TCONS_00000118 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000118
Unique NameTCONS_00000118
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2386

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000118 ID=TCONS_00000118|Name=TCONS_00000118|organism=Clytia hemisphaerica|type=transcript|length=2386bp
ATCGTGTTGTTAGTATagttaaaaaaagttattttttgttttgatgaagg
GCGTCGATGAAGGAGAGGTTGACACGTAAAACTTGGAaacaatctcgtac
ccagagccacttgcaccatcttttgattttactgattgGCGTGAGACCTC
TATTCGTGAGCGCTATATCAGAATCATGAAGAAGCGAACTAAAAAAGACT
GGATTCAATTTTGGTTGGAGACATGttaaagaagaaaacaaaaagaaata
aacaaagCAACAACACAGATTTGTTCAAAGAGATTTTGAATAGTTTTGGT
GATTTTGCCGGATTCGTTGGTTTATTTGTATTCATTGACATCATTGTTGG
TGAATTTGCAATTCTTgacgtctttttttatttttcaatggaTCTGTTGT
AGTGATATATGCATACAAACATAAACAAACCGTACCGTTTTGCAAACTTT
GGAAAAATGATGATTATTCTACGCTGGCAATGGGTTTTACTTATCTTATT
ACTAACAATTGTACAAAAAGCATGGACTGGGAAACGTACTAAAGCTCTAT
TTTCATTGCGAGAGTCCAAAACCTCCGATGGAAAACAAACTGACGTTCTA
TTAAATAAAGACAAGGAGCTAGACTCACTTCTACAACAAACGAAAGAGAA
TTTGATTAAAGCTTTCGGGCTACGTGAAAATATGATCTCCAATGGTGACA
AAATACAGAAGCGTGAACCTCATAAATATATGAAATATATTGCTCAGAAA
TACAAAGACAATTATAAAAACGGTATCCCGTTGACGGCAAATACAGTCCG
TGGATGCGTCGATATAGatcACGGCGATAAACGTCTTGCAGATTTCCCTC
ACGTGTCATTCAAATTCGACGTGTCCGAGATTCCACAATCTGAAATACTC
ATCCAATCCGAATTAAAAGTATTGATGAAACCGGACTCATTCGGGATCCG
ATCAATCCGAAACGGTTTCTTTCGAGCCACGGTTCTTGGAGTCGTAGCAC
GTAACAAAGCCGAAAACAAAGCTAAAGGACGTCATGTCTATCCAAAGCTC
TGGGAAATCACTTCGAAAACCATCGCAATGGTTAAAGGACAAACAGAACA
TTGGGTTACATTCGACATCACAAAATTTGTGAACTACATCATAAACGTGC
AACGTAAGCACGTGAAACTTGTCTTACGCGTAAAGCCACTAGGTGGCACA
TCAATCGATCCTAAACTCATGGGGCTTAACAATCACATTAAACTTGAAAC
AGAGAAAGGACTATTAGTAATTTACTCCGGCGAAGATGAAGCTCCGATTG
TCAAGAAAAACAAACGTAGTAAACGCCACGTCAGCAATACATACACGGAA
AAAAGCAACAAGAAAAACCGtaaaaagaacaagaaaaataagaacaaaaa
taacaagaacAGACGGAAAGGCAAACGCCGTAGAAAAGCTTGTCGACGTA
AGGACATGGAAGTTGACTTTGATAAGTTTGGATGGTCAAACTTCTTAATT
GAGCCGTCAAAACAGAACATTTATTACTGCCACGGACATTGTAGGTATCC
ATTACCTCACTACGTACCGGCAAGTAATCACGCTACGATACAGTCTATAT
GGCATGAGATGCATTCTTCCGTTCCGCCACCGTGTTGCGTACCAGATGAA
TTTGATATGCTTCCGGTACTATCTTTAGACGGAAACGACCGAGTTgtctt
caaaatgaaagaagGACTCATTGTCAAAAGTTGCGCTTGTAGATAGAAAG
TTCAGCGTAAAGTGAAAAGTGAGCCAAGCTTTAGGTGTAGAGCATAAATT
AATTTATTGGGTGCGGAACAGAGACTGGAAAGTTGAACCAACTCGAATGT
ATAAAATGTCATATCCTTTGCAaacaactttcaaatttttaccgCAGAGA
ATTCCCGTAGAATGGAAAATtgagcaattttttttcaaaagcttatcAGA
AGGAAACTATTGCAACAAAACCAAGTGGCACTTATAATTAATCATGCATT
CGAATTGAATACCAAACGAAAACTTTTAAAGTTTGACAACAAAGAAGATA
CAATGCCAATACCATTCCAGACAGATCGAGGAGACACACCATGATCCAAT
TTTTATCTTAAATTATGGAGAGCTGGGTCTCACCTTTCTATTAtgccaaa
gaaagaaaaacaattatacCCAAAACTTAAAAAGAGACATCTAGAAAAAC
AATACTAAGAGGGGGGACGTATGATATATTCCCCCTCATATTTTCAACCT
TAACTTATAAatatgttataaatatgaaaaaactATATTTGAAGCCCTTA
TAAATAGTTATATTAAGAAAGAATCATTATATAATTTGTGATATAGCAGt
tttaaagtaaagaaaaacagaagaaataATCCAAGT
Run BLAST on NCBI

protein sequence of TCONS_00000118-protein

>TCONS_00000118-protein ID=TCONS_00000118-protein|Name=TCONS_00000118-protein|organism=Clytia hemisphaerica|type=polypeptide|length=445bp
MHTNINKPYRFANFGKMMIILRWQWVLLILLLTIVQKAWTGKRTKALFSL
RESKTSDGKQTDVLLNKDKELDSLLQQTKENLIKAFGLRENMISNGDKIQ
KREPHKYMKYIAQKYKDNYKNGIPLTANTVRGCVDIDHGDKRLADFPHVS
FKFDVSEIPQSEILIQSELKVLMKPDSFGIRSIRNGFFRATVLGVVARNK
AENKAKGRHVYPKLWEITSKTIAMVKGQTEHWVTFDITKFVNYIINVQRK
HVKLVLRVKPLGGTSIDPKLMGLNNHIKLETEKGLLVIYSGEDEAPIVKK
NKRSKRHVSNTYTEKSNKKNRKKNKKNKNKNNKNRRKGKRRRKACRRKDM
EVDFDKFGWSNFLIEPSKQNIYYCHGHCRYPLPHYVPASNHATIQSIWHE
MHSSVPPPCCVPDEFDMLPVLSLDGNDRVVFKMKEGLIVKSCACR
Run BLAST on NCBI

transcript from alignment at sc0000001:2214645..2251916+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000118 ID=TCONS_00000118|Name=TCONS_00000118|organism=Clytia hemisphaerica|type=transcript|length=37272bp|location=Sequence derived from alignment at sc0000001:2214645..2251916+ (Clytia hemisphaerica)
ATCGTGTTGTTAGTATagttaaaaaaagttattttttgttttgatgaagg GCGTCGATGAAGGAGAGGTTGACACGTAAAACTTGGAaacaatctcgtac ccagagccacttgcaccatcttttgattttactgattgGCGTGAGACCTC TATTCGTGAGCGCTATATCAGAATCATGAAGAAGCGAACTAAAAAAGACT GGATTCAATTTTGGTTGGAGACATGGTATGTAGTGTGTTTATAAGTTTGA AGTTTCACCACTGTCTCAAATATCCAGTGTGATTGCAAATTCTCTTAACG GAGTTGATTTCTTTCGGGTAGATGAATTAAATGTTTTAGTTTTCTCCGGC TTGGCCCCGTCTGAATCACTGGgcattgaaattttttgtgtaccttatcg gccctttttacgccggccctaatttaacgccggcccattttacgccggcc cttattacgccacagcctgattttgggcttacgccaattagggccgtaaa tgacgccaaaatttgttagaatggctatttatgcttcaatttacattaaa acaTCATTTCAGTAGTAAGCTGTTGagaattccattgaaaatcactaatt tttgcaaagtttcagatatggagtaaaacaatggataatttcttatcttc gaatcatacctaaaatcctttaaatagaaaaaaatggtcaaaaattaacg ccacttttaagtaaaatttgcaaaactttGGCCCTTTTTGcaccggccct tttaacgccggctCTTATTACACCAAGAGCCTAAAATTGACGCCAATAAG GGCTGGCGTAAAAAGGTCCGATAAGGTATGTAAaacttttactttttact taatTAGTAATATTGTTAAGtttgacaaaaataaaagattttttttgaaa agctgtgAAATGTTGACGTAAatttcaaatatcttttttcaattttatgt cATATTTCAAGCTactataaatcaaaacaaatgcgATACTGTATATCATC TGAATAAAGAATTACAACTATAGCAATAATCTCGTACCTAGAGCTGCTTG ATTCACTTCtttattttactgatggactAGATACATTGGACTGTTCCATT AAAATTTCatgtaggggggggggggggNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgg ggggggggggtggacaaaccttttcacgtcaaagaaaaattctttgaaat gtGTGAATCCCCCTGGAAatagcaaaatatttgaaagaccCTTGGAAAAT TTATTATCCTACCTTTGAAGTGAGGGTGgatgaactaaaatcagtctgaG ACCCCCCTGGGTACTTTTAAAACAAGTTCTTACCTCCTGTAAAAATGATT CTTCTCGGattaccccctgaaaatgttcACCCGTCcaccctgtatggata taaaatggaatggacgtgagcgctatcagaatcgaATAGAAGTGAACTGA GGGACTATGGGCTCAAGTTTGCAGCTTATAGCAGCAAGCAATGTCGTTTC AACgttcttttattattatataGTCACTATGGGCGCTATTTGAATCTtga aagaacatccaaattagTCTTAGAATACACTGGATTGTTTACTTCGGGGT TTTTTCACAACCATGTACAAAATTTTCTATCGCAAAAACCAGACAAAGGA AACTATTGAACCGCCCTTCTTTCACCCCCAAAAATCTGATACCGCTTTTG AGCGGTAAAACTatgtttcaaaataattttgttacCATAATGAATTATGA TATACGATTATCAGAATTTTAAAGGagcttttctttttgctttatcTAGC GCTTTTCAACGATCAAAGATAAGACAGAGAAAAGAAAGAATAGCTGTATA TAGCTCATATCGCCGCGTCCAGCGCACGGCTTTACAGTATTTTTTACAGT GCAATTTTCTCTCACAATATTTGGTTTCTTTTTCGAAGTTGCTTGATAGA GGctgttgattttttgaaaaaaatgaagttctttGGAACTATCGGTGTTT TGTAATATTTTAAATATACCCTGGCAGTTCTAAGACTTTCATGCTAAATT TGGAAAGAAAGTCAAAACCGAAGAGGCAAGTAATATATAAGTGTTATAAA CAGGGACGCTTATCTTCACAAACTTAATTTGAAAATTAGTCCCTCTAAAG GTCTGTTTTCGAAATCGTAACATTTCAGAGCTACTTCTTGCGCTACCCTC CAAGAACATTTCCAATAATTCttgttcatatttttattcaccAAGTTGTA TGGCTATTTATACCGAGTTGTATGTCTTTAGAAGCCTTAGTAAATATATT ATAAGGAAATATTTTCatcatcaataaaattttttcctgtatCTAATTTC TACTATAGCATAATAAAAATAGGCGTGTACTTCGGGAAACCATGGATACA AAACAGCGAATTATTTTCTCGGTAATTTCCGATATATTGGCTTTTTGACG gtcttttaaattgaaataatgTGCGCAAAAAATCTTCAGACATAAATGat caaagtaaaattttcagcGTGCTAATTGTGTTCATACTTGCATTTttaga atacactttataaccCTTTATAAACATTCGCTCACTGTGAGATTCACAGA CCAAATATTCTGACCTGTGAAGACAAATCAGAATTTTTCTCAGGGAGAAA ACAAAAGTTTCCATTGAAATCATCCATAAGCCCCTGTTTCtagaggcccc cagcggtttacgtgatggcgtgattgggacttttttcttgcgtgatggcg tgattagagatttattttggcgtgatggcgtgattagggctGCCACTGGG GGGCCTCTTTCTATCTAGTAACTCAGGATTTTAGTGCCGTTTTGAAGTTA TTGTGGATGCTCTAGGGCCTTCCCACTGTATTTACGGGGCATACTCAAAG ATTTCTGTAAACCCGAAAGGGTTATACGGAGTGCTTAAAGCTTTTCCggt caaaaaagtgaatatcgtaGAAATTATTTTTGCTATTGCTTTCGAAAtac cgcgaagcttctgattggtcaaacgCTGAAATCAGTTCGTAATGTCACGT AAAACAgtacacttttcagccaaagtacTTTAACTAGCCCTCGTAGGGAT TCATAGATTTGTGGGCATATTGAGAAAATATTATTACCTAGTTATAATGC CTAGACGACCCGGGGGTGCTAGTTTTGCGGGATACCGGGTATGTACCGCA CGACTTTTGGTGGTCGGGTCATTATAAGGACCAAAACGGACCATTAGAGG GACTTAAAGGGACGAAAAACCCGAATTTCTGAGAGGTTTTGGGTTTAACT AGCAATCAGAAAGATTTCCGGTAAGCAAAATCATTCTCATAGATAAGATt aataaattttaagaaattataCGGCTAATAATAACGCAGCCTTGCCAATG ATAAAGACTTCCATTTAAAGCCTTTTAACAGAtttgttttccttaaaaaa aatcGGATTAATTTGCGTTAATTTGATCATCATAGCAGCTTAATACCTAA ACGTAAACTCTTTTTGTAAGGTGTTTAATACCAATTAATTGGGTATTTAT TCGTGTACTAGTTTCGTATTagtcattttgatgttattataaAATGATTA TAATTTTACTGGTAAAATTTATTGACTTGGACACAGTCTGTCAGTCAGAC ACAACTTCATTATCCGTACCTTTTTATCAGGTGTACAAAGGGCACTggct aattcgaatctctattaAATTCAAATCTTTATACAATTCGAACTGACTCT CAGTTTCTGTCAAAAGGAAAAACCTCGTAAAATACTTTCTactatttgaa aaaatagtctCTCCACTTGACTTCGAGTTAGCGAGATGTCACTGCGGGGG GCGATTCGACACCCAGGGTGTATGCTCCGTAGTCTTTTGTGTCGCACTGC ATTTAAAATTGTACTTCCATTTACCCAATTAgtctgaaaaaatatttttc tatggtCCAGCTTTTTAATATTGATTTTGAAAGCTGAACCCCTTTCAATG TTTCAATTATTATGTCGAAAAACTGAAGAAAATTGCATGGGCGTAATCTC AAATTAGTTCAAAACCGAATAAATGTCATTTCAAGCTTAATTTGACTTAA ACGGATAAGcttaagttgaaattttttaatctttaacgagaaaaaaaaat ctgtggAGGAAAAACAGTATCAAAATAAGGAGAGTATCTGatgacaaatt tttgaaaatctaaattccttaaaatataaaatgcaCGTTTTTTAAGCCAT ATGAAAAAGGGGGTTGGACACTTTGGTGGATCTGTTATTTATaatttgat tttgtgtttttaagGAGAGGTCaaagttaagaaaaaattttgatttgctT TTAATAGTGTTTTGATAGAAAAATCCAAATATTATTCATAACGTACATTC CATTTGTTCTTGAACGATTTGAAAGCGTTCCAGTCTTCTATTCTGATCTA ATTTTGTCGTGGATTTTGCAGTGGGAGGCCTGGTAAAGCAGCCCTCATTT TCGGGGAATGGCGGGTTCAACTGAAGCGCGTAAGagtagttgaacccgac tgagtaTGCGGCACATCAGAGGCCGACTATCatttctctccgatgggaaa ttggcccgctccctttagagctttagcgtgagCGGCCACCAATCCACCAT CGGAGTATCAGATAAATTTTGGTATGGCAAAGAGTAAATAGAGCAAAGAA TAGGAAAGAATTTATTTTGGGGTCCAAAGGGTTAAAGAACACTGGTAATC TTTGCCGTTcctatttaaaaaatgtttattttaattgctaaaaaagaaaa gacaaaattAATTTCCTAGTGTCAAACTTGACAAACAAAAGCGTGACTTA AAATCAATGCGGTCAAACACACAAAAACCAAAATCAGCTTGAAATCAAAA GTTTTGCGGCAAAAAGTGATCAAATTAACCCCATACTATGTTTTTACGAT AAGAAGGGGGAAGggtataaaagaaaaaaggaggAAAATTTGCTACAAAA TACGATTAGTTCGTTAAGAAATCTTATTATCAATTTACCGATCAGAGGGT GATAGAAATATTACACTctttctataaaagaaaaaagtatttaAGAACAT AAACCTTCCAGCCCTAAAAACTTTCTAAGAATATTTTGCTTTGTAGATTC TGAAGTATTATGTTCCCATTATATTTAAAGCCCAAAGGGTAAAAAGAACC CGGTATTTAATGATTTTAGATGCTCGAAACTGTACAGCGATTTCCGCTTG GCTTATTTGACAGATACTGATAGAATTacaacaataaaaaatgaacgAGT TTTTCTTATCATAAATTGAAAATATCTCTCAACCTACGGCAGTATGGCCG ATTGCCAACtaatttcatttttgacgtgGTCAACCCAGTGCAGTAATCTA GGCTTTAAGACAATTTTTCGATAATTGTCACGGGCTAGGCGGGTATTCAA AGTGGGAACCCCCAGTTTTGTAACCCTGTAGCTTTTAATATGtactttaa aaatacatttctCGGACGCTTTTTTGATATTGAAGTTTTGGAGATGGTCC TTGAGAAATTGTTGTATTAGAATTTAACAGAAAAGGACGATAAAAAATCA GATTTGAAAAGTTACTAGAAAGAAAGTTGCGGTAATTAAAATAATCTAGA CACCCGCTGAGCCGCTAATCTCACATAAATTTATaggattttctttttct ttctgtcAATGAAAGGCTAGCTTCCAATGTATGTGAgttataaatttatt tgatgtgAGACTTCGGAGACCGCACACCGTTCGGTTCGATATAGCCATAT TGGATGATTAGAAGAAACGCAACGTCGGATtccgaattatagaaagattt atCTCTGATGGTTTAGACTACACTCTAAAATTGCGTTGTGAATTGTAATC ATATTTCACATTGGTTGGGCTTAATCCAATATCTTAGATGATTACCATGC TTTTGTTCTCGTTGGATGTAAGTACGCTATATAGAATCGGTATCCGTCGT CACAGTGCATGTTAGAAGCCAAACCAAAACTGAAGCAAGACGAATAGACC AGGGGGTTTTGCTTGAAAGATTAATTTCTTTTACTTTATTTATAAATCGC ATTGGAAAATTAAGCATGTAATTTTGATAAGGTATGCATAGAATCGGATC ACTTTCGGTTTCACATTTAACACTCCCAGGATGAAATATTGaaggttaat tttttttcatcgaatttttaGCAATGGTAGTTACGACTGATAGAATCGAA AAATGATCCCGATTTTCGttgatgaagatttttttcAGGTGGGCATTTTG TGTTTTCTTGGTAGCAGTAACGTTGATTTTCTCAATTGTGTTTAGGATAA TTTAAGGGGTAATAGAGATGTGTGAGATGCGTGCGATAAATTTCTGAACT CCGAAATACACAAACACACCAAAGAGTTTTACATTTCCACGATTCTGGAA AAAGTATTTTCTAATTCCCACTACCGAATTACCTATTATTTCACCAAAAT CGAagcaaaaagataaaaaagatcTAGAGTATATAATCCAAAGTATTgga aaaaaacttcaaaaactctgatctaaaaatgaatttattCACAACACCTA AATAATTTCATGTTTATTCTGAAATCACACACATCCTACATGTATTAGGG GTTAAAAATTACCTATTCTCAGTTTAAAAGCGCATTTAAtagaagttttt tcaaaattatcacGTGACTAGCCCAGCTGTATATGAAAGTTTGATGCGTT CTACATACAATTAGGAAATTTTATGGTATTTTTCAAATACGGGGTTAATG ATTTTAGATATTCAGCTATTTTTTCCAGTGGCAAGAGGTCCGGCCGGGAC TTTCCCGCCATTGTCCAATTTTTTCTAGATTACGGTATGAAATATGGATA GGAAAAAATTCATGAGTATTGAATAATCTCTCTTACGAGTGAAATTTAGG aattaaaaatttactttaagattttttcattcatttagtTTTCATGTTTC CGTTGGTCGTAAAAATGATTTGCTCGGTGTTAGTAACAAGTTgtaataaa aatgagaaaacctTTTCTTCTTGACACTTTTTgtgtaaataaatataaaa agttGTTTCTAAATGTCTTTCAATTATTACATTTTTGGAACCAGTTTAGT GTACTTTATTTGTTTGTTGTCGTTGTTTGTTTTTACAGCCGACTCACTAT AACTGGAACCTcttttattcgaatctctctgtatttcgaactaaaatatt ggtccccccTGTATTAGAATCTTTGTCTAATTCAAAAAAGACTTCATTGT TCGTTGAAGATCGAATCAACAAGATTCAACTCTATCTCAAGTCTGTCTCT TTGAGGCGGTAAAAGCCCTTAGTTCGGATTTTGATTCTGATAGTGTTCAC GATGGCATCAAGTCAATAAGTAATTTCAAAAAGTGATGCACGTGGAGTAT GAAGTTGGGAGAATGCTAATATACCTCAGCATCCAGACCCTAGGTTACAA GACATGTCATTATCAAGAGAATAGTAAAGTAAAAATGTGTAGGCGTGGTC AGGCTGTCTAACAATATAAGATTAAAACATTATGATAAAGAACACCTAAG CACGTAAACGAGAAATTAAAAGcaattatcaaaatttaagaCAGGGAAGG ACGGGAACCATTACCATTATGAGGAAATTTGCTGCATAATGGAATACTGA TATATACGAATGATATAGCTGATCATTTTGACATTGATAGCAAATAGATC TTATTGATAGCATATCATTACTTCCCATAAATTCCCTGAATTAAATTTCA TTACAGAATCAGCACAGGTTTCGAAATAAAAGGCCGTTCAAGACGTACAC GTTTTtacataagaacaaactatataagaacataaggcttcgatggcaaa aatttaaaaaaaagttaagagcattgtaaggctttgcagactctaaaaca gctaatttctgaggaaaatggacaaaaatacataaaaaatggggaaaata agaacatgttaaaaaagtttttaggctagAAACctaaaaggttaagaaca tccgaagacctcaaaaattttggatgttcttataaaaaactgtgTATCTC AATATTTAtgtataaaaaataattaaaatattcagCTGAAACAGGTGTAA GAGATTATCTGAAAGGCATCATGAACTCAGGAAGTAGTGAAATCTCAATA AAATCTATAACAAGAATGAAAAGtcatcattaaaaatgatatttgataTT CATTCATCACCATAATCATTAAATTTAATGATCATCAAAGAATAAATTAA CCAATCATTAACATTAATGTTCCATCAAAAAATCGTttgatttttaccaa aaaatgcattttaagCGCGTGTGGATTCGCAATCAAGCACATTTTAATCA TAGTTTTTACGTATTTTGCAATATTATTTTATTCTCGGCCGATAATTAAT TCTTCGAACTCTAAAAGACAGACTCTCATAATAATCTTTGATTGGaatac atcttttcgaccgtagctgccaattgccgGGCGGGCATTTCCCCCCTAAa atcgatccaatccttttttgacaccttttttctattgtctataagTGCGA AAAATAAACTGGGATGGTTTTAGGGTGACAAAACGGACAAAGAAATGTCC ACgcagcaattggcggctacggtcaacATTTGTTGAGCTCGTTTTTCATA AACACTAATTCcaagctggtacacaacgttatttcaacgtttatctaatg ttcataatgtccatataacgttagataaacgtcgaaaaaaatgttgtgtg ccagctgggcttaTAAAGTCATCATTGCTTCCAAAGCGTAGCCATAAGTG ACCCATAATGTCAGTCGCTTCGAAGATTTTGTTTTCTTGTAAAGTAAAAT ATGGAAATTAGTATACATTAGATATTGCGAAATCTCGCTTCCTTTTTTCC GTCCACATAATTGACTTTTTTGGCATTTACCGGGGGGTTTTAGAATGAAA AAATGGAAGTGcatctaaatttaaaaattgctttAATGTATGAGATCTTA GTGATGGTGACAATGTTTATGGACTTTGGAATATTTACAAGaaatgcttg ttttttttgttagGGATCATTTGAGATACAGttaactttctctaattcga tctctGAGGGActattttttcgaattagagaaagatttgaatagtAGAGA gcaatttaaaccactttcgaGTTGACGGAACCAAttttttagttcaaatt acGGAAAGATTCAAAAGAGGAGAGactcgaattaaagagagttgATTGTA TTAAAAACTGTAATAATCAAAATACATGGAATTCTTAGTTGATAATTTAG TCTTCGCACTATCGATGATCTGGATGAAAGAACTTCAAGGTAAAACTGGA AAttgaaattggtaatttttaGACAAATGTTTGGGAGTAAAATTCTATGC TGTAGATGGCCAatgtttgaagttttactaTTGACACTCTAAGATCGATT CCGTTAGTATTGGGAAATGCTGAGGGTGGTGCTGTCAAAATTTTAGAGTC CGTGAGAAGGCTTTTATCCAATTCCTAACAGCCACTTCAAAAAGCTGTca atgaaactaattaatcaccTAGTTGGCCCATCAACCGAAAACACATAAAC ATAGTATTAACACTTCATTATCCCAACTCGTAAACATtcttaaatatttc aattaaGCTCGTTAAATTTTGACATACATGTCGCTATTTTGACCCCTCAC GCTTAATTAATCCTTGCGCGACGAATTTTTTACTTGTTTTGTGAAATAGT CTCTTTTACAGTCCTTCTAGCAAAAACATCAAGTTTCCATGTCCAAAGGT TAAAGGAACTGCGCCTGAACATTTTGCCTCCATAACTTGAACAATATTTC GAATGCCTGAACGAGTTTCCTCAACCATGAAATAACCTTCATAAAAAAAT AGTTTCAGTGCGAGTTTTCAAATTATGTCATACTCATTCTACTATATTGC ATTGTCACGGCTATCCAAGTTTGTCCAGGGATgacactcgatctgaaaac gggTGCTGAAAACTACCGTTATGTTGCTGAAGACAAAAGTCTACTGACTC TCAAATTGGAATCTTAAaatgcagagaaaatttgagaagattagagcaaa aaaacaaactttttgtccACCTAAAGGTAAATATTTTCTAatcttgcaaa attttagctaaAGACCAAAGCCTACCTTCAAGGGCTACACTTGTAGAATG CCTCCGGACTTGTAGTACATGTTTGTTGTACAAGTCATCATGGATACGAT CATATGGGTTTGCTTTTCCAAGTTTATATTACAACTGCATTAATACTCAC AGTATTctttgaattaaaaagaaattagaaGATTCTCGACAAAACTCCAA TACATCTTTCCGACCGAAGTCGCACGGTCAGGCGCGTGTCACTTTatcat ttaatttaccaccATAAACTCGATTCAatcttttttaacacttttctcta ttgtctttaggcgcgaaaaaaagactgagacggttttagggtggtaaaat gtCCGCGCAggaattggcggctacggtcgaaaaggtgtatacgaattttc cttttttagaGTACAAAATGTTGTTTACGCATGCAAATCGGTGTATATCC GCACCACGATTTCCCGTGTGCGGGAattaaaaaactattttctgTGGATA TGTGGGTGTTAATCACTGCCACATTAAATTCGCATTTGCTAAGTAAGAAA AGGAATTACAGTAGTTTCTTTGATAGAATTTTTGTTTATGAATAagtgaa ctttaaaaaaatgttgttttggaTACACCGTTTCAATCGTAGTCGCACGG TCAGGcacgtgccacttaattatttaattatccccttaaactcgatccaa tccttttttgacacatttgtctattgtctttaggtgcaaaaaaaggactg ggacggttttaatgggataaaaagCACAAGAAAatacccgcgcggcaatt ggcggctacgaatgaaaaggtgtattagtcAGACTTTTAGAAAGCCATTT TTGCCCGTGTATATCTGTTGACGTTTTCCTAAGAGGTAACCAGATCGAAC TTTAGTTCAAAAaattcctttcattgaaattttctcaattttggttactt ttcaaagaaaatccaAAGTACAAGGCTGTACCTTTTTATCCaaggaaaat atgaaaaatctaAATGTAGTTTTTCACTTAATATACTCTAAAAAGTGTCT GGCCACAGTAGAAAACTCGGTagaaaagtcttcttttttcgTCTTCAAAT GTGGAACTCCTTAGAACTCCTCTGTCCTCAACAATATGTTTCCAACAGTG TATGTATTTTTGATATTGGTAGTCAACATTGAGGCGCACACCCTTAGTAC ACTCACattttcttgtctttaaaaaattaaagatttactTATTGATATCC TTCCAATTTGAATTCTATATCAATTTTGGCACTACCTATATGTTCTGAGT GTTCTATAGTCTAATTTGTATGTCATTACCTAATTCTATCTGAAATGCAT TAATGATACCCTTTTTGATTTCAGTTTTACACCAATTTTCGAAAAGANAT AGTCTAAGTGTTCTATAGTCTAATTTGTATGTCATTACCTAATTCTATCT GAAATGCATTAATGATACCCTTTTTGATTTCAGTTTTACAccaattttcg aaaagaatgcttttgaagttcatttttgatgaaattaaaaATGCGGGGTT TTGCGGGTTTTGAAATTATAATTAGTCCTAATTATCGAAATACGTGTTTA AAGATCAACTGTTTGAGCTTTGATGTGGCAAATGGATATCCGGTAGCCTG CTACTTCAGGAAAATCTTTGTCGATAGAGAAGATGTTTTATAACACTTCC AGGGTGATTCATAACAGCAGTGGATCTAAATAGGGTAGACaataaataca ccttttcgaccgcagcgccaattgccgcgtgggTATTTATGTCTGTTTTA CCATCCTAAAActgtcccagtctttttttcgcgcctttaGATAATAGAAA AAGGATTGGGCCAAGTTTAGGGGGATACtcaaaataataaagtggcacgt gcctgactatggtcgaaaaggtgtattcaaagAAAGTTATGTTAGAATTT CTTGACCTTGATAGAACTAagctttttacaaaaaacaataatCATTGAAA TTCTACCTATGCATAGAACCCGTCGGGAAGGGAGACAAACAAAATGAACT TTCGGAAGAAAGGTAAAAAGAAATAGCTCTCTAGGTCACTATACTGTTtg aaaagttattgagaattttaTTCAAAGATTTCGAATTATAAATCGATACT ATTGCAAATAAGACGATTGAGGACATGGAGAAGCGATAAGAGAAATAATT TATAGANGATTGGGTCAAGTTTAGGGGGATACtcaaaataataaagtggc acgtgcctgactatggtcgaaaaggtgtattcaaagAAAGTTATGTTAGG ACTTCTTGACCTTGCTAGAACTAAGCTTTTGACAAATAATAAGAATCATT GAAATTCTAATTATGCATAGAACCCGTCGGGAAGGGAGACAAACAAAATG AACTTTCGGAAGAAAGGTAAAAAGAAATAGATCTCTATGTCACTATACTG TTTActgtttgaaaaaatattgagaATTTTATTCAAAGATTTCGAATCAT AAATCGATACTATTGCAAATAAGACTATTGAGGACACGGAGAAGCGATAA GAGAAATAATTTATAGAGATGCTCAGGGAAAGAATACTACTAATCTATGA TGAACTTTCCAGCTTGGATCATGATGTTCATTGCAACACAACGTTGCCTT GAACAACATTAAAGATTTAGATTGTGAGACCTTTggtaaaatttggtaaa aatattttccattttcCCTAATCCAAATAAGTTTGAgtttatcgacccag tgatattcatattggaagtttatcgtggcttggatcacgagatttacgtt tggctacgtttcgagagattcttctcccatttTCCTGTTTGCATCAAAGG AAGGGGTGTTAATTGTAATATCCTTACAGTagcttaaatttttttaaatt cttcaacGTCACACATAACGATTTAGTAAAGATATATGTTGAAGAACATG ATCTCGTGAccgataattaaaaaaacttccCTGTTGACTGGGTAATAAAA CAGGTTCGATTTACAGAGCAATGAAGGTCCGAGTTATAGAGGTGCGAGTT ATAGAGGTGTGATTATATAGGTGCGAGTAATAGAGGCCTGAGTTATAGCA GTTCGAGTTGTGAAGGTTTGATTTAAGTCATTTAAATAAAAGAGTTTCGA GTTTTGAGTTATAAAGATATAGAAATCGAGTTATAGAAATTAAAGTAATA GCATCCCGAGTAATTCAGAGTTGAGAAAAAGAGGTTCGAGTTGTGAAAGA TCGAATTATTGAGATTCGATTTATGAAGACTCTATTGTatacaaacaaca aacaaacaaaattttaacGGAAACACAGATCGGACACGATCATAATTACa aggaaaataagaaacatcaTCCACAACAAAAAATCCTTTTCGCATAAGTA ACGGTCAATTTTACATAATCCCTTCATGATCCTTTTAAATGACAGTGCTA ATATCATAAAATAAGGCTTCATATCCGCGGCGTGGGATTATACCGTATAA TAATTCTACTATAcgttttgtttataagaacatccataatttttcaattt aaatttttgagttttaagcctaaaaatgttctttaacatcttcttatttt caccattttgtgagtatttttgtcattttcctaaaaaaatagAGGTTTTA GGGTCTGCAAAGCCATAAAATgtcttatgctcttatatagtttgttttta taaaaaaaaacatgtaagcgGTGTCGGCTTACTGAACCAGTTTTAATTGG TATACTCATTTGCGCTTCCAAGTGTTCCCATTAAGTCAGTATTAAATGAT AGGATTAAGATACTTGTACAATTAATAAGTGTTAAAAGACAGCGGGTGAT CGAAATTTTTGAAGGAGTTATGTGCCCGCCTTTATGAGATAAGTTTAATC AAAATGGCAACATTCTTTATTCATGATGCAGGATTTAAACCGGTACGGGC ATATTTAATAAGTTATAATAAGTTATTTTTATTGCATGACTTAAATCTTA AGTTTAAGAAGATGCACCTTTTTGGAGTTTGTTTTCTGCTttattttgtg aatgtttcGGCTGGTAAAGGATTGGTTAGATGCTTCAAagtctgtaaagc cttaaaTTGTCCTTGAATTGTCCATAATATTTTGGCCTAAGAAGACCGAA GAAGAACGATGTTCTTtaatagtttgttctcatataAACATATATTGAAT ATAACTTTCCAAAGGAAACTTTTGGATAGGTGCTCACCGAATATTTATGT ATGATGCCGCGACTTATAAATTCCATGCAatacaatctttgaaaaatgtc cTTCAAGGGTTTCTTAAAAGCAAGTTACTCGGTAAAAGTTAGGTAATGAC AAGATcctttaaaaatctaaaatggtaGCTAAATTATGGGACAGAGACGT GGTTGGAACCCcgaggtggggggggggggcttatgCAAAATTGAGGTCAG GTATGTGTAAgcccataagggtccctttttcgcACCGTCGAAAGTCCCTC AAAAGGGtacaaaacaatcaaaagaaaattttggctaaaattttggggaa attgtCTCTCTGAGGGTCGGTTTTTGAACTTTGACTAGGACGAACGCGTC ATCTCGCAAATCCCAGGTTGGAGCCTTTCAGAAGATACGGATAAAATGAA GGAGCAAATTGCCAGGGGAAGTAAAACATCCTGTTTTTGGTGAGTAGGGG TTTTGAGCATTACAATATTTGCAATGGTGATGAACCAACAGGGTATATTT TTCTCATCGAACGATCTTCTGACACAACACAACACAAAACACAAAGAGGA AAGAATAGATCAAAAACGCATTTAAATGAAAAGAGTTATTTCAATCGATT CCAACAAAATTATGAATCTCAATTATCCTAAATGACATCCTATGCTTGGT TTACAAATTAAACCGGTTAAAAATTACAGGAATAGGAAGATGTGTCATTT ATCTCATTTATTCCAATAcaagttttcgtttttttgtaTTTAGATTGACC ATTTCTTGTTGTCCTCTATTGTCGCTTTTAAATTGCTACAACCAACGCAC AAGGATATGTTATGTGCTCTATCTagaactacaatcatggttgtaatatt tgagaaaaaagggaaatccaccgggaagttttgaaaccacaatcagtttg taagtgctctaaagtaggttggaagggtagaagtttagctctgagtttta acgtgagacttaagacttaggaggaGCTTAGTATCTGAGGATCCGAATGT TCAAAAAGGGTCCAATAAGGCATAATACAGCCTGGAggtctataaacccg agccaaattgaaatatccgattaaatttgagagatagcccaaaatcgact ttctcgcccgaactccaaatttcgaaaaactgaggaaataagcttaattc tcaatagtTTTCGACCATGATAGTAGTCATgtcttttgtttacaaaatga gTATTTAAAGCTCTGAAAGAAACACGGTGACATGGTAATCAATTTATCAA CACTGGTGAATTAAGATAGCTATGCATGTTTAAAAAAACCtcttttcaat tgaaaaattcCGTAAAACAGCATTCCCATTGAATTTGGAAGAATGAGGCC GGAATAACAATCCGATTTTTAGTGACTGTAGCATGAAGGTatagcatcca gctacggtgcgcaaggtcgtGGGCTCAATCCTTAGCCGGATCATACCAAA GactccaaaatggtacttgatgcctctctgcttgatgatCAGCAATTAAA GAGACGGATCGAGGGTAAGtgaagaaatccagggaaaggagtggcgccct cccctaatttgggtagacagctagagaaaagggagccttcggatCACCCT CGACTGTGGTCGCAAACTTACAAACAATCCAAAACATTGCATTTGAAggt gaaaacaatagaataagAGATTCCGTTTGAATTTCGACAAAGATTTTCTT CCTCGTTGAGCAAGAAAAGTTTGATTGAGgcaagaatttattatagacac tggataaccaacgagctatattttcattgatttctcatgttctagccttg tccgcagtaatgacattattgttcactNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNgacattattgttcactctccttccttcattaaacgattttt cgtaacattttaatcatttttttcatcttaacacagtcatttcaattccc aaataAAAACTAAGTTTTCCTTAGAGAGGCGaacgcatcaaaataattgc taATTACGTGTCGTTATACCGTTTCAGTTGCAAGAAAGATACGAAAAACA TGCTatgaatgaaaaattgaatgtcgacaccagaaatttttcaaaattta acctcaataaaaccaccgatccaccacaagcctccaaaatattttcatac cacGGTTAACCGGTTAAGCCAAGACACCCAAAAGTCTGATATAATATGAA GAAAAATGTTAGAAAGATATCGCCAGCTTAAAATTCTGTGTCATTTTAGG ctctttgtttgatttttcttgtctgatgatgtttttgacACAACAGATTT AATACATGTATCCGTtaagtattttagcatttatttccaaatttttggcg agtaaatgtacaaaaagataTAGATagaggactttttagaaatgagataa ttaatcctttttcaaaatcagagaacttcgagccgccatgacagttgtcc tttgcggacaaagctagatcctcgattgtttttttaaacaaaagaaagac aatggttcgctctccaccgttttatacgttgtttatccagtgtctataat aaattcatgATCGAGGCACTATAATAAATGAAGGTTCCCTTATAGAACAT TATAAAGCTTCCTTGTTTTAAAGCATCTTCCATATATCTAATACAACAAG CATGGGCAAATTAGTTTCTAAGTAATTATATGGCCATTTTCCACTTAATT CTAAAAAGTATGATACAAGATGTCACATTGCAGATGGAGTAATCAGAGCG TAGATGCCATTTATAGTACACCTAgctattttcagttttttttaagtgtt cataatttttttatatggaAATAATCAAGCTATAACAAGAGGGTGGTTTT GCAACTAATTATGAGGGAATGTAAATTATAGAAAATACTTGAGCATGTTG GAAAAATCACTTTTGATACAATCTTGTTTTAGTTGTTATGTTTTGTCggt ttatttgatttgtttttttggatTGCCATTTTAGAAAATAGGGTCAAGTG TTACTAATTTCTGAAATTCTGAAAGATGAAAGTTGACCGCTATTTGGTTT TTGTGAAATCCAGTTTTCGTGTCAAGAGCTTTGTTACTGATTTGAAAGTG TCTTTAACCAAGTAAAGAATATTAAATTGTCGTTATGTTATGTTTTACTA GATACCATTAAAGCAAAGGTAAATCATTCGGCAACGGTGCCCAATGTTGT TGGTTCAATCCTTGGTCAGGGGTCATACCAAATATTTTGCACTTAGTACA TAAccggtacttgatgcctctctgcttgatgttcaGCAATTAAAAGatgg atcaagggtaagtggagcaattcaggaaaattttgggtactgtaaatagc tatcgaaagaggagcaaTCGCAGACTaactttatttgtttatttgctACG CTTTAAATGATCGTCTTAACAATTCAAGATGACTGGAATTCGATGCATAT TGTTTACAATATTGTTATGGATATTACAGATATAGGCAGGTTGAGCAAAA GGTAAGCGTTTTTTTAACGCTTGCAGTTAAATGAGGATTACAATTTCTTC AACCAAATTCGATGAAATCGAAAGTAGTGATTTTGTGGGCAGTATTTAAA AGCATGTGGTAATACAATACCATGCCGGAGACTGACCGCTTTACTTTCTA AATCGTCTTTATCGAAGTTTTTAAATACAGTCAACTCTAGGCTGAATCAC AGaccttttcgctagaggatgagcagaagcctaagcCAACTCTCTCTAAA TTTGAAAACcgacgagtctgctaaattacgtgggtcgCGTGGGTGTCGTG GGTCCGTGGGTTACGTGGgtccgtgggttcgtgggtcgcgtgggttcgtg ggttagAAAAGcgcgtgggttcgtgggtccgaaATGTACGTGGgtccgtg ggttcgtgggtcagaATTTTTTCtacgtgggttcgtgggtatttttttac gtgggttcgcgggtgcaatttttttttacgtgggtccaattttttttacg tgggtctaatttttttttacgtggatcaaattttttttacgtgggtcaaa atgttttctagaaacataagaagaacaatttttttgcaaGCTCTGTGTGA AGTAAAAAGAATTAGAAATATGCAGGCAGGACTTTTGTAAAGAATGTACA TactgaaacaatcttttttataatgaaaCAAGTGAGATTTAAAACTGATt agctttttcttttaaaaatgaaaacaaaagaaatatatgAGTACGCTATT CATATTAATAAAAGATTTATACGTTTTCTAATCTCTTTATCACCAGATAT TAGGTATATATTGGTATATCGAATATCTATCTATATAATAAGTTTATAAA GAAGTTGCAACATCGACACCGAAACAACGGGTTAACAGTGGNTGCAACAT CGACACCGAAACAACGGCGGTTAACAGTGGCAGTTCCAGTCATAAAAGCG CCCACCGCCTGCGCCCATTGGCTTCTCCTGGCAGTAAACTGACTTATAAA AAGCGAATCGAAGTGAGATGTAATATTCCGAAGcgataaagaaaaacaaa tgtgCTCTGTAACGTAGTTGATCAGCGGAGTAAAAAAATACTGTTATGAC AAAAAGTGAAACTCAAAAAGCAAAAGATAAATTAGTAAAAATTAGAACGG CAATGTCGCGAAAGAAGATGGCTTTCGCCATACACGTTTTTCgctaagaa caaagtatataagaacattaggcaTCGagttcaaaaataattaaaaacag gttaagaacatttggaGGCTTTGGAGAATCAAGAGTaaagaaataagaac atttttcatttttgattatgtACACATGAATTAAAAGACtttaattaaga acattttaaggcttgaaaccaTTAGAAGGCTTCTTCGAATTCTGATTTCC TATAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNACTTTTctaacccacgaacccacgtgacccacgaac ccacggacCCACGTAACCCACGGACCCACGACACCCACGcgacccacgta atttagcagactcaaaaCCGACTGTTCAAATCTTTCTACTAGTGATTTGA ACTAACTAGAATATGGGTCCTTTCAGCTGGAATTGCGTGTAAAACCCCCT CTTccattttgaatctttttctaaTTATAAGAAAAGCTTATGGTCCCTAG AAGAGTGATTTAAAGAGAGTCAACATATGAAGTCCTAGTCAGACAATAAC AACATATTCTGCAGTGATCCAGCTACAAAGTATTATAGCTTAGCAACGAG GAAAAATTAAGCAATAAACGATGACGTAATTTAATAAGCATTTGGTAAGA CTCCAAATAAACACGTTTAAAAGTCGTTTTCAAAATGACTTTTGTATTGT TTCATTGCAGACAGAGACATATAGTAAATTCGGTGCAATTTAAATGGAAA AGAAAGGCAATTACCAATTTCAGCCAATAAAGCAATAAAGCAAAAAAGGA AAGATGCGAGTTGATTTTGCCaagaaagtttcattttttgatgtgaTACA TGTTTATGTGATTATTGAAAGGTTCAGTCGATTGTAGAGTATGTGTGTGG TGATTTGTGTTAAGTTGAtcgaatttttgtttgttttggtagattttttt tatgtgaaggatattttttttttcattacctCTGGTCGTCTAGTTTGAGC CTTCCTATATTCAATTGCGAATATCAAGACCTTGTAAGATACAACGTTTT TTCTCATATTAGttcattaccgagtttatgtatgtgtgtttttctgcgac ggagacggtaaggttctaatttagCTAGATCCTAACCAGCcaaggacgac ggtaaatcagcacttttaccgtcctcgatttgcgggtcagaactgcaggT TTTTCCAAagcgcttcagtcactctaccgtcctcaaaagtgcaaatacat aaactcgctattattaGTTTCATGGTAGATCTGTATATTATTCTAGACTG CGCTGCCAGATTCTAAGAGAATTACAGTTCATCTGGGGCTCATTCAGGAT CACTCTTTTAGCGAATTTCGGCGAAATGTTGGGTACGCTAAGTTCATTTT CGAGCATTGAAATAACGAAATAACAAACTGTTTTATAGTATTTTCCTTTT ACTAATctttaatttccttcaaaagattttattctaataaatcaaacttt cgattttgaagaaaatcGTCATTACAAAAAAGTACAATTAATCACAAGTT CACACTCGAGAGCAATTGTTAATCTAAATGCAAACATTGGCAGATAGTTG TTAAAAGGTACTGATTAAGAGTGAGCTATGAATTCCTTTTTGAGGGATTG GAATTAAGGatttttttcctcctttttaaCGACTTGGGCAAACAATCGAT GTTATCTTAGTTCGTCCGTATAAGGAGTAGTGTGTTATATATGAAgattc tttttgataattttatagATGTTGGGTTCTATTTCAGAGTTTTTCTTCTG GAATGATTTGTCAAACCCCCTGAATGGTATCTCGAGAGAAATGCTTACGC GATCtgcaaaatttttcttttagatttCATTAATTTCAAACTACGAAAAA CATTTATAGGTATCTATACCAAGAGAAGTCAAATATCGTTGGATCTGTTG AAAATTTACAATATTCTCTAGCTCTTTATTTATCCTAGAATTCGGTCAGA TCACAAAAGATCACAATAGAGACGCGTTTACTTTGCTGGTTAAATGtgaa tattgattgattgattgattgattgttgattaaTTATTGATTAATAGATG ATTAATGATATGGTCAACTATTCAttgtttgattgattgattattgattg attgattatcAATAAGTTCATTACGATTGTTATAATATCACCTTGTCGTA AACGCTTATTAGGGAAAAATCTTGATATAAATCAACACTTTCCTTTCTTA GGAATAATTCGTAGAAGATTTCAATTTTGCATTTTCGTGTGTTAACACAG GAAATATATTTGATGATGTGCTATGGTAATaagttaatgaaaaatgaaaa ttaatgacATTTGTAAAGCTTATAATTAGTAGAGTCTTAACTAGTCACTA ATTCAGAAATGACCTGCAATAATGGTATTTCCCACACTTTCAAGAATGTG TACTTATCAGAGTCGTCGGTTTTCTCACCCGGgagggcagtcaggcaaat tgaccgacgggtatgtgcggtggttaagggtatgtttttcaaaatatcag aaatgcactgtatgggtggacttttgataaatgcactgtaagggtggaaa tttcggcaaatctgggaaaaattgcaaatttttgctcgaaaattttgatt ttttttgctctaagagagttttaaaatttgaaaaaatgcactgtaagggt atgaatttcaccgatttttttctacactgtaagggtgcgattctaaaagc catttttttcgccgcacatgccgtcagttggtaaacccactgccccccca gGTTTTCTCATTTTGAATCTTCtctataatttatttttttccaatggCTC TGGTGAAAGGGAAATTAGTTTTTTGAGAATCTTATATACTTGGAATTGTG ATTTTGCTAATTTGTCAAACACAAAAAAGTTTGTGTTTGGCATCGTTGGC AAGCTCTTTTCAAGATAAATGTCTCAAAAAATTCATgctggaaatatttt ttctttgtaaccATTTGAAGTAATTGCACTAAGAATCGAAATACTTGGCT TATCATTGCAAGTTTTCTGGACCAGACTACACAAAAAGAGATTGGTTTGA TTGTCGCGTGAGAGTTTATGAGGAACTTGCAATGAAAGTGTGGGCGTGGT TTTTGCAACTTCCTACCAACATTGCTTCAATATTGGCATTATACTTTGTG AAACGGTATTTTACGCATAATTTTATAGTTTCTAAATGTCTTGCAATAGG CTGATGCCGAAATGAAGATACGGACAAGTTCCGTCAGTGATTACTTTAAA ATAACAAGCTGATCTCTTTCCCAATTTTGTGGCTTTTTTGATTTCTAATT AGTAAACTTTACATTGTCTAGCAATAGGAACCtttgctttaaagattttt taccaTTCGACCTTGCCTATTTCAAATGGGACCAGGTTCTGTGAGCGCCA GCTggacgagacaggggtgtctcatTTTGCTTTTCGAAGTCTTCTCCTTt ctattaccgagtttatgtatcggaggatatcgagggcaaTGGTAAGTGAA Atcaatacaaaacaaagtcgatagttgatgacggtatcttggtgttttta ccgtcgtcgagcaaagtatACGGCGATTTCTGCCCCATGTCAGCTTTGCT TtttaccgtccccctcgatttatttcgaatacataaactcgctactgaTT GAAAGAGGACAGCGGTTATCGTTACTTTCTCGAttccttttcaaaaaaca tattgAAATCAAAGATTCATATATCAGTAACCAGAATCTAAATCACATTT CTCGTAATACCTTGCACTCTTACACGTATAGCAATAATCTGACTAAAAGA AATTCCAGCAATACTTTATAGATTTAGATACACATGAGAACAAGagaaat attttcactttttaaatcGTTCGATTGAAGAAGTTTTGGAATTCCTGCCT GTCCCTTATCTTCTGTTATTACTAACAGGATATTGATACAGATGACACTG AAACGTGAGGATATAGAGCAGGATTGGTAAAAAGGTAATCTGGATGGTCG AAGAATTTGTTTGGAATGTTATGATAAGTTTTGTCGTACTATATAGACAA GACAGAGTCGTGAGGAAGTTGAGTAGATTGAAAATAAAGTTATTTAGTCT GTTTTAGAGAGGTTATATCATATTGTAAGTGTATAATTTCGTTAGCAACT TGCGCTAGCAAATGCGAGAATCAGCTGATGCATTTTGATATACGCAGCTA GTCCGGCTCAACATCATCAAAACACGGCAATGAGtagaaaatttaagaaa gtAATTTTGATGTAACTTAGATGTGGATACATCACATTATTTTATATTGT TATGGAATTACTGTACTTTCATGGGCTGGAAATGAtgctatatttttcaa atataaccAACCAGATACTtgataacacccctgtctcactgcccCTGGTG GAAAtcttttcctcagtggggataaaaattcctattgaaatctcaatggg gatagaaattctattgctccaaggtggggatggttttggagtgcaatttg gaATTActgaaaaacctaccctcaAGGGCCGCAcatccggtaggtcactt acctggagtgcccccccccctccgggggaatttcgagtggggatgaaatc aaaatcaatttcccagtggggctgaaattcaagggtatttcccaccgggg acgaaatttttgccaaattttccagtggggctggggttccagtgggtctg tgacacagaggtGTATTGTTTTGGAATTACTGTATTTGATGGGCTGGAAA TGATGCTATATTTCCCAACCAACCAGATACTTACTATCACTTAGTGTAAA ATATTGTGATTTACAGAAACAGATGACCTAATAGGTCTATGGCAACGGAA AGGGAAATAGTTTGTACATACAAGAAAGAGACGTGCTCACAAAAATAATT CGTCTCCACTAAAACAAACAAATAGGTGGTTAAGAACCCGTCCTTTATTA ACCACAAATCAACAAATACATTGTCATTCAAAAACAatccacgaagcctt aaaatattttatcctGATCCATCAATCAATTTTTATAACTCATTGAAGTT TTAAAACTGGTTTACTGTTTATTTTATTGGTTGTTATTACTGTTAAAGTG TGAGCGTTGGACTGTTTCAGAATGCCATTGCGCTGAGAATACCTGCAGGA GAAATCTACGGCTTTTCTAGGAATTAAACAATTTTAAGCGTGTATGTTGG ACATACTATAGAGTAAAAGATACTTAACTTGATAGAAGAGTTGAAAGCTT TAATACTAATGTTCTGAAACTCATAAACCTTGTCAAATTGTTGGGTCAAA TAGTCAACCGACTGCTTTACCGAGAAAAGTTTTGTTGGGTAAATTCTTTT CACTTGTGCAGATGAAtaggatattgatttttaaaaattattcttttttt tacgCATGTCTCGACCGCGGTCAGGATGATAATATTAATGATGAAACAAA TGTAACATTTGAAATAATTACCGTACAGTTACGCAAAAGACACACATCTC CTCATGTTAAGATCAAGGGGAATCTTTTAGGTGAAAGGGGAAATAGTTTT GTGTAATTAAGGTCGCGGGTCCCGAtatattgagtttaataatataCAAA ACAAGATATGTCGGTATTTTGGCTTTGAGAAGATTTGCGGGACTTTCAAT CCGCATTATAATTATaattgaataagtttttctaTGTGTGAATATCTTCA ATATCCATGTTGGTTATTACATATATAAACATCATAAAGTAATTTGTTTT AGTTTGAAATTAACTCATTTACAACTATAATCAAATTAGTTAACTGGTTT TGATTCGATTTTGATATATCTGGTTAATAGttatttttaattgatttttt tgttgtttatcatacgtttgtttattttggtgtTTGTTTACATGAGAGAA TCTTTTAAATGATTGACTTGAAAGTCAGTGGATTTCAGTTTACgtttatt gattttgtttttcgatTGGAACTGAagaatttgtcaaatttttgtaactt ttaaaATAAACTGTTGAGAAATTTAGAACATCTTAAGGAGTTGAATACAC TCCTGTCTCACTGACCCGGTGAACCAACATATATCCTTAGTTGGAAGGTT TTCAgtggaaaaatttgccaaagAAGGGCGACAAGAAAAGTtatcttaaa atcaaattattaactttcttttttagattttgtttAACTTAAAACAATTT ATTCCTCCAGCGAGACAGAGGTGTAACATTGACCCAACTCCAATcaattt gaagttttctttattCAGTTCTGCAGTCAGTACTTACTGAAACCATTGAA ATTCGACCAACCATAGAAATTTGAttcaatcaaacaaaaattgattgata acACTTACAAGTGGTATTTTACAAGGAGTGAGAAAATAAGTActtaaatt ttgacttttactTTCACTAAACAAACAATTTATTGTATACTCCTACACTT GTAAAAAATGTTACAATTTTCCCAACAAAATATTACAAGTACGAATGAAA GAGCTGATTCGTGATGTCTTGACAAAGAGCTGTATACCGCAACATTGCAT AGAGCTTCTGTTTTAGACCTGCGACATGTTATTTCTGGACAGTGCCAACA TATCAATGTATTACTTATCAGCTAGCTTGGAGTAATCTCTGTTGTAATTT TGTTATTCTGTAAAGTTAAAATGCAGTAGGTCAAGTATTGATACTTTAGG TCTTTCAAATGATTACATGACACAATCAAAATGGTGTTTGATGGATAAAG ATGGGTTCGATTTGTCAATCTCTCATTTTTAATGATAAGTTAAGGAATGG TAATTTTGACAACTTCATGACAGATTAGCCTTCAACACCTTCAAGCCACT TTTACCGCTTTTGACCAGAGAAAAGAGGAGTTAAGATAACTGAAATGGTA CCTTATAAGAACAACCATTATTTGATCAAGATAAGGAGGTTAGGAAAGTT TAAGGTTTGAAAACATGTCTAGACATCGTTTATATTGATCCATCAATGGA ATAAAACGCTTGGCGGACTTTCGTGGACTTCCTACAAACCCTACCTCATC GAATAAAAATGTAAGTAGCTTTCATAAGCAGGCTCAAAGTGCTTAAAAAA GTGAATACATAGAAAAGATCTAAGATCTTGACGTGATGGCCATCAATCAT TTGAACGCGTTAAAATTGCTACACACAGctcatcaaattttcaaactcgT CAAAATTTGAACGATTGTTTTCGTTAAGAGAGCGCTACAAAAAGAGAAAT AATATACAGTAAATGTAACGTATCATCATGTATAATTTCTTGAGAAACTT TAATGCTCTTACGTTCAAAAgccttcaaaaatcaattactATGTTTTGAC TTTCTTTTGCTTGAAAGATACACAAACACACGCTAGTGAAAGCTTTAATA CTGATTGAATTTGAAAGGAGTTTTGACTGGGAATCAAATATGCAATATAT GGCTTGTTTTATGGTGATATATTAAATTCATTGTCAGTTGAGTGTTGTTA ATGCTGCAGGGCTTTGAcgttgaaattttggaaaaggtCCAGATATTGAG GCATTTGGACCATTGATGATTTGAGGCGTTGCGATTGCAATATCTCTTGC TGCAgcaatcaaatgaaaaaaatatggtGTGATTGGTAGGGGATGTGGTA CCTACTCCACTTGACACATTTTTATGCTCTTTTGGTGCAATAAGGATATA CATTTATTTAAATGTCCGCGTGGTCTAGTTAAAGAATATTGAGCTGTATT CAATCATTAGTAGTCGTGACATACAGTAACATTTCTTCGCAATCCTTAAT GAAACGTGGTATTATATAAATGATCGCAAATTAAGTATAAAAATTTACTA ATTCGCTAAAAAAAGGAACACAATGAAAGGTGGATATAAAGAAACAAAGG TAGGAGGAAAGGAAACAATaggacataacttttgaaacagCATTTTAATA GCATTTCCACTGTTCTCTATTAACAGAGGAACGTCTTTATGATCAATTAA AAGTCATTAACAACCATTTTAGACAATAGCTCTTAATACTAGAAGAATAG TTATTGGCTAACTAATATAAAAGGAAGTTTCATTCTAAATTTTGTGACAT TTGCTACTGCGGCTCACTGAATTTGGTTCATACCCACCACATCTTTTATC TTACTggtgaaatattcgaatatagTAGATTCTGAGTTTTCACTAATaca ttgtttattttttcagtACCATAgttaaagaagaaaacaaaaagaaataa acaaagCAACAACACAGATTTGTTCAAAGAGATTTTGAATAGTTTTGGTG ATTTTGCCGGATTCGTTGGTTTATTTGTATTCATTGACATCATTGTTGGT GAATTTGCAATTCTTgacgtctttttttatttttcaatggaTCTGTTGTA GTGATATATGCATACAAACATAAACAAACCGTACCGTTTTGCAAACTTTG GAAAAATGATGATTATTCTACGCTGGCAATGGGTTTTACTTATCTTATTA CTAACAATTGTACAAAAAGCATGGACTGGGAAACGTACTAAAGCTCTATT TTCATTGCGAGAGTCCAAAACCTCCGATGGAAAACAAACTGACGTTCTAT TAAATAAAGACAAGGAGCTAGACTCACTTCTACAACAAACGAAAGAGAAT TTGATTAAAGCTTTCGGGCTACGTGAAAATATGATCTCCAATGGTGACAA AATACAGAAGCGTGAACCTCATAAATATATGAAATATATTGCTCAGAAAT ACAAAGACAATTATAAAAACGGTATCCCGTTGACGGCAAATACAGTCCGT GGATGCGTCGATATAGGTAAGTCAAGACAGTTTGAATTTCAGTTGTGGAT ACCAGGGCGTAACACTATTGATAAATGAAGTGTTTATTTCATATATCAGA TAACTAAagttgacgctctttaattcgacCTTCTaccattcgatacgctc cattattcgataatattgaaagtatCACCGCCAACAAGAAACTCCCATAA ACGACGTTCTGCTATTTGATACCCTCCCTcatttgatgaaaatgaaaatc gaattagagagcgtccacTGTATAGCCCTGGTCTTTACAATGACTTTCAG TGTGGCAACAATTCTTATTGAGAACTGAACGAATTATCTGGTATTATTAT CAGTAGGTGTTTACGCATGCTTTTCTTTCTATTTATCGTTCGTAGTACGC ACATTACAGAGGACTGTCATTTAGAAATTATAATGATTAGAATACTCTTC ACAATAATTATATGTACCACGCCTCTAGGTTTGTTTACATTACCGTGCGT AGGAGGTGATGCCAAATACAGCCCGTAAAGTGTTCATAGTTGTTTTAAAG TAAGAAGCAGAAAATTAGAGTATGATTTAATTCCTTTTACTAAGTAATCG TCCCCCGAGAGCATCGAGCTTCATAGCACATAACTTGAATGTCTTCCAAC TCTCTTTGAATATTATGTAGGTGAGATTAACGTCACTTTCAATTTTTGTC GACAATCAAAATGTACGTTACGCATGAACGCAATATCGTCACCATAATCG TTCTCAAAAACGTGCTAGTGGCGTATTATCCACTACGAAGCCATGGCAAA CTCATTGATAGTACACGAGTAAAAGAAGAAATGAAGATTCGAGAAATTAT CTAGTTTAgattcccagctgacacacaacgttgttttaacgttcatctaa cgttatatggacgttgtgaacgttagataaacgttgaaacaacgttgtgt gccagctagaTTAGAGTGTACTTCTTAAAGGAAGAACCAGAGTATTATAG AAAACGCTTTTGTTGTATGTGGGTGTTATAGGACGTGTATCCTGAAAACG ATTCAGCAACTTTTTCGAAATAGTGCAATTTTTTGTTAAGAAAGAAATTG GACGGAATATCCTTGGGAAATACACACCTGCAGGATCATCATTTTGATAA ATGCGACTGCTGTAATGAAATGCTCTCAAGATACATCACAATATTCTAAA TTTGGAGCGTCATCAATACCTGAGTCTATAGCAATACAGGTGCTTCAAAT AGGACTTTGCAGCAATctttcttaaatattttctgaTGTACACAAGAGAG TAGCCTATCGATTACTTTGAAGTGATTAGACATTAAGCGCGTCTGATTGT TTGTGTATATAAGGCTAGCCAGTATGTCTTCCACTCTATAACAACGACTT CCTGTTATGTTAAGTCCAATTGATGACCTCTTAAATATCATGTTTGGGTG GATTAGCAAAGGATTCTTCATTAACTGAGGAAATGATGCATAGCGAGAAT TAACTAAACATTCTAGATCCTGATCAAAGTTTACAGTTTCTTTTTAGTAA GTAATCAGAGTCATTATAATCTTTATCCTTTATGCTATTGAAATAGTTGG AATAGATTTATATATACGTCAATATTTGAGTTTTTAGTTACTGTAGTAGC AAAACTATATAAGAGATTTAACTGCATGATCTATCTGTCTTGACCTTATG TAATAGCAAACTATAAGGCGGTCTTTTCATTTCCTTATCTTTTATAATTG TAAAGGAACTTTTAATAGAAATCTACTTATGAGTACTAAAAATGAGATGA AGAATAGCCTATGTTTGTAGTGcgaaatttatcatttttagttACACTTG GTATATCtaaataaaatattcttttgtaatttccttTGAAAGACCTGgag aagtgaaaagtttttagtCAAAGTCAAGTTTTGTACAGCAATTAGCAAGT CTGTATAATTGACAAGTATTTTGACATCGGTTTAAGAGCACTCTGAGATC TCAAATTAAAGATATAATTATACTGTCGAAAGGTTTAGAAGTTCTCTTCC TTAACTTATGATATTAAGATGAGCTGAAAAGATTAAGGCCCATTACATCA ACTTAGAGTGTAAGGGTTATAAGCAAAATGGAGCTTTTCATGGTGACGTG TGGTTAGAGAATTTCAATGTGATGAGTAtgatagaaagaaaaagaaatct tttcgCTCTGAGAAATAACTGAAGCTTCACTTTGCTGTCAATTTGTTTTG CTAATTGATTCAATCCTTTAAAGTGTTTACGTAAAATATTGATTGTTGAC ATTAATAAATTTAGGGCTTTAGGGGTCTTCACGAAATCAATCTTTTTGTA CTTAAGTTTAAtctaatttaaagaaaaaccgACAAAATATTAATTTATCA AACGGTTATTAGGAAATTTCAAGGGAATGACATAACCTAAAAGTGACATT AAGATTCTCTAGCAAAGTAAATCATAATGAATGGAAATCAGTCAGTCAAT TCTTTAGATTTAAGGCTCTAATCTGTTCTAGTGCCCTTTCTTCTTAATTA CTCAAAAAGTATTATCTTAAAACAAAGAAgtgaacaaaaacaaaagtatt ATGTCAACTTCGTAATGCATCAAAAATCAAACGTCACTTGTTCTTTTCAT GTGAATTTTATGAAACCATTAATGGGTATTAAGCAAATTTTATTACTTGA TCTTTATTGAACCCATATTAGCgcattaagaaaatcattaatttCTTTCC TCCATTTAACCGCAACTTTTAACTTCATCAAATCAAATCACATCATCTTG AAAACAGAATGCCAGAATATCAGATTGTTTATTGTCATTGCAATTTCCAA TTTGGACAAATCGGTCAAGTAGAGGTACTATCAGTACTGTAAAAAGTCAC ATTAAAATTCTCTTCGAGGATCTATAAGTTTAAGATAGAATGACAGTACT GTAAAAAAGATTCGAACTAAAAATTGTCTTAAATTTGCTTTTTCAGTATG ACATTTAGAAATGTCTTTGCAATTTGAACAAATTGGTCAAGTAGAGggcc agtagcgtagacagagagcgcaaaatttgtgtaagagagcagatttttat gacacagtaatcatctattcataatataaaaagggTTACTGGAGGGTTAC TATCCGTACTATCAGTACTGTAAAAAGTCACATTTGAAACTCTCTAATCA ATATCAAATACTGAAACACCCTTCAACGTCCGTTTAAACAACCACAGAAG CAATGCACTTCATCCGAAAGAAGACACCATCCCAGCGTGCAAACACTTCA ACAAGGAAGNNNNNNNNNNNNNNNNTTTAGCTAGAAATATACCTTGAAAA CGGCCctggccgaaacatgttggaaatttctagcatctaatggtattttt gtctcgatcctccgtccgataTAAAATACTGATTATCTATTTTCCAAGGC ATGGCATGAGCCCTGCAAGAAGCTAGAATTCAAAGGACCTTGCTAAATTG GAAAAGTCTATAATTTCAACAAGCTATATACTAacaaaaaaaacgacaaa tacCAAAGCAATGACAAGGAAATATACTTGCTTTCAACAAGGGATTGCTT AACAACTACTCAACTTTCGTGGACCATTAAAAACCACAATGGACCTACTT AAAATGATTTATTTGACAATATTTGGAATAAAGTATCTGTTAAAGAATGC TCATCATTTCCCATTATTGGTCTTTATTACTATCATTAAGCGACTTTGAC CTTTCATATTGCCCTAGTCCATCATTTTCTGGAACGAAAACGAAATTCCA AGTATCTATCAATCGAAGTTTAAGAGATCGAAATCGAAATATTGTCAAAT TGCCAATGCttgattaatttttaaagctCTTTAAAATACAAATCGTATAT ggtattttgaaaatgttcccTTAAGTTCTATGAGGGCGTGAACAGAAAAA ATCATTACAGTAATGTATTAGCATTTCACGTGACATAAATATTGACAAAT TGTATTAAATTGCACGATAAGGCTTAATGCTCTTAGAAACACCTCAATCA GCTTGTTTTACCCAAAATTGATGAGCTGAAAAGGGGTTGGAATAATCATT TGTCAATCAAATTATGATTATGATGAATGGTGATGATGTCATCAAGCAAT ATTCATTCCTAGCTTAGTAATTAAAACACAAATCTGCAAGCTCAGTATTA CAACCATTTTAGCacaatttcagaaaatatattaaATGCACGTTTTATAA TTTAGATGATAATATTTCAGGTCCTATTATCTATATATTGGTGAtaatta tcttttgaaaaagaaattgcgATATCCTCTGCATATGTTATACAGGCAGT AGCAATTTCTGATCAAAATAATATAATGTTCCGGccttttaatgaaattt ttcttaCGTAGATTAGAATCATAAAATGCAATCATGTCATTCCTTGGAAA ATAGATAATCGCtatttgatatttgattaaTGGACTTTAATTGCTTTCAG ATAATTTCACTGTATTATTACAGGGTACTTTGGCCTGTCAAAATAGAAAC ATTTTTCGTGACTTTTCCTCTGAAACGATTTCTAAATGTCATACTGAAAA AGCAATTTTAAGACAATCTTTTGCAATCTTTGGTTTTAAAAATCGCTAAT CGTGCCTAATAACATGCTGAATAGTGTCTTATAATGTTATGATATTATGA CATATTATATGAATTTTGCGTTACCATTTGTGGTAACATATTAATAGGTc gttaaaaagaaaattcaggAATCGTAAAATGCATTTTTAAACTATAAATA TACTGGTTTGAGCAAATTTTTGATCCTAATtaacttgatgacgtcattcg gAAAAGTTAACGTCACGGGTAATGAGTTTTTTCTCAagtttttcttccat tttcttCCAAATTAGTTATTGTATACAAATACAATGCGGCTACATATTTG GgtaaagaaaaaaatcggtCAATTTTTGGTCACAACTTAATTACTTATCT ATCAAATTTGGTGCCACTGCAAATTTCTGTTTGCGTTGTTTAGTTTCAAA AGCACGAAAAGCAAAGAACAATGTCTGTTTACCGCTGTCATACAGTACAG TCAACGCCCTCTATTTCGACTTTATAATCTTCGATACACtatattattcg ataatattgaaagtcaccgtcgacaagaaactctcataaacgacattCTA CTATTTGATTTGATACGCTTCAtaacctttttgaccgtagccgccaatcg ctgtgcgggcatttttttgtccactttatcccactaaaaccgtcccagtc ctttttttttgcatctacagacaatagaaaaatgtgtcaaaaaaggattg gatcaagtttagggggataattaaataattaagtggcatgCACCAGACTG CGCGACTATACGGTCGAAAAGCTGTATTATATAATGAAAGTCCAATTTTT GAGAGAAAACCTTACGATCTAACATTTTCGTCAAAGGAAATAAAGGCATT TTCAAGATACAAGGAAAAGTGAAATTAAAAGGATAATCTAAGAATCCTGT TTACTTCGTgtctcaaaaagtcaaaaatttatttttttcgctaatttgaa tttcctttttattcttttcactGACTGATTAGGTAGAACCGCATGCAAAT TCGGAAAGTAAATGTGGGCTTAATAGATATGGAAGTGGTTAGAAgaaaac taaagtaaaaaaaCAGGATAATTTAGTCAGCATTTTTAACCCATAGAAGT ATTAGtgaaatattttcagaaaatagaaCTGTCGTAATTGATTAAGAGGA CGAATTCCAATTTAACGAGGCGTGGTACTTTTTTCGTTCAACTGAAATTA TATGTTCTTTTGTAGATTATAGGAAATTGTATTCTTACTCGTAATTTGTG TACTTTTTGTTTCATTGAAtaaactcacaatttttttttcattttctttt cagatcACGGCGATAAACGTCTTGCAGATTTCCCTCACGTGTCATTCAAA TTCGACGTGTCCGAGATTCCACAATCTGAAATACTCATCCAATCCGAATT AAAAGTATTGATGAAACCGGACTCATTCGGGATCCGATCAATCCGAAACG GTTTCTTTCGAGCCACGGTTCTTGGAGTCGTAGCACGTAACAAAGCCGAA AACAAAGCTAAAGGACGTCATGTCTATCCAAAGCTCTGGGAAATCACTTC GAAAACCATCGCAATGGTTAAAGGACAAACAGAACATTGGGTTACATTCG ACATCACAAAATTTGTGAACTACATCATAAACGTGCAACGTAAGCACGTG AAACTTGTCTTACGCGTAAAGCCACTAGGTGGCACATCAATCGATCCTAA ACTCATGGGGCTTAACAATCACATTAAACTTGAAACAGAGAAAGGACTAT TAGTAATTTACTCCGGCGAAGATGAAGCTCCGATTGTCAAGAAAAACAAA CGTAGTAAACGCCACGTCAGCAATACATACACGGAAAAAAGCAACAAGAA AAACCGtaaaaagaacaagaaaaataagaacaaaaataacaagaacAGAC GGAAAGGCAAACGCCGTAGAAAAGCTTGTCGACGTAAGGACATGGAAGTT GACTTTGATAAGTTTGGATGGTCAAACTTCTTAATTGAGCCGTCAAAACA GAACATTTATTACTGCCACGGACATTGTAGGTATCCATTACCTCACTACG TACCGGCAAGTAATCACGCTACGATACAGTCTATATGGCATGAGATGCAT TCTTCCGTTCCGCCACCGTGTTGCGTACCAGATGAATTTGATATGCTTCC GGTACTATCTTTAGACGGAAACGACCGAGTTgtcttcaaaatgaaagaag GACTCATTGTCAAAAGTTGCGCTTGTAGATAGAAAGTTCAGCGTAAAGTG AAAAGTGAGCCAAGCTTTAGGTGTAGAGCATAAATTAATTTATTGGGTGC GGAACAGAGACTGGAAAGTTGAACCAACTCGAATGTATAAAATGTCATAT CCTTTGCAaacaactttcaaatttttaccgCAGAGAATTCCCGTAGAATG GAAAATtgagcaattttttttcaaaagcttatcAGAAGGAAACTATTGCA ACAAAACCAAGTGGCACTTATAATTAATCATGCATTCGAATTGAATACCA AACGAAAACTTTTAAAGTTTGACAACAAAGAAGATACAATGCCAATACCA TTCCAGACAGATCGAGGAGACACACCATGATCCAATTTTTATCTTAAATT ATGGAGAGCTGGGTCTCACCTTTCTATTAtgccaaagaaagaaaaacaat tatacCCAAAACTTAAAAAGAGACATCTAGAAAAACAATACTAAGAGGGG GGACGTATGATATATTCCCCCTCATATTTTCAACCTTAACTTATAAatat gttataaatatgaaaaaactATATTTGAAGCCCTTATAAATAGTTATATT AAGAAAGAATCATTATATAATTTGTGATATAGCAGttttaaagtaaagaa aaacagaagaaataATCCAAGT

Coding sequence (CDS) from alignment at sc0000001:2214645..2251916+

>TCONS_00000118 ID=TCONS_00000118|Name=TCONS_00000118|organism=Clytia hemisphaerica|type=CDS|length=2676bp|location=Sequence derived from alignment at sc0000001:2214645..2251916+ (Clytia hemisphaerica)
ATGCATACAAACATAAACAAACCGTACCGTTTTGCAAACTTTGGAAAAAT
GATGATTATTCTACGCTGGCAATGGGTTTTACTTATCTTATTACTAACAA
TTGTACAAAAAGCATGGACTGGGAAACGTACTAAAGCTCTATTTTCATTG
CGAGAGTCCAAAACCTCCGATGGAAAACAAACTGACGTTCTATTAAATAA
AGACAAGGAGCTAGACTCACTTCTACAACAAACGAAAGAGAATTTGATTA
AAGCTTTCGGGCTACGTGAAAATATGATCTCCAATGGTGACAAAATACAG
AAGCGTGAACCTCATAAATATATGAAATATATTGCTCAGAAATACAAAGA
CAATTATAAAAACGGTATCCCGTTGACGGCAAATACAGTCCGTGGATGCG
TCGATATAGatcACGGCGATAAACGTCTTGCAGATTTCCCTCACGTGTCA
TTCAAATTCGACGTGTCCGAGATTCCACAATCTGAAATACTCATCCAATC
CGAATTAAAAGTATTGATGAAACCGGACTCATTCGGGATCCGATCAATCC
GAAACGGTTTCTTTCGAGCCACGGTTCTTGGAGTCGTAGCACGTAACAAA
GCCGAAAACAAAGCTAAAGGACGTCATGTCTATCCAAAGCTCTGGGAAAT
CACTTCGAAAACCATCGCAATGGTTAAAGGACAAACAGAACATTGGGTTA
CATTCGACATCACAAAATTTGTGAACTACATCATAAACGTGCAACGTAAG
CACGTGAAACTTGTCTTACGCGTAAAGCCACTAGGTGGCACATCAATCGA
TCCTAAACTCATGGGGCTTAACAATCACATTAAACTTGAAACAGAGAAAG
GACTATTAGTAATTTACTCCGGCGAAGATGAAGCTCCGATTGTCAAGAAA
AACAAACGTAGTAAACGCCACGTCAGCAATACATACACGGAAAAAAGCAA
CAAGAAAAACCGtaaaaagaacaagaaaaataagaacaaaaataacaaga
acAGACGGAAAGGCAAACGCCGTAGAAAAGCTTGTCGACGTAAGGACATG
GAAGTTGACTTTGATAAGTTTGGATGGTCAAACTTCTTAATTGAGCCGTC
AAAACAGAACATTTATTACTGCCACGGACATTGTAGGTATCCATTACCTC
ACTACGTACCGGCAAGTAATCACGCTACGATACAGTCTATATGGCATGAG
ATGCATTCTTCCGTTCCGCCACCGTGTTGCGTACCAGATGAATTTGATAT
GCTTCCGGTACTATCTTTAGACGGAAACGACCGAGTTgtcttcaaaatga
aagaagGACTCATTGTCAAAAGTTGCGCTTGTAGATAGATGCATACAAAC
ATAAACAAACCGTACCGTTTTGCAAACTTTGGAAAAATGATGATTATTCT
ACGCTGGCAATGGGTTTTACTTATCTTATTACTAACAATTGTACAAAAAG
CATGGACTGGGAAACGTACTAAAGCTCTATTTTCATTGCGAGAGTCCAAA
ACCTCCGATGGAAAACAAACTGACGTTCTATTAAATAAAGACAAGGAGCT
AGACTCACTTCTACAACAAACGAAAGAGAATTTGATTAAAGCTTTCGGGC
TACGTGAAAATATGATCTCCAATGGTGACAAAATACAGAAGCGTGAACCT
CATAAATATATGAAATATATTGCTCAGAAATACAAAGACAATTATAAAAA
CGGTATCCCGTTGACGGCAAATACAGTCCGTGGATGCGTCGATATAGatc
ACGGCGATAAACGTCTTGCAGATTTCCCTCACGTGTCATTCAAATTCGAC
GTGTCCGAGATTCCACAATCTGAAATACTCATCCAATCCGAATTAAAAGT
ATTGATGAAACCGGACTCATTCGGGATCCGATCAATCCGAAACGGTTTCT
TTCGAGCCACGGTTCTTGGAGTCGTAGCACGTAACAAAGCCGAAAACAAA
GCTAAAGGACGTCATGTCTATCCAAAGCTCTGGGAAATCACTTCGAAAAC
CATCGCAATGGTTAAAGGACAAACAGAACATTGGGTTACATTCGACATCA
CAAAATTTGTGAACTACATCATAAACGTGCAACGTAAGCACGTGAAACTT
GTCTTACGCGTAAAGCCACTAGGTGGCACATCAATCGATCCTAAACTCAT
GGGGCTTAACAATCACATTAAACTTGAAACAGAGAAAGGACTATTAGTAA
TTTACTCCGGCGAAGATGAAGCTCCGATTGTCAAGAAAAACAAACGTAGT
AAACGCCACGTCAGCAATACATACACGGAAAAAAGCAACAAGAAAAACCG
taaaaagaacaagaaaaataagaacaaaaataacaagaacAGACGGAAAG
GCAAACGCCGTAGAAAAGCTTGTCGACGTAAGGACATGGAAGTTGACTTT
GATAAGTTTGGATGGTCAAACTTCTTAATTGAGCCGTCAAAACAGAACAT
TTATTACTGCCACGGACATTGTAGGTATCCATTACCTCACTACGTACCGG
CAAGTAATCACGCTACGATACAGTCTATATGGCATGAGATGCATTCTTCC
GTTCCGCCACCGTGTTGCGTACCAGATGAATTTGATATGCTTCCGGTACT
ATCTTTAGACGGAAACGACCGAGTTgtcttcaaaatgaaagaagGACTCA
TTGTCAAAAGTTGCGCTTGTAGATAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000064XLOC_000064Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000118-exon-sc0000001-1491911889:2214645..2214869TCONS_00000118-exon-sc0000001-1491911889:2214645..2214869Clytia hemisphaericaexon
TCONS_00000118-exon-sc0000001-1510915933:2214645..2214869TCONS_00000118-exon-sc0000001-1510915933:2214645..2214869Clytia hemisphaericaexon
TCONS_00000118-exon-sc0000001-1491911889:2243819..2244410TCONS_00000118-exon-sc0000001-1491911889:2243819..2244410Clytia hemisphaericaexon
TCONS_00000118-exon-sc0000001-1510915933:2243819..2244410TCONS_00000118-exon-sc0000001-1510915933:2243819..2244410Clytia hemisphaericaexon
TCONS_00000118-exon-sc0000001-1491911889:2250348..2251916TCONS_00000118-exon-sc0000001-1491911889:2250348..2251916Clytia hemisphaericaexon
TCONS_00000118-exon-sc0000001-1510915933:2250348..2251916TCONS_00000118-exon-sc0000001-1510915933:2250348..2251916Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000118-proteinTCONS_00000118-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2214645..2251916 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.0158918 0 0 0.131861 0.0868322 1.04759 1.09843 1.49688 2.4665 1.50247 1.37839 9.70034 10.8055 18.0911 15.6508 13.4939 8.97811 4.26162 5.40214 12.4476 11.5743 3.04572 4.31488 7.06877 5.73093 2.25694 0.667748 0.036176 0.0552864
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001839TGF-b_C
IPR029034Cystine-knot_cytokine
IPR001111TGF-b_propeptide
Vocabulary: Molecular Function
TermDefinition
GO:0008083growth factor activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0008083 growth factor activity
Blast
BLAST of TCONS_00000118 vs. Swiss-Prot (Human)
Match: BMP7 (Bone morphogenetic protein 7 OS=Homo sapiens GN=BMP7 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 4.229e-27
Identity = 74/295 (25.08%), Postives = 137/295 (46.44%), Query Frame = 1
Query:  859 FKFDVSEIPQSEILIQSELKVLMKPDSFGIRSIRNGFFRATVLGVVARNKAENKAKGRHVYPKLWEITSKTIAMVKGQTEHWVTFDITKFVNYIINVQRKHVKLVLRVKPLGGTSIDPKLMGLNNHIKLETEKGLLVIYSGEDEAPIVKKNKRSKRHVSNTYTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMEVDFDKFGWSNFLIEPSKQNIYYCHGHCRYPLPHYVPASNHATIQSIWHEMH-SSVPPPCCVPDEFDMLPVLSLDGNDRVVFKMKEGLIVKSCAC 1740
            F+FD+S+IP+ E +  +E ++      +      N  FR +V  V+  +              L+ + S+T+       E W+ FDIT   N+ +   R ++ L L V+ L G SI+PKL GL      + ++  +V +    E           +  S   ++    +   +       ++ ++R+  ++       ++ V F   GW +++I P     YYC G C +PL  Y+ A+NHA +Q++ H ++  +VP PCC P + + + VL  D +  V+ K    ++V++C C
Sbjct:  156 FRFDLSKIPEGEAVTAAEFRIY---KDYIRERFDNETFRISVYQVLQEHLGRES--------DLFLLDSRTLW---ASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKH------ELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGC 430          
The following BLAST results are available for this feature:
BLAST of TCONS_00000118 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
BMP74.229e-2725.08Bone morphogenetic protein 7 OS=Homo sapiens GN=BM... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php