTTTACTCTACCTGAATATCGAACTGACCTAAAATTTGAAGAGTATTG TCTCAATTTTGCTCTAACTTAATAACTAGATGTTTTTCTGTGATCTATTT CATGTAACGTGAAAAGGAAAATTCATCACTTTCCCTTTGAAATTCTTGTT TTCTAGAATATCATCCACGTACAACATCAGATGATGCTCGTATCATTTTA AAGTgagtttttcttaaaagaaaaatttgaatttcctgAAGGGGAATGAT CTTTAAAAgaccttttatttctacaatttGCGTACATGTTTAAATATGTT GATTTCTAATACAATTTGCTAttgttttaaatctttttttttattctaga AAGTTTCCTTCTCCTTTGGAATACCTTGGctacattttcaatttttcatc agTGTTTACCGGACCACCTCCAGAATACCAAGATTATATGGATTTCATAG ATGGAAAACAATATGATAAATATAAGGTTACCCAGCTTGCACACAACgct ttttcaacgtttatctaacgttcacaacgtccatataacgttagatgaac gttgaaacaacgccgCGTGCTAGCTGGGTAATGAtctattaaaaatttta aatctcgACTTTGGACAATTAGACCAAAATACTTGGCGGTAGAAGGTTAT ATTAcaggccaaatatctcaaaccatctgattatccctttaaaggcttta tttttgcataagtgttcctgtttcatatcagacacatatttcttatcagg acagtgtctgtctattgttatattatgctgatataagcaaaaaatgtttt tctttttctctttctgaccaatcttgctcctcatccgtgtcaatccaatg tgaaaaagcttgtgaattaaaattaatgagtaagcaaaaaatatcgctct tatttaaaatcaaaacctttaaagggataataagatggtttgagatattt ggcctgTAGTAACCTTCTACGGCCTACGATCCTGAGTAAAACCTCCAAAT ATTTTgatctaaatattttcaaaagtcgagaTATAACGATTGGAAATTac tgaaaatgggttcttacacggttcttttgttatatttcttactaaaagta aaaaaacttgtaactaATATATCATAACTTAGGAAAAtagttaggcaaaa atattttgaggttttgttCTTGAAGGAacccacatgccaaatatctcaaa ccatctgattatccctttaaaaataCTTTTGGAAATTCAGTTTagtaaaa gaaatattttacttttttaaaacaCTTACCTAataaatgaaagtaaaatt tgaatttcttcaacTTGCCTAGCCCTAGTTTTGGTACCCTGTCCAGATTT AGTGTAATGAGGGCAAAGGTtcgataaaaaataataaaaaaggtAAACTG AACATATCGTTTGTTTATTTGTCGTTCTTCAaaagaatcttttgttttat ttcggTTTATTAATCTTATTTTTTACACCAAATCTGGACATCACTCTTTG TAAAGCCACAAAACCCTTTTTGGTGATCCCTTTTTCGGTTGGAAAGTTTC CTCTTccctttaatttatttttattttttttcatactttttagGACGAGT TGAAAGGGAAGCAACCTTCACCTATGGTATTGAAATTATAACTTTTcttg aaatgttttgttttgtagaAAGGACTACTATTAACACTATTACTAAAACC TGTTTCTTAAAATTTGcggtttattcattttttgtaaatatttctcTTGA GAGATtactcgttgaaaagataatttagaGTGGTTTTGCGAGAAAGTTCG AATATGaagataaaaattgaagaagaaaaaattgtaatcgTATATTTTAG GTATCACTTTAAATGCtatcttttatttttccctCAAAAGTAATGTTTAA AATGTATTGACTGCAAATGTTTTTGGAACAGATCATTTATATCAGACACA AAATACATGTTCCCGAAAAGTCCAAATTGaaagtgatttatttttttctc ataccatttttttctttgttatttcAGCTCGTATCCATCCAAAAATTCAT TCTTGGATATATGGCTATTGGAATGTACGGTTTTGTCAGCTCAATATTCA AGCCTGACTTTTATAAAAGTAAGTCGTAATCCATAATAATTAATACACCC AGCGAATATTATGGTAGGTTGTTACATAAAAGGTCTCCTCTTTAAATGAA TTTTAGTGGTTTAAAAAGCAGCCAACGAGTAAGGAAATTGTTCTCCTCAA CATTGATATGATGGAGGATTTCTTGGAAAAGGACACAATTGTTATCTTGA TGGACTTAGATTTTTAAATATGTAGGTACAAGTCCGATTAATTCAATGGG AAATTTACGGGAAATAAAGTGCTGATAAGCTTGATTCATTTAACAATCAG CCCTTTATACTTAACTATCCCAGAAAATGACTTTTGGTCTTTCAGTGTTT AAATCTtataatcgtcagccgtgcaaaattactcgaatctgattggttta gaggagtgcgattaatcgttaattgcactattaccactttttgcactctt cggcggggggNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN Natttgcactcgtccttcggactcgtgcaaattactattttctcctttgt tactcgtgattaatcgttaattgcactccaaaccatacgattactagtac taatagcATCAACAcgtcaattaaaaagaaaatatcttatTTTCACATAC CATTTTCAGTAAAAAGtgtaaaataaaatctaaaagaaaaattatcaaca atatttttatacattttaaaTAACCTTTCATTCCTTTTCATCTTTACCAA TTTATAATAACTTCattaaaacaacaacaatataAAGGTTTGCTTAGAGT GCCAAGTAAATCTGTCCAGTTCCCAACGTTTACGgataaagattgaaaga aagaaTTTTAGCCCTCTACTATTCTTTGTTTTATTCTACTGTTTATAATT TTACTTCTTAATTATAGTAGAATCTCGGAAGAGATATCTTCCTTTTTAAA ATAAGTTCCCTTCCTTTCTACTAGAGAAGGCCTTGAATGTATTAGGTATT TTTATTGAGAGAGAAGTTTCTTCTataatatcaaattttgaaaatgtagc AATTCTTCTAGTTGAGAATTTATCAATAAGATCCCTCTGTTAGAAGCTCG TGTATTGTaaagaaatttctttgataaagtCATCACACCTGGCTATCGAC ATAATTTCTATAGAAGGTTTGAAATTCGGGCACGATGCCTGTAGATAAAT CATTAATTGTTGACTTATTTGATTTATCAGTGTAACCCTCTAAGGATCTT TGCGCTGTTTTTTCTACCAATGTATTCCCTGATGGGTTACCCACACTACA GATTCTACCTGATTGTTGCAAAGTCAAGTCATGCATTTATTCTGTTTAAC ATCTGTAGTCTTGTTCCGTTTTGCCGAAATATCTTTTTCCAAGTACGAAT TCCTTGAGTACGAAATCCTGAATGTTTCCCGAAATAAACAGCCGGGTTCA CTATAGAGCTAATAGACCATATAAAGCGTCCAAtttgtaaaagttcatta ttgtGTTGTTCaaataagattttaaaatgTTCAGGCAATGTCGTATATCT GTTGATAACCATGGCTAAACGTATAATGAAAATACCGGAAGATAAAAGCC ATGTTGCTGCAACCACCCAGTTAATAATCATCATTGCTTTTTCGTTACGT TCGACTGATCTTTGTTTGATGACATCGGATTTAGCTTCCTCTTGTTGTCT ATGTAAATCTTCCTTGGTTTTCTGTGAGAATAAGTGAACAATAACAGCTA ATACTGGTATTGTTATAGTGACAAAAAGATCACTGGCATCTTTATTTATT CTTTTGAGAATCATGTAAGGTATTGGCGAGCACCAGGGTAGTACCAGCAA CGCAGTCTTCTTCATTTTACAATTAGCGCCAAAGCCTGATCGGACAATTT TGACATACCTATAGAAAGCTATACTAATTAAAGTATATCCACTAATCGCT ATAATACCTGTCAATGCTTTTGTCAATGTGTGCAATAATGGACTTGCTAC TTCTAGAATCTCCGCAATCGTCAATGGTGAAAGAACTGTACTGACCAATA AATCACCAATACATAAAGAAATCAATAAAGAATTTGGTAGATTTTGGAGT TTTCGATATCGTATGAAAAGATAGATAATGAATAAATTTATAGGTATCCC GAACGTCATTGTTGTGCTGTATCCTGTTAATAGAATGTATCTCCATACTG TCAAGTTAGCCATATCTTAAGGAGCGATTGATGAGGGGTGTGAGACGTCG ACTGCGCgtggacaaatctttgaacaaaggcttaatctcaGAAGATCGGT AACGCAAGGCTACTATGCTTTATACAATACCCTGTTCTCGTTCAAGTTGT CTGCATAGGATTTATCTCCGGTGGCAGTCAACGCCGGGTACGAGTCTGCC CTCCTTCCAGTGGTCTGTTCGATTCACAGATAGTCGAGACggctttgttt ttattgaaacatttcgaatgttttgaatacGTCGAACGATTTGATTGGTA CAAAATTGATCACGTGCTTAAAATACTGCAataacttcttggaagaatac gATAAAGCACAACACAATTCTTTGCGATATATTTTATCTCTCTCTCGTGA GTAACCTTCTGATTCAAAGTATAATCTTTTCactcttttaaacttttttt aataaaatctttgtttttaattgGCTCATACGACCTCCGTTATGCTACAA TTTTTTTGATTCAcgaaaatttcacaattttttttaattcacggaaattt cacaattttttgtAGTTCACGGAAATTTCACAGCAAACACTTTTTCTTCA AACAACTTTTACCGATCTTTTTGGgcgttttaaagaaaaaaaagtcaaat gtAATAATGTATTATACTTTAAAATGCAAAAGGAATATTTAATCCGTTCT TTAAAGTATCCCTCACTTTGAACGATTAATAGAATAATAATAATGCTATT TTTCCggcatttccaaaatttacatttcgcTCTTCCACCTGAAAATTCTG TATAATATATATGCAATGTCTAGAAGATTTATGAAAAATAACCTGCTGGT ATACTGAGGAATAATATTGACGGGCCGTATAAGACTTTACAATTAGGCCT ATTTTCTTCTCTGTGCACTTTTTCACGTGAATttatattttcgattttca ccgTCTCATCCGAACATTTTCAACGGCTTTCCTTTGCGGCAAAAAGTTAA CGGAGAGTATCTGTAAAAAATTCGTCGGCAAAAACTAAAATCGTCACTCA CCAACAAATTCGTCCCTTTTTACCGACAAATAGTTTTTGCTGACAAGTAG CGTCGGCTTTTTAAAGGAATCGAGGCTTGTAAAGGAATCGAGGCTTGAAA ACACCTATAAACTGAGCAATAGATGGGTAGAACGGAGAACTTGGGATGTC TAAATGTTAaattacagttgacactctctaattcgacgttctactattcg ataggctcccttattcggtgaaatttaaagtccccgtcaataagaaactc tcataaacggcGCTCCCTTtatcgataagctcccttattcgatgaaaatc caattccccttgaagatcgaattagagaacgtcaaCTGTACTTCtgtgtt ttcttttcattttagcACCAGAGCTATACGAAAGTTCTTTTTGGTTCAAA GTAATGTTCGCTGAAATCATGGTTTATCATCACAAATTTAAGTATTATGG TGCTTTCGGATTAGGTACGTTATTGGTTAATACACTGGATTCCTTTTCTA GTTTAGTTCAAAGATGGCAGAATATAATACAACTACCTAGGTGAATGAAG TCGCTCAGTAGTTGGCTCACAAgtagcaaaaattttaaaattgctgaaaa aaGACGGATTCGGATCctctggattttttttcaattatgaAGGACCCCCT Taggtttttttctcattttttggaccaccctggattttaaacctcgtttt actgaccaccctggatttttacactcgaaaaaccagaccccctggatttt tatTTACCAGACCACCCGAGACGTCACTCCTCCTTAACATTGGATGTAAT TTTCTCATTcgatttttaattaattttacttCAGGTGAAAGTATATGTAA TGCTTCTGGATTGGGATTCAGCGGTGTAGATGAAGACCGCAACCCAACAT GGGATAAATTGAAAACATTAAGGCCACTTCAAATTGAGGTATAGAAAGCG TTAGGgctattttatcaatttttatgcACTAAACACTTagtaaccattga gtttaaagccgaaggctagagagGATTCTTCAACCTtttctaaagcaaaa aaaataaaagaattgaaGCCACTTTAGGGATGACGGATTTAACCTAGCGC TTTTTTTCGAAACCCGGCGATAAATCATCTTCGCTTCTTCGGGGGTTTAA ACTCAATGTTAGTAACTCAATAAAAGTCGTATCACGTGAAGTTTTATtgg ttttaataattttccagTATGCAACAAATATTCGTGGCTATGTGGATTGT TGGAATTTGACTGTAAATGTTTGGCTTAAAAAGTAAGTTTGGTTAAGCCT TAAGTTTATTTCCACCTATTTAGCAGACAAATTTTTACATGTAGCAAAAT CATCTTGGGAATTAAATATCTATTTATTGaaccaaaattttactttatat aaaaatttgtctttttttttttcgaaacaacTAATAAATACCGTGGTATT GAATTTCTTTCAAGGAATGTAAGATCACAATATCATACGGTTGATTCTCT GTAGTTTGAGCTTCCATTTTTCGAATCTTCCTAAAGTTTGAACTAATTCC CACAAAGGGGTAACTCTTGTAGACTTGAATTAAAAGGGATGAACCATAAC TAACGCCCAGTTCCCAcaaagacacccccttctcacatacccggtgggat tttttcagccaaaggGGATAGGAATAACGGACTATAACTGATAACtgaat attttgttttcaagtcagaaaatccaTTGTGCATGGGAAAAAATGGCATA ATACTATGCAGTGAGAATTGggttatctgattattttcagtgggaacGAA AATggtaggataattttccaccggggacgatattttggacaattttccag tgggtctgtgagaagggggtgtacgcAGAAGAAACTCTTTATACTTGAAT TGAAAGTGATGAACCATAACTAACGAGATTGTTATACTTTTGTTTAGATG TGTTTATTCTCGTCTGAAAGTAATACCATTCCTTGGTACTTGGGTATTCT CGGCATTATGGCATGGTTTCTATTCTGGTTATTACACATTCTTTATACCA CTTGGGTTTGCGCTGTTCCTCACTCGAAAGGTATGCATTGTTTTACATTT ACAATTTTTTAGGTGCCTTCTCTATTTCAATGAGATATAATTTTACGGTT TAGCTCTCTACCaagaaatttcaagattttaccAGGACTTTTGGTTTGTG GCAGATATTTTCAGTTAATCTAGATTTCCACCCCGCGGTTTTTTATGATG GATATTTTGATGGAACTTTtaggggaaaatcatcctataatattcttaga atattcttaggttaggaccctaattcaaactagatttaGCATGTAATATA CACGTctaaagcataaaatgacaattttgtgaaagtagtgagccttactt gggggtaattggcaaattataattgaaagtgctctaaaaatggcattctt ttattcttagcatattcttaattttttggtcaatttcatcatgaatattc tgaTAAAGTataattcttatataaaaaagcgtgtattctagTTTGTTGAT TAGGCAACAATTAGgctaaaattgaatatgggggtggaggatataacatt ttttgtaaGATCGGGTtaacccccggacattgtgacttttgaccacCGGA CAACAGATTTAACCCCCGGACAACAGATCTAACCCTCCCGGACAAGCATC atttgaccccccggacattcaTAATTACCCCTAAAAAGAGCAGTTTTGCC CCAAACAAGCcaaatttttcactacccctggacaatatatccaatatatc ctccacccccatgtacgatTTTCTGTAAGAGCACAATTAACTGAAATGAT AATCAAGAAgactcaaaaatctcaaatgaaatctataaaataaacaGGTT TTACTAAGGATAATGGAAAGAATCTTTTAGActagatttcttttttattc ggCTATCCCTTTGAAGACAAAAGCTTTTCAAATTACATTACAGGTCCGAA GAACAATTCGTCCGTACTTTTTATCGTCGCcatctttgaaattattttat gacgtcatcacttggTTCGTCACTAGACTCTTGTTAAATTTCTACGCCGT TGGATTCGCAACATTGAACTATGCAATCACCTTCAAATTTTGGAAGTAAG TTTACCACATATCTTATAAAACACTAGAAgcaaagcaaaaaaattaatcC ACAAACCTTTGTAAGATGACCCCAGTTTggtgccggcaatttgatcaatc aAGACCATTCTCTCATCTCCTCGTTTTCTGCCATTTCAGTTGTTTATTCt gattgaacaaattgccgATACCAAACTGTGGTCTAATACTGTGATCTact catcaaatattttttgcttcaACTGCGGTGGCTTGAGAAAGACAGGGtat atctagtgttttatataagatatctgtggttgaCCAAATTAGCTAGAAAC TTCAAAACAACTTCTATAATGTCCTTGTAGCGAATGACTGAAAACCGAAG CCCATTTCATAATATGCATAACTGTAAAAACATCGTGGAATTATTTCTAA CCAACACGTCAATAATGAGCTGGTTCATGTAAAAATGACCGAATGTTAGA GCATTTTGCACGTAATAAGACAGAGTTTTTGCctctttctttaaagttga tgtctttgaaaattctttctaGAGTAATTTGCGAAATTTTATGCTCGgga aaattcttgacaaaatagaaaaacttaaaacaaaatgtaagatctacggc actttttagcctgttaaAGCCTCATAAGTGAAAGGACAAAGGTTTCAATC CAACTCAAGAAGTATTTGTACATTTGAAGTATTTTCATTTCAAGAAGTTA TTAAATTTCATCTAATCCAATATTTTACTACCCTCTTGCTAGCTCTGCAA GTCATTATGGAACCGCCATTTTACTTCTTGGCACCTTATTGGTTATTGTG TTTCAAACGCAACAGCAGAAAAAAGATCACAATCAGAACGACCAATCACC TTCCATCTCTACCAACGGTCATCCCCATGTAACCAATGGCAACCATAATG GGTCCAGATGAAAATACCAGTTGTGTTAGCTTCTTGGATGGTTGATTTGT TGAGTATTAAAAAGTTTAAGATTAGTTTGACTGTCAGGTTCTTTTTAaca cagttgacgctctctaattcaacaTTCTACTATTTAATACCATCGATGTT AATACGCTCCATtgttcgataatattgaaattctcctaGACGAGGCTTTG CCATTCGATATTCCCTTATTGCATGAAAATGCCATACcttttgaaaattg agttagCTCTCTAATATTTTCTCGAAAGCCATTGTATCTTATTTGCGATG ATTATGGGGCTTCAGGTACGCAGTGATCTAATTCTACTTTTATCTCCTAT TTCTCTGTGACATTCTGGTGTATGTCGTTTAACCACAAGaacaaaatttc tcaaaatggcCATTTCTTTTTATATCCATATAGGgagtggacgaacattt ccagtgGGTAATCCAAGATGAATTTCCAGGGgctgttttttcatttttct aagggggtaaaaagttattctaaaatttccagggggtaaaagactgattt tagttcgtccaccctcacttttaagatatgaaaagaattttttaaggtac ttttgccattttccagggggtatccacgcatttcaataatttttttttta attgaaaaggtttatccaccccccccccccaacggTTTTTTAATGGGACA GCCCATTGTGAATTTTAGGGTATCAAGCTcgttaaaattttgtttttttt aatcaaatatttttgatagtTGTACATAATAGTTATCTTTAACAAATTAA GTcgagtattttttttttagttcacaaaatttttgataataatAGTATTT TTTTGGGATAGTTTTGATACagttaatattttttctttgttttatattta caactttgttttgtttatgcTGGTTTATGATATATTTAACCTTGTTTTAG TGCAGTTTTCATGCGATTAAGCACCTAAGTTTACGGTTAAGACCATtgaa agaagaatgaaaaatgaaagaaaaataatcaaagaatggtgtaaggaagc cgaaaaaatgaGTGCTTAAATCAAGGGAGACAGCGCAAAATGGAAAgtcc gaaaaaaaatatattttaaaacgGTCATTGTAAAAGTACGAGCGGATAAT AAAGGCCCATGTGTCTccacggtggcctgcaaacctgtaaagctttatta ttataAGAAGAAAACAAGGCATTTAAAGTTCCAAAACGAAATAAAAACGC TAAAAACGTTTTCTACGTTGTGAAATTATggcttaaaattttcaattctc aAAAAAGGTCCAAagtaatattttctttaaaaaataattattgttTGGAG ACAATTTTTCATTCGTGGGTAATAGACGATATTGGCTTAACataaaaact cagatttgatccccgagaattccccacaatgctttgcgcggaaaataTTT CACCGCGAACTTTTTCCGcccaaagcattgtggggaatttgGTCTTTACt tcttaagaaatattttaGGTTCTCTCACGTTTTAGGATTTAAAGAATTGA AAGTTACTGCCTaagtttattttgtttttttttgaaaatttttgttgtta ttttcccggtttttttgttgttttttctgttttatttacaATGTTTATTC ATGTAcagtttatttttttatgatatatttatatatttttttctatcttc tatgttaaaattttggaacaaatttattttgaataaaggGGCCAATAACA TATTCTCTTTATCTAGTTATTAATGTATATTTAGCAATGTTTATATTGGT TTACAGTTAAATTtctttagaatttcttttgatattcgGCAATGTTATCT GCGTTTCAATATTGTATTTGTTGACCAAATGTGGCCATGGTAATAATCCA C
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000066XLOC_000066Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000122-exon-sc0000001-1491911889:2342121..2342230TCONS_00000122-exon-sc0000001-1491911889:2342121..2342230Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2342121..2342230TCONS_00000122-exon-sc0000001-1510915933:2342121..2342230Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2342121..2342230TCONS_00000122-exon-sc0000001-1575043694:2342121..2342230Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2345185..2345271TCONS_00000122-exon-sc0000001-1491911889:2345185..2345271Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2345185..2345271TCONS_00000122-exon-sc0000001-1510915933:2345185..2345271Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2345185..2345271TCONS_00000122-exon-sc0000001-1575043694:2345185..2345271Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2345819..2345964TCONS_00000122-exon-sc0000001-1491911889:2345819..2345964Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2345819..2345964TCONS_00000122-exon-sc0000001-1510915933:2345819..2345964Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2345819..2345964TCONS_00000122-exon-sc0000001-1575043694:2345819..2345964Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2346382..2346459TCONS_00000122-exon-sc0000001-1491911889:2346382..2346459Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2346382..2346459TCONS_00000122-exon-sc0000001-1510915933:2346382..2346459Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2346382..2346459TCONS_00000122-exon-sc0000001-1575043694:2346382..2346459Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2346721..2346813TCONS_00000122-exon-sc0000001-1491911889:2346721..2346813Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2346721..2346813TCONS_00000122-exon-sc0000001-1510915933:2346721..2346813Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2346721..2346813TCONS_00000122-exon-sc0000001-1575043694:2346721..2346813Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2347442..2347497TCONS_00000122-exon-sc0000001-1491911889:2347442..2347497Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2347442..2347497TCONS_00000122-exon-sc0000001-1510915933:2347442..2347497Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2347442..2347497TCONS_00000122-exon-sc0000001-1575043694:2347442..2347497Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2348327..2348372TCONS_00000122-exon-sc0000001-1491911889:2348327..2348372Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2348327..2348372TCONS_00000122-exon-sc0000001-1510915933:2348327..2348372Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2348327..2348372TCONS_00000122-exon-sc0000001-1575043694:2348327..2348372Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2348520..2348646TCONS_00000122-exon-sc0000001-1491911889:2348520..2348646Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2348520..2348646TCONS_00000122-exon-sc0000001-1510915933:2348520..2348646Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2348520..2348646TCONS_00000122-exon-sc0000001-1575043694:2348520..2348646Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2349764..2349796TCONS_00000122-exon-sc0000001-1491911889:2349764..2349796Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2349764..2349796TCONS_00000122-exon-sc0000001-1510915933:2349764..2349796Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2349764..2349796TCONS_00000122-exon-sc0000001-1575043694:2349764..2349796Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2350198..2350288TCONS_00000122-exon-sc0000001-1491911889:2350198..2350288Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2350198..2350288TCONS_00000122-exon-sc0000001-1510915933:2350198..2350288Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2350198..2350288TCONS_00000122-exon-sc0000001-1575043694:2350198..2350288Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2354636..2354734TCONS_00000122-exon-sc0000001-1491911889:2354636..2354734Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2354636..2354734TCONS_00000122-exon-sc0000001-1510915933:2354636..2354734Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2354636..2354734TCONS_00000122-exon-sc0000001-1575043694:2354636..2354734Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2355105..2355208TCONS_00000122-exon-sc0000001-1491911889:2355105..2355208Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2355105..2355208TCONS_00000122-exon-sc0000001-1510915933:2355105..2355208Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2355105..2355208TCONS_00000122-exon-sc0000001-1575043694:2355105..2355208Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2355488..2355552TCONS_00000122-exon-sc0000001-1491911889:2355488..2355552Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2355488..2355552TCONS_00000122-exon-sc0000001-1510915933:2355488..2355552Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2355488..2355552TCONS_00000122-exon-sc0000001-1575043694:2355488..2355552Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2356218..2356350TCONS_00000122-exon-sc0000001-1491911889:2356218..2356350Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2356218..2356350TCONS_00000122-exon-sc0000001-1510915933:2356218..2356350Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2356218..2356350TCONS_00000122-exon-sc0000001-1575043694:2356218..2356350Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2357264..2357415TCONS_00000122-exon-sc0000001-1491911889:2357264..2357415Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2357264..2357415TCONS_00000122-exon-sc0000001-1510915933:2357264..2357415Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2357264..2357415TCONS_00000122-exon-sc0000001-1575043694:2357264..2357415Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1491911889:2358163..2360221TCONS_00000122-exon-sc0000001-1491911889:2358163..2360221Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1510915933:2358163..2360221TCONS_00000122-exon-sc0000001-1510915933:2358163..2360221Clytia hemisphaericaexon
TCONS_00000122-exon-sc0000001-1575043694:2358163..2360221TCONS_00000122-exon-sc0000001-1575043694:2358163..2360221Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2342121..2360221 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.460052 1.98336 0.696278 0.0148104 0.181793 0.0142145 0.0723008 0.0539126 8.92012 7.98888 4.75808 4.81919 3.06053 6.15761 0.19018 3.40461 1.7091 0.00953288 3.47184 2.42998 0.503411 4.47937 0.834034 3.34675 0.162576 0.21507 2.00839 1.05542 0 0
Blast
BLAST of TCONS_00000122 vs. Swiss-Prot (Human)
Match: MBOA2 (Lysophospholipid acyltransferase 2 OS=Homo sapiens GN=MBOAT2 PE=2 SV=2)

HSP 1 Score: 239.58 bits (610), Expect = 5.885e-68
Identity = 138/435 (31.72%), Postives = 220/435 (50.57%), Query Frame = 3
Query:  159 EDLEKKTGLTADQIVPLITLFFAFWVGHIFRIWLSPQRISSQKRHFISMALGIIMLSIVFGEQAFHLLYSCLISYTLMRFVDTSVVHVWVMGSAMLYLSLIHFKRMMLQD-DNYVVDISGPLMLATIKITYVGCGIHD---KYHPRTTSDDARIILKKFPSPLEYLGYIFNFSSVFTGPPPEYQDYMDFIDGKQYDKYKDELKGKQ--------PSPMLVSIQKFILGYMAIGMYGFVSSIFKPDFYKTPELYESSFW-FKVMFAEIMVYHHKFKYYGAFGLGESICNASGLGFSGVDEDRNPTWDKLKTLRPLQIEYATNIRGYVDCWNLTVNVWLKKCVYSRLKVIPFLGTWVFSALWHGFYSGYYTFFIPLGFALFLTRKVRRTIRPYFLSSPSLKLFYDVITWFVTRLLLNFYAVGFATLNYAITFKFWNS 1424
            + L     L  DQ+  ++   FA      FR +L   + SS  RH ++  LG+ +    FG  A H L    ISY +M  +    +H +    A+ YL++    R+ + D   Y  D SGP+M+ T KIT + C IHD   +     TS    + +++ PS LEYL Y  NF  +  GP   Y+DY+ FI+G+ Y   +    GK+        PSP    +QK ++  +++  +  + +    ++        ++ W  K+++  I +   + KYY A+ L ++I NA+G GF G DE+    WD +  LR  QIE +T+ + ++D WN+   +WLK+  Y R    P + T++ SA+WHG Y GYY  F+         R +R   R YF+    LKLFYDVITW VT++ +++  V F  L+   +  F++S
Sbjct:   13 QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTSFSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYFIEPSQLKLFYDVITWIVTQVAISYTVVPFVLLSIKPSLTFYSS 447          
The following BLAST results are available for this feature:
BLAST of TCONS_00000122 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MBOA25.885e-6831.72Lysophospholipid acyltransferase 2 OS=Homo sapiens... [more]
back to top