TCONS_00000102 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000102
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1763

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000102 ID=TCONS_00000102|Name=|organism=Clytia hemisphaerica|type=transcript|length=1763bp
ttaaaactttggctcggacatacctgtcatcactcgcaaacctagtaccc
cctggGGCTGGGTGTCAATTGCTTATCTTCCTATGACCCTGGTGGTCTGA
TAGCAACCTGTAGCTGCATCTTGAAGAATCTGTTATCATTCACATGAATA
ATAGTTCACAGGCTCTCAGATTACCATTTTTCAACAATGATGCGTTTGAA
GTGGACTAATCGGGTACAAACTTTTGGTCACCTTCAGTCGCTACGTCGCT
ACAACATCTACAATATATTCATCTCCTGCAATTTTTCCCAAAGATTTGCA
AATCTGCAGGGTTTGTAGATTGAAATTTGTTGATTGCCTACATGATTTCT
TTTCACTGCCATAACGAATGCCAACTAAAGGATTGCTAAAAATTGGTTTG
Agggattttttcctgtatttttatcaaaatagtctttcttttcatttcag
AAAACAAAATCTAGTTGTAATGAATGTTATGAATAAATGTAACCCTGAGT
GAAATGTAAACTGCACAATgtcaatttattttaaatgttcAAAGTCGCTT
TCAAGATTTACTCAAAGCCAAACTTGGAGGAAAGTTTTAAATACAACTCG
TTCATATCACAATGAGTTAACTACAAGACCTGCATTGTTACAGCCTGTCC
TGTTCACCGCTGGAGTTAGCATAGGCTCTTTTGCAGGATGCTCCATTCTT
CAATATGAGcgtgtcaaaacaaagatgggtGAAGAATCTTCCATATCCAA
GTTACTGAGGAGGCGTAAAGAAAAAGGATTTGAATTTCGAAACCAGATAA
ATAAATGGTGGAATGGTCTCCATGAAGGTCACAAAGTAGCAGGTGTTATC
ATTGGCATGAATCTACTGGTATTTTCAGCATGGCAACTTAAAGGGTTACG
TTCTTTTATGGTCAAGTGGTTCACTTCAACACCGGCTGTTAAAAAATCTT
CACCATTGTTATTGTCTTGTTTTAGCCACAGTGACATTTGGCATATCGGT
GCAAACATGTTTGTGTTATGGAGTTTTGCACCACTCATTCAATCTTTACT
AGGCACTGAACAATTTATTGGTTTCTATACAGCAGGTGGTACAATATCTT
CTTTAGCAAGTTATTATTTCAAAGTAGCAGTTGGCTCTGCAGTCCCTTCC
CTAGGGGCATCAGGAGCTCTTCTAGCTGTACTGGCAGCATGCTGTATTGA
ACGTCCAGACGCACGACTTTCCATAttatttctaccattttttacaTTCT
CTGCTCAAACTGCACTATACAGTATTATAGCAATAGATGTGACTGGTTTA
TTGTTACGATGGAAGTTATTTGATCATGCAGGACATTTAGGTGGTACCTT
ATTTGGTAGCTGGTATGTTATGAAAGGACATGAATGGACTTGGGATAAAA
GAGGTCCCTTTATAAGATGGTGGCATGAGTTGCGCCAGtcaatgaatgaa
aaataatattttatgtaaTGTTGTCTTGCATCATAGTTTTGTATTAAAAT
CAAGTACAGTGTGTCCCGTTTAAAGCGTTTGGTGTCATACCTGGTCATAT
TAGTTTATatcaatattttatcaaaattaattaACGTGTCAACACTCATT
CACTACTAAGAATAACCGGAtgaattttaaggtttttgaaCCACTTTAAT
TTATACGAGACATCTTGTATTTTATTGTATAACTAGCTTTGtaatactaa
aaaatattttagcttATAAAATTTCTGTTTATTATTAATCTACAAGAGAa
cttaaaattagaa
Run BLAST on NCBI

transcript from alignment at sc0000001:1933671..1935433+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000102 ID=TCONS_00000102|Name=TCONS_00000102|organism=Clytia hemisphaerica|type=transcript|length=1763bp|location=Sequence derived from alignment at sc0000001:1933671..1935433+ (Clytia hemisphaerica)
ttaaaactttggctcggacatacctgtcatcactcgcaaacctagtaccc cctggGGCTGGGTGTCAATTGCTTATCTTCCTATGACCCTGGTGGTCTGA TAGCAACCTGTAGCTGCATCTTGAAGAATCTGTTATCATTCACATGAATA ATAGTTCACAGGCTCTCAGATTACCATTTTTCAACAATGATGCGTTTGAA GTGGACTAATCGGGTACAAACTTTTGGTCACCTTCAGTCGCTACGTCGCT ACAACATCTACAATATATTCATCTCCTGCAATTTTTCCCAAAGATTTGCA AATCTGCAGGGTTTGTAGATTGAAATTTGTTGATTGCCTACATGATTTCT TTTCACTGCCATAACGAATGCCAACTAAAGGATTGCTAAAAATTGGTTTG Agggattttttcctgtatttttatcaaaatagtctttcttttcatttcag AAAACAAAATCTAGTTGTAATGAATGTTATGAATAAATGTAACCCTGAGT GAAATGTAAACTGCACAATgtcaatttattttaaatgttcAAAGTCGCTT TCAAGATTTACTCAAAGCCAAACTTGGAGGAAAGTTTTAAATACAACTCG TTCATATCACAATGAGTTAACTACAAGACCTGCATTGTTACAGCCTGTCC TGTTCACCGCTGGAGTTAGCATAGGCTCTTTTGCAGGATGCTCCATTCTT CAATATGAGcgtgtcaaaacaaagatgggtGAAGAATCTTCCATATCCAA GTTACTGAGGAGGCGTAAAGAAAAAGGATTTGAATTTCGAAACCAGATAA ATAAATGGTGGAATGGTCTCCATGAAGGTCACAAAGTAGCAGGTGTTATC ATTGGCATGAATCTACTGGTATTTTCAGCATGGCAACTTAAAGGGTTACG TTCTTTTATGGTCAAGTGGTTCACTTCAACACCGGCTGTTAAAAAATCTT CACCATTGTTATTGTCTTGTTTTAGCCACAGTGACATTTGGCATATCGGT GCAAACATGTTTGTGTTATGGAGTTTTGCACCACTCATTCAATCTTTACT AGGCACTGAACAATTTATTGGTTTCTATACAGCAGGTGGTACAATATCTT CTTTAGCAAGTTATTATTTCAAAGTAGCAGTTGGCTCTGCAGTCCCTTCC CTAGGGGCATCAGGAGCTCTTCTAGCTGTACTGGCAGCATGCTGTATTGA ACGTCCAGACGCACGACTTTCCATAttatttctaccattttttacaTTCT CTGCTCAAACTGCACTATACAGTATTATAGCAATAGATGTGACTGGTTTA TTGTTACGATGGAAGTTATTTGATCATGCAGGACATTTAGGTGGTACCTT ATTTGGTAGCTGGTATGTTATGAAAGGACATGAATGGACTTGGGATAAAA GAGGTCCCTTTATAAGATGGTGGCATGAGTTGCGCCAGtcaatgaatgaa aaataatattttatgtaaTGTTGTCTTGCATCATAGTTTTGTATTAAAAT CAAGTACAGTGTGTCCCGTTTAAAGCGTTTGGTGTCATACCTGGTCATAT TAGTTTATatcaatattttatcaaaattaattaACGTGTCAACACTCATT CACTACTAAGAATAACCGGAtgaattttaaggtttttgaaCCACTTTAAT TTATACGAGACATCTTGTATTTTATTGTATAACTAGCTTTGtaatactaa aaaatattttagcttATAAAATTTCTGTTTATTATTAATCTACAAGAGAa cttaaaattagaa
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000051XLOC_000051Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000102-exon-sc0000001-1491911889:1933671..1935433TCONS_00000102-exon-sc0000001-1491911889:1933671..1935433Clytia hemisphaericaexon
TCONS_00000102-exon-sc0000001-1510915933:1933671..1935433TCONS_00000102-exon-sc0000001-1510915933:1933671..1935433Clytia hemisphaericaexon
TCONS_00000102-exon-sc0000001-1575043694:1933671..1935433TCONS_00000102-exon-sc0000001-1575043694:1933671..1935433Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1933671..1935433 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
25.662 25.7894 10.573 8.82871 8.13481 5.77452 8.76316 9.22946 7.92533 9.92209 5.07223 4.81185 5.12248 3.69557 5.55402 6.39319 10.5662 9.4652 2.53598 4.77669 9.15653 7.71087 31.9632 29.4149 6.65216 8.71776 5.09368 4.48854 17.248 19.7707
Blast
BLAST of TCONS_00000102 vs. Swiss-Prot (Human)
Match: PARL (Presenilins-associated rhomboid-like protein, mitochondrial OS=Homo sapiens GN=PARL PE=1 SV=2)

HSP 1 Score: 231.106 bits (588), Expect = 5.456e-69
Identity = 132/280 (47.14%), Postives = 185/280 (66.07%), Query Frame = 2
Query:  632 ALLQPVLFTAGVSIGSFAGCSILQYERVKTKM-----GEESSISKLLRRRKEKGFEFRNQINKWWNGLHEGHKVAGVIIGMNLLVFSAWQLKGLRSFMVKWFTSTPAVKK-SSPLLLSCFSHSDIWHIGANMFVLWSFAPLIQSLLGTEQFIGFYTAGGTISSLASYYFKXXXXXXXXXXXXXXXXXXXXXXCCIERPDARLSILFLPFFTFSAQTALYSIIAIDVTGLLLRWKLFDHAGHLGGTLFGSWYVMKGHEWTWDKRGPFIRWWHELRQSMNEK 1453
            +L++P+ FT G +  +F   +I QYE +K+++     G ++     +R +KE   +FR +INKWWN L +G +    II  N+LVF  W++  L+  M+++FTS PA K   SP+LLS FSH  ++H+ ANM+VLWSF+  I ++LG EQF+  Y + G IS+  SY  KVA G   PSLGASGA++ VLAA C + P+ RL+I+FLP FTF+A  AL +IIA+D  G++L WK FDHA HLGG LFG WYV  GHE  W  R P ++ WHE+R +  +K
Sbjct:   97 SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEG--DFRKEINKWWNNLSDGQRTVTGIIAANVLVFCLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKK 374          
The following BLAST results are available for this feature:
BLAST of TCONS_00000102 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PARL5.456e-6947.14Presenilins-associated rhomboid-like protein, mito... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php