TCONS_00000109 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000109
Unique NameTCONS_00000109
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length814

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000109 ID=TCONS_00000109|Name=TCONS_00000109|organism=Clytia hemisphaerica|type=transcript|length=814bp
GTTTCAAATTGTCAAGCTAAGTGTAAACAACAAGGCAACAAACACTCACA
AAGATGAAGATTTGGAAAGCTTTGTTACTCGTCTCCTTCTTGGTGTACAA
AGTTCACTGTGAAACAGAACAAGAGGCGAAAACTATTTCCAAtgatgaag
aaacaacaaatgaCATTGAAAATGACGAAGTAACGATGGACCTTCTAGAC
CAAGATGAAGACCAAGAAGATGAACAAAGTGAAGATGAAGCAAGTGAACa
acttgaaaatgaagaagaaatgaaAGATGAACTGGAAGAGCAAGATCTTA
AAGAAGATGAAGACGCAAGCTACAAGCGATTTCTTTACACCAAGAAGGTC
TTCATCTTCAAAGACAAACACCCTGTTCAATGTCAAGTCACCAAAAGCAG
CAACAACCCAATCAGATGCTACCTCAAGTACGCATGCGTCAAACGTCATG
GTAACAAATGCATTAAAAAGAAAGTGTGGAAATTTTGCGTTTTCAGATTC
ACAAAGACATGTTTGTTCACATCCAAATTCGTCATCAAGAAATGTTTCAG
AATCAGACATGGTGGAGGCTACAAAGTCAAATGTTATAAAAGTGCACCAC
AATtggtcaaaattcgaaaatctGCAGGTGTCATCAATAAAGCCAAATTG
GTCAAAGTCTATTACACCAAACACTAGATATGGACTTCCGATCAAATCAA
ACCAAATGAACTGGACTGGACCTGCAAACGGACAACAATTTTTAACTTAC
TACTtaacaaatttttttacctttttgtaagcttacattttttaaattgc
tAAATATATTTGAC
Run BLAST on NCBI

protein sequence of TCONS_00000109-protein

>TCONS_00000109-protein ID=TCONS_00000109-protein|Name=TCONS_00000109-protein|organism=Clytia hemisphaerica|type=polypeptide|length=207bp
MKIWKALLLVSFLVYKVHCETEQEAKTISNDEETTNDIENDEVTMDLLDQ
DEDQEDEQSEDEASEQLENEEEMKDELEEQDLKEDEDASYKRFLYTKKVF
IFKDKHPVQCQVTKSSNNPIRCYLKYACVKRHGNKCIKKKVWKFCVFRFT
KTCLFTSKFVIKKCFRIRHGGGYKVKCYKSAPQLVKIRKSAGVINKAKLV
KVYYTKH
Run BLAST on NCBI

transcript from alignment at sc0000001:1981881..1982856+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000109 ID=TCONS_00000109|Name=TCONS_00000109|organism=Clytia hemisphaerica|type=transcript|length=976bp|location=Sequence derived from alignment at sc0000001:1981881..1982856+ (Clytia hemisphaerica)
GTTTCAAATTGTCAAGCTAAGTGTAAACAACAAGGCAACAAACACTCACA AAGATGAAGATTTGGAAAGCTTTGTTACTCGTCTCCTTCTTGGTGTACAA AGTTCACTGTGAAACAGAACAAGAGGCGAAAACTATTTCCAAtgatgaag aaacaacaaatgaCATTGAAAATGACGAAGTAACGATGGACCTTCTAGAC CAAGATGAAGACCAAGAAGATGAACAAAGTGAAGATGAAGCAAGTGAACa acttgaaaatgaagaagaaatgaaAGATGAACTGGAAGAGCAAGATCTTA AAGAAGGTGAGattttttcttctgatttttcaaAGAAGAGTCTGTCAAAA CTTTGAGGTTATTTTTCAGCCACACACAGTGTAAAACTTTTAACGTTAAC GGTTTGATacgtttcaagtttttttttgtaaattcaataaaatcttACCT TGCGTTTTATGTTCAAAGATGAAGACGCAAGCTACAAGCGATTTCTTTAC ACCAAGAAGGTCTTCATCTTCAAAGACAAACACCCTGTTCAATGTCAAGT CACCAAAAGCAGCAACAACCCAATCAGATGCTACCTCAAGTACGCATGCG TCAAACGTCATGGTAACAAATGCATTAAAAAGAAAGTGTGGAAATTTTGC GTTTTCAGATTCACAAAGACATGTTTGTTCACATCCAAATTCGTCATCAA GAAATGTTTCAGAATCAGACATGGTGGAGGCTACAAAGTCAAATGTTATA AAAGTGCACCACAATtggtcaaaattcgaaaatctGCAGGTGTCATCAAT AAAGCCAAATTGGTCAAAGTCTATTACACCAAACACTAGATATGGACTTC CGATCAAATCAAACCAAATGAACTGGACTGGACCTGCAAACGGACAACAA TTTTTAACTTACTACTtaacaaatttttttacctttttgtaagcttacat tttttaaattgctAAATATATTTGAC

Coding sequence (CDS) from alignment at sc0000001:1981881..1982856+

>TCONS_00000109 ID=TCONS_00000109|Name=TCONS_00000109|organism=Clytia hemisphaerica|type=CDS|length=1248bp|location=Sequence derived from alignment at sc0000001:1981881..1982856+ (Clytia hemisphaerica)
ATGAAGATTTGGAAAGCTTTGTTACTCGTCTCCTTCTTGGTGTACAAAGT
TCACTGTGAAACAGAACAAGAGGCGAAAACTATTTCCAAtgatgaagaaa
caacaaatgaCATTGAAAATGACGAAGTAACGATGGACCTTCTAGACCAA
GATGAAGACCAAGAAGATGAACAAAGTGAAGATGAAGCAAGTGAACaact
tgaaaatgaagaagaaatgaaAGATGAACTGGAAGAGCAAGATCTTAAAG
AAGATGAAGACGCAAGCTACAAGCGATTTCTTTACACCAAGAAGGTCTTC
ATCTTCAAAGACAAACACCCTGTTCAATGTCAAGTCACCAAAAGCAGCAA
CAACCCAATCAGATGCTACCTCAAGTACGCATGCGTCAAACGTCATGGTA
ACAAATGCATTAAAAAGAAAGTGTGGAAATTTTGCGTTTTCAGATTCACA
AAGACATGTTTGTTCACATCCAAATTCGTCATCAAGAAATGTTTCAGAAT
CAGACATGGTGGAGGCTACAAAGTCAAATGTTATAAAAGTGCACCACAAT
tggtcaaaattcgaaaatctGCAGGTGTCATCAATAAAGCCAAATTGGTC
AAAGTCTATTACACCAAACACTAGATGAAGATTTGGAAAGCTTTGTTACT
CGTCTCCTTCTTGGTGTACAAAGTTCACTGTGAAACAGAACAAGAGGCGA
AAACTATTTCCAAtgatgaagaaacaacaaatgaCATTGAAAATGACGAA
GTAACGATGGACCTTCTAGACCAAGATGAAGACCAAGAAGATGAACAAAG
TGAAGATGAAGCAAGTGAACaacttgaaaatgaagaagaaatgaaAGATG
AACTGGAAGAGCAAGATCTTAAAGAAGATGAAGACGCAAGCTACAAGCGA
TTTCTTTACACCAAGAAGGTCTTCATCTTCAAAGACAAACACCCTGTTCA
ATGTCAAGTCACCAAAAGCAGCAACAACCCAATCAGATGCTACCTCAAGT
ACGCATGCGTCAAACGTCATGGTAACAAATGCATTAAAAAGAAAGTGTGG
AAATTTTGCGTTTTCAGATTCACAAAGACATGTTTGTTCACATCCAAATT
CGTCATCAAGAAATGTTTCAGAATCAGACATGGTGGAGGCTACAAAGTCA
AATGTTATAAAAGTGCACCACAATtggtcaaaattcgaaaatctGCAGGT
GTCATCAATAAAGCCAAATTGGTCAAAGTCTATTACACCAAACACTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000057XLOC_000057Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000109-proteinTCONS_00000109-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000109-exon-sc0000001-1491911889:1981881..1982186TCONS_00000109-exon-sc0000001-1491911889:1981881..1982186Clytia hemisphaericaexon
TCONS_00000109-exon-sc0000001-1510915933:1981881..1982186TCONS_00000109-exon-sc0000001-1510915933:1981881..1982186Clytia hemisphaericaexon
TCONS_00000109-exon-sc0000001-1575043694:1981881..1982186TCONS_00000109-exon-sc0000001-1575043694:1981881..1982186Clytia hemisphaericaexon
TCONS_00000109-exon-sc0000001-1491911889:1982349..1982856TCONS_00000109-exon-sc0000001-1491911889:1982349..1982856Clytia hemisphaericaexon
TCONS_00000109-exon-sc0000001-1510915933:1982349..1982856TCONS_00000109-exon-sc0000001-1510915933:1982349..1982856Clytia hemisphaericaexon
TCONS_00000109-exon-sc0000001-1575043694:1982349..1982856TCONS_00000109-exon-sc0000001-1575043694:1982349..1982856Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1981881..1982856 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.491344 0.743393 0.321011 0.391148 0.316322 0.124981 0.226176 0.0847151 0.148247 0 0.0594111 0.0390545 0.156213 0.202681 48.2673 5.67654 0.0440215 0.0451206 0 0.0652307 0.0566973 0 0.201709 0.305639 0.0629601 0.112381 0.0804083 0 0.0650868 0.132626
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000109 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php