TCONS_00000118-protein (polypeptide) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000118-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length445

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000118-protein ID=TCONS_00000118-protein|Name=|organism=Clytia hemisphaerica|type=polypeptide|length=445bp
MHTNINKPYRFANFGKMMIILRWQWVLLILLLTIVQKAWTGKRTKALFSL
RESKTSDGKQTDVLLNKDKELDSLLQQTKENLIKAFGLRENMISNGDKIQ
KREPHKYMKYIAQKYKDNYKNGIPLTANTVRGCVDIDHGDKRLADFPHVS
FKFDVSEIPQSEILIQSELKVLMKPDSFGIRSIRNGFFRATVLGVVARNK
AENKAKGRHVYPKLWEITSKTIAMVKGQTEHWVTFDITKFVNYIINVQRK
HVKLVLRVKPLGGTSIDPKLMGLNNHIKLETEKGLLVIYSGEDEAPIVKK
NKRSKRHVSNTYTEKSNKKNRKKNKKNKNKNNKNRRKGKRRRKACRRKDM
EVDFDKFGWSNFLIEPSKQNIYYCHGHCRYPLPHYVPASNHATIQSIWHE
MHSSVPPPCCVPDEFDMLPVLSLDGNDRVVFKMKEGLIVKSCACR
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000064XLOC_000064Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000118TCONS_00000118Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR001839TGF-b_C
IPR029034Cystine-knot_cytokine
IPR001111TGF-b_propeptide
Vocabulary: Molecular Function
TermDefinition
GO:0008083growth factor activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0008083 growth factor activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 315..335
NoneNo IPR availablePRINTSPR00669INHIBINAcoord: 345..362
score: 29.17
coord: 423..444
score: 28.98
coord: 362..379
score: 34.72
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 298..345
IPR001839Transforming growth factor-beta, C-terminalSMARTSM00204TGFB_2coord: 345..445
e-value: 2.6E-37
score: 139.9
IPR001839Transforming growth factor-beta, C-terminalPFAMPF00019TGF_betacoord: 344..444
e-value: 4.7E-24
score: 85.2
IPR001839Transforming growth factor-beta, C-terminalPROSITEPS51362TGF_BETA_2coord: 321..445
score: 31.375
IPR029034Cystine-knot cytokineGENE3D2.10.90.10coord: 332..445
e-value: 6.4E-32
score: 110.1
IPR029034Cystine-knot cytokineSUPERFAMILY57501Cystine-knot cytokinescoord: 339..445
IPR001111TGF-beta, propeptidePFAMPF00688TGFb_propeptidecoord: 126..287
e-value: 1.8E-9
score: 37.6

Blast
BLAST of TCONS_00000118-protein vs. Swiss-Prot (Human)
Match: BMP7 (Bone morphogenetic protein 7 OS=Homo sapiens GN=BMP7 PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 3.908e-38
Identity = 91/324 (28.09%), Postives = 154/324 (47.53%), Query Frame = 0
Query:  127 ANTVRGCVDIDHGDKRL--ADFPHVSFKFDVSEIPQSEILIQSELKVLMKPDSFGIRSIRNGFFRATVLGVVARNKAENKAKGRHVYPKLWEITSKTIAMVKGQTEHWVTFDITKFVNYIINVQRKHVKLVLRVKPLGGTSIDPKLMGLNNHIKLETEKGLLVIYSGEDEAPIVKKNKRSKRHVSNTYTEKSNKKNRKKNKKNKNK---NNKNRRKGKRRRKACRRKDMEVDFDKFGWSNFLIEPSKQNIYYCHGHCRYPLPHYVPASNHATIQSIWHEMH-SSVPPPCCVPDEFDMLPVLSLDGNDRVVFKMKEGLIVKSCAC 444
            A+ V   V++   DK      + H  F+FD+S+IP+ E +  +E ++      +      N  FR +V  V+  +              L+ + S+T+       E W+ FDIT   N+ +   R ++ L L V+ L G SI+PKL GL      + ++  +V +    E      + RS R   +    K   +NR K  KN+      N        +R+AC++ ++ V F   GW +++I P     YYC G C +PL  Y+ A+NHA +Q++ H ++  +VP PCC P + + + VL  D +  V+ K    ++V++C C
Sbjct:  130 ADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIY---KDYIRERFDNETFRISVYQVLQEHLGRES--------DLFLLDSRTLW---ASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEV-----HFRSIRSTGS----KQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGC 430          
The following BLAST results are available for this feature:
BLAST of TCONS_00000118-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
BMP73.908e-3828.09Bone morphogenetic protein 7 OS=Homo sapiens GN=BM... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php