Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000099 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000099
Unique NameTCONS_00000099
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3677

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000099 ID=TCONS_00000099|Name=TCONS_00000099|organism=Clytia hemisphaerica|type=transcript|length=3677bp
TTTTTATTACAAATTGTCATGGTTAGTCGCtagtttgtattttcttcagt
gcaTATAATTTCACAATActtctttatatttttcagccaaaacaaaaagt
aaaaatgataagaaaaaaTTGATACTACAACAGTACAAATTAATAATCAA
AGATGGCGTCACAAATCAAAGATCTTGCCATGGATGAAGATATTGGACCC
TCCGTTGATTCACCATTGATCGAGGAACGCATTGCTGCAAGACGATTGAG
GATAACAAGGCGTATGGAGGCTTTAAAAAAAGACACTCTTGGAGAAGATG
TTACAGTCAAAGTTTCATCCGAACCAACTAAAGAATTATCCAAAAGCCGA
AAACAAATTGAAGAGAGTTTCCAACAATTAGCAAAGTTGATCTCAGATGG
TACAGAGTTGGTATCGAATATCGAGGTAGCGTGTGACTCGAGGGAAGCTA
CACTACGacaagaagaagatgaaaatgtcaGACAAAGaacacaaaaattg
caagaTGAAGTCAAAACAGCTGCTATCAAATTCGAACAGatcacCAAAAA
ATGGGAAGGTGCACTGAAGAAGGACGTCCCTCAACAATTAAAAGAAATGC
TGGAATCACAACGTGAACTATGTGACGAAATGATCGGTGAAAAAGACAAC
CTGATTGATGAGCTGCAACaagatttaaaacaaaaagatgacCAGTATGT
TAAAGACCTAAGAAAACAGtcaGAAGATGCGGATCTCATGCTTGAACGAA
TGGAagaacaaatcaaaacattgaatcgTGCTCATAAGAAAGAACTTGAC
AATGTTGAGAATGCTTTCTATTCCGAGCGGAGAGATGTACTGCAATCGCA
CAAAAATAAAtgGACCAATCAGAGTGAACAACGGCGTCAGAAAGAACAAG
AGTATTTAGAATTACGTCAGAAACACGTGGAAAATTACGAGGAACAATTG
AACACGTTGCGAGTTCAAGATGCAGAGGAGTATAACATGGTCAAAATCAA
ACTCGAAACTGACGTTCAGattttggagCAAAATCTTCAACAGATGAAAG
CAACATACCAgttaaatcaagaaaaactcGAGTATAATTTTCAGGTGTTG
AAAAAGCGGGACGAAGAGAACACGATAACGAAATCACAACAGAAGCGTAA
AATCACACGCCTCCAAGACCTTCtcaacaatttgaaatttaaactcaAGA
AGCAAGAACAACAGTACAAGGACGAGAACCAAGCTTTTTCAGATGATTTG
AAACGAATGACTGAACAGTACAAGGAGctacaaaagaaatttagACATTT
CCAAACAACGGACAACAAGAAGTTTGTGGATATTTGGAAAATGAATGAAG
AACAAACAAGAGAGTTGATCGAAGATTTGTTATCCGCTGATCGTATCATC
TTTGAACAGCAACTTGGTATGACGTGGCGTTCACCTGAAATCAATTTTCT
GCAAAAAGTTGGTCCTATCAACGGCTCGAAGAAAGCTATATCGAAGACTG
CGTTGGATGCAGCTACGGAGATCTTAGCGTATGATGAATCCGCTGACAGT
AACTCACACGGCAAAATGACTGCAAAGACCTCTACGAAGGAGGGCAGCAC
CAAACAAGAGATTGAGCACAGCCATGAAGATTTGGACGCACCGCTTTCCA
CCGGAGCGATCAAACGAATGCTGGAACTGCTTTGTGATGAATCGGGATTT
CTTGTTGAAGCAAAGTTGATCAAACTGTTGGCACCCATTGAAAAAGATGA
ACAATCGCTGATGAAGTTGGATGCCATCTTTAATGCCATCGGTATCGAGT
CAGAAAGAGACATCGTATCACTCGGCAAGTATTTCTATAATCGTTATTTG
GAGAAACTCGAACAACCCGAAGACGAAGAGGAACAGAATGGAGAAGAGTC
cttgaccaatgaaaacgctccAATAACAGAAGGAGCCAATCAGGATCAAG
ATCAGGTTGACACGCCAACCAATCAGAAACAAGAAGCTTGTGATTTAACC
AATCAGGAGACGGCATCAAATGAAAGTTTAGAATCGATACCGATGGTTGT
TCGACAAGAGCTCATTCATCCAAACGAAGTTGTGAAATCTTTGAGAAAGT
TTATTGACGATAATCGAGAACCATTCAAGGACAGTCGCAAATCAAACACC
GTCCGTATCGGTAGTTCATCAGGACGTGATAGCAGTTACGACGAACAATA
TTGGACGCAGCTAGCTTCGGTTATTGATCTACAGAGAGAACGCCTGTGGG
ATGGGATGGTATCAGGATTTGAGAAATACAGTCAGATATTGAAAGAACGA
TCGACTCTCATTGGTGAAACTGATTCCCTTAGACAACAGAATTCCGAACT
GCGAATGCTTTTACATCAGTACCTAAGCTCTAAGGTCAATCAAGAATTGG
AGATTCCACCGACACGTGTTTTGCAAGTTGAAACTGGACATTCAAAGTAG
TAGTGCTTTTTTGTTTTGGGCCTATAAAAAATAGTTTAAAGCAGATGATA
CTGCTTCAAAATTTAGCCAACCGGGCTAGCCCGCTTCCTTCAACAGCCGA
CACTTTAGATTATATTTTATGTATTCATTGCATAGTTCCTTTTCCGATTG
GTTTTGATGAGAGAAAATATCTCCGGGTAGATTCTAATCATTCTGCATGG
TTCTGCCGTGTGATGATCTTGAAGTTAGGTGATCTGTGTTGAGATTTGCG
ACCCGTTCCAATCCTCTACTttaaagattacgtcattaattgaatgattt
gaaaaattgttgtttAGAGAAGTCAATGAGAGAGAAAACGTTTTTTTCCT
GCTGACGTAAAATTAGTAAACGAAATTGATATCCTCTTTATTCGCTAAAA
TCTACATCAATCCACtacttcaaaaaaataaaatgaagataaaaatgctg
acatcagcaaaatgTCATCAATTGTCAATCAAAATATTCCCTTTATGTCA
CCATCGCTATCACACTACTATTTTAGTTCAAAATTCCACATTCtttcctt
ttcaaaatattgacttttaaaaaaatagatTCAAAAAAATCGGagaattt
aatgttgacacaaAGTTTCATAGACGTGACATCTTCGTCGCAAAAAAACA
CATACTCTCTCgaactttagtttttttttctttcttttgaacacaaaaaa
aagttgaaacgtTATAACTGGACTGGCTGCGAGTGTgtacaaaaaatact
ttttcgTTGGTATGGTTTGCGTgtgcttattatttttttaaacaagggTC
AAATTGTAAGCTTTATTTTTACTTATGTTTATCGCCACAATCTGTGGTTT
TTATCTAGCACTCGCCGTTCCATGGTATGCTAAATCTATTTGTAATGTCG
CCCCATTTTGCTGTAGTGATGGATTTGGGCTAAAATTCTGTACACAGCCC
TTACATTGAATTTCCAAAGCTGTATTGCTCAAAGTTTTTTCATCTCCATG
ATGGCTTTTGTCCAAGACAAAAAAAGTATTTCCAAAAAAGTTCAATAGAC
ACCACCAGACTATTTGCCTGATTTTCAGCCCAAATTTTGCCCCTTTATGG
CGCTAATAGCGAGTCGATTTTTGATATtacgtgattttgggaccctgtTA
GAGACTCGATTGCTGTTTTATGCTTTTTGTaccccctttgagagactttc
gagggtgtaaaaaaagttttgccaaag
Run BLAST on NCBI

protein sequence of TCONS_00000099-protein

>TCONS_00000099-protein ID=TCONS_00000099-protein|Name=TCONS_00000099-protein|organism=Clytia hemisphaerica|type=polypeptide|length=765bp
MASQIKDLAMDEDIGPSVDSPLIEERIAARRLRITRRMEALKKDTLGEDV
TVKVSSEPTKELSKSRKQIEESFQQLAKLISDGTELVSNIEVACDSREAT
LRQEEDENVRQRTQKLQDEVKTAAIKFEQITKKWEGALKKDVPQQLKEML
ESQRELCDEMIGEKDNLIDELQQDLKQKDDQYVKDLRKQSEDADLMLERM
EEQIKTLNRAHKKELDNVENAFYSERRDVLQSHKNKWTNQSEQRRQKEQE
YLELRQKHVENYEEQLNTLRVQDAEEYNMVKIKLETDVQILEQNLQQMKA
TYQLNQEKLEYNFQVLKKRDEENTITKSQQKRKITRLQDLLNNLKFKLKK
QEQQYKDENQAFSDDLKRMTEQYKELQKKFRHFQTTDNKKFVDIWKMNEE
QTRELIEDLLSADRIIFEQQLGMTWRSPEINFLQKVGPINGSKKAISKTA
LDAATEILAYDESADSNSHGKMTAKTSTKEGSTKQEIEHSHEDLDAPLST
GAIKRMLELLCDESGFLVEAKLIKLLAPIEKDEQSLMKLDAIFNAIGIES
ERDIVSLGKYFYNRYLEKLEQPEDEEEQNGEESLTNENAPITEGANQDQD
QVDTPTNQKQEACDLTNQETASNESLESIPMVVRQELIHPNEVVKSLRKF
IDDNREPFKDSRKSNTVRIGSSSGRDSSYDEQYWTQLASVIDLQRERLWD
GMVSGFEKYSQILKERSTLIGETDSLRQQNSELRMLLHQYLSSKVNQELE
IPPTRVLQVETGHSK
Run BLAST on NCBI

transcript from alignment at sc0000001:1853832..1880636+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000099 ID=TCONS_00000099|Name=TCONS_00000099|organism=Clytia hemisphaerica|type=transcript|length=26805bp|location=Sequence derived from alignment at sc0000001:1853832..1880636+ (Clytia hemisphaerica)
TTTTTATTACAAATTGTCATGGTTAGTCGCtagtttgtattttcttcagt gcaTATAATTTCACAATActtctttatatttttcagccaaaacaaaaagt aaaaatgataagaaaaaaTTGATACTACAACAGTACAAATTAATAATCAA AGATGGCGTCACAAATCAAAGATCTTGCCATGGATGAAGATATTGGACCC TCCGTTGATTCACCATTGATCGAGGAACGCATTGCTGCAAGACGATTGAG GATAACAAGGCGTATGGAGGCTTTAAAAAAGTATGGTTTTTTTTTGCTAT CTTCTTTTTCATACTTTCTCAAAATCTCTCTCATCCTTCTAAAAAGCTTA CTTGAATGGAATCTCACACTTTTCTGCGAgttttaatctcgcgaaaatag taaaaattcgcgaaatcactaatatctttccaatgataccaaatttaaat AAAGAATGAAGAATTCCTCCAAAATTTataaggtaaaagaaaaaagagta cACACTTAATCGTGAATAGGCTTTAATGACCTTCAACGACTGGGTTTAAT TTTGATATAATTTAATTTTGTCTTTCTCCATTTGGTAAACTCGGTTCCCA TGCCCATTCTCCCCACAAGTTGTAAGGGTTTAAATTATATTACTTATTTG GGAAAGAATCCACATAGTATATCGGGACCAATTTTCTCAATATACTCTTT GTCGTGACATGACGTCAGAATTGGATGACAACAGAGCACTATTGTTTTAA AGAATCTGTTCACCCTATGGACACACGATCTAGATCTGGATATCATAGAT CGCTTTTGGatgtaacattttcaaaaagttttttggtcTTTTCATTTTAG AGACACTCTTGGAGAAGATGTTACAGTCAAAGTTTCATCCGAACCAACTA AAGAATTATCCAAAAGCCGAAAACAAATTGAAGAGAGTTTCCAAgtatgt attcatgatatgcaccactggagagtcttctgagaatttttaaaattttc cacccaatacgtcacttaaacaatagaaaaagtgacgtatttggtggaac aaaaacagaaaagttgcataatttcgtaaagtcattgcagtggtctATAT CATGAATATATACAATGAAGTTTTGGTTTTTGGTTTAACCCATTGGCGTA TTACCAATgtagttttgataaaagttttttaaggGAGATAAAAGAGTAGC ACTCTCTCcgctaccttcgggtagatagctatcgaaagaagaGCCTTCGG GTCACCTTCGACTGCGGTCgtaatcactgacctttatataccctggacct agcttctcaatcccagccaagcaaaatctttgatcggagttttttgaaaa ttggtaccctaatggcggcactactcgatagcggtgtaaatgcatcgaga gcgctaggtctacttttcctcgaattcttttgatgatgtagcggcgttag acgttaatttttaacttgTAATGGCTTctcctcgggtaccaattccaaaa aaaactccaatcaaagatggcagatattgcttggtccagggttatataaa ggtcagtggtcgtAATATTTCCTTACTAAAGTATTCACTTTATTTTTCCG TTTCTCAATAGCAATTAGCAAAGTTGATCTCAGATGGTACAGAGTTGGTA TCGAATATCGAGGTAGCGTGTGACTCGAGGGAAGCTACACTACGacaaga agaagatgaaaatgtcaGACAAAGGTATGTGAAAGGTTGGAAAAAATCAG TGATTCAGTTGCCtttttctaattcgatcttcatgtaactataattatat ttttttcttcgaattagagaaatatttaaaaagagcATTTTACACTAATT TTAACCAAGatttaagttcgaattatagaaagatttatatagaggttcga attagagagatttgACTGTGTGTACTTACCTTTGTTCTAATTATGATTTT AAACTTCTTGATCTAATATTTCTCACAACATACCTCGTGTCGTTTAGGCT ATTCCAGATAAGTTATTCCCCTCTCATGTTGGGGATAGtcaatttacccc cccccctccccatCTCGATGTTCTATATTTTTTGAGGGCACCATCTCATG GTAAAATGACTTCTTCAAAGGGATAAAACTTTTTCCTTGAACGGCCTATT TGCTTACTCAGCTTTTTTGCGAACAATAGAAGCAGTTTGATGattttcga attatttttaAGGTATTTTCGAATCATATTGTTCTCTTATTTTTAGaaca caaaaattgcaagaTGAAGTCAAAACAGCTGCTATCAAATTCGAACAGGT TTGTAGACTGGATGTAGCGTCAGGATGAGATTGAATAAACAATAACGCCG TGTTTGTAACACTGTTCAGTGCATTAATTTATTGATGTGTAGTAATGTAG TGTTCAAACTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNggggggggggtcggtagtaaaatctcagacatatatgagta gtaaaaggatttttacgaatttttacataccaccacccagactcttggga gaggtattttactaccctggtagtaaaagtttttgggacaatttgtcatg gagaccacctactttttggttgcttttaggacagattttacaaaaaaagc taaaaaatgattatttctgtgacacatttgtcacttagtgcaaaaattaa tgttttgcccttagaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNAGTTGAGTTGCATTGTTTCACAACCCT TTACGAGCTGACTTCCTTCATCAACGAGAAGCTTTTTCGGGTAACCAACC TCACAGGCTAGTCGTGTAAATGCTTGAAGAAATGACGTTGTGTTGTAGCT GTCCATGACTTTGATTTTGACAGCTGTGATTGTAGCGCAGCAGAAAACGA GTAGCCAGATCTTCACAGTGGCGCGCTTGTGATGTTCTGAATAGGACTGA AATGGTCCAGCAAGATCAGTCTGGGCGACAAAGAAGGCAGGGGCAATCTT TAGGTTGTCTTCTGAGAGTGGTCCCATTATGACTTGGAATTTCCTTTTTA ATAGATNGAAGCTGAGGGATTTggtttgtgaaattttttgaagctaTTGA TGAATTTAAGTACGTAAGCCATCACTCTGATTACATGGTTGAAATTTCTC CAATTGGGGTCGATCAAATAATTTGAGTATTTGTAGTGATTTGAAACGGC TTCTGGAATCATCGACTTGGTTGAGGATATGTAGCATTCGATACCTTCCT TGTGTACTTCTTCTCTTGACTCTTTCTTAAGATGTTGTTTCTCTTGCGCT GTCAGTGAGATGTCAGTAGTAGTCTTGGCTGGGAAGTCCGAAGGGTTGCT TCTCATCCATTCATATCCGTTGATCCACTTTGAATGTTGGTCGACATCTT GGATGGCTGTGCATCTTCTAGTGCCCAAGTCTGCAATCATGTCCTCTGAT CTGACATATTTCCATTGGGATGTGTCTGTAAATCTGTGGACTTCAGATAC TCTGTTTCTTGTCCATTGCTTTAAATTCAGGTGAAGGTTACAAATCCAAT AGAGACTGATCTGAGAATCTGTAAATTTGATGCTCGACTTGTGTTTATCC TTCAGGGCTTGTTTGATTGTATGACCAGAGTGTGCATTGATCATCGCTGC ATATAGCTCTGCACGTGGTTGAGTGTATTCATCTGAAATGAGTTTGGATC TACCAAAGATGAATTGACAGGAGAATGATCCATCCTTCTTCATGAATCGA ACATATATAGCGACACAAATGAGGCTTTTGCTTGCATCCCCAAAGTCAAG CGTCTGAATGTCTAAACTTGCAGCATCTTCTGGTACAACGGCTCTTGGAT ACTTGATTTGTTTGATTTCATTCATCATATCGAAATGGTCAAGCCAAATG GTCCGGATGTTATCGGGAAGAGCATCATCCCAATCCAATTTCCGAGTGAC AAGGTCGTGAAGATCTAGTTTCATGGTGGCAACAATCGGTGTGATTAAAC CAGTGATGTCGTAGAGTTCAGCTACCTTGGCCACGCATTGTCGTCGAGTT AGGTTCTCAGGTACCGTAGATACAAGTGTTGGTTTGCGACCTCGTGATTT TTTGGCGAAGTTGAGTTCTTGCACATCGAGAGAGATTTGATCTTTGAGTG GAAACCACTTGAGTCCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNCTCTTGTCTTTCTCCTTGTCATTGGTTGAGTTGG ATGTCTTGGTATTCGACTGGATGACAGTGACTTGTTGCTGTACCTTGATT TCTTTCTCCAGAAATTCGATCATCTgtttccttttgtattttcccTCTCT TGGACTTTCGCAGGTCAATGTCAGCCATCTCATCATTCGACTTTGACCAA GTTCGTTCGACAGGTGGGTTAGGGCGTCACCATAGTATAACTCGTTCTCG ATGTTGTGGTCGGATGCTAGATGCATTAAGTCCCGCATGACGTTGATGAC CTTGCTCAACGATTCAGTGATTTTGATGGAGTCCTTGTGCTTCAAGTCAA TGGAATTGAGTTTGGACAGCTTGTTGGAAAGGAGCAGACGTCTATCACCA AACGCATCTTTGAGTCTTGTCCAGATATCTTGGATGTCGGTCACGTTCTT GACAAGCTCCAGGGCATGTTTTCCGAGATGATTGTTTTTCAGTAAGTCAG ACTGGTACGATTTTGGAATGTCTGAGAACAGTTTATTGAACTCCGAGTTG AAGGTGTAAATGTCAATGTGCGAGTCATAGCCTGTGAACGTAGGCAATTT GATATTGAGctgactctttttaaagttATCAAGTTTATCAAGTTCTCTGG TTTTGATTTCCTCTTGAAGACTGCTCTGGTATGACAATCGAAGCNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAATG CAgaccaaacaaaaacaaacaaaatggctgcaCACTGAAAAAGGTGAGAG TGTTTGATTGACCAAAAATGGATTAAAACTAAGGTTTATGCCTTAacact ggagtcgtttataatccatgtaatacagtaatatgtgtttgaaaatgata attagatATTCGTAGTTGTGATAAGTCAAGAGATAGTCGAATGAGCTTGA CAGAagcaatgttaatttttatttttaaacatgtTTCGATATATTAATGA TCATCAGTAATTATTTAGTgttctaaaaataaataaaaattaggtTATTA AAAGTGCAAGTATAATTANGTAATTATTAATgttctaaaaataaataaaa attaggtTATTAAAAGTGCaagtaaaattgtaaaatgagaCGAAGTACAA GGACAAAATCAAGATAATCAAACTATCAAATTAACTTTTCAACGTTTTCT GAATATTCAAGACACCTCTTAAACGTTATAATATAATATTAGTTGTATTT GTCctttccattattttttttgCCCGAGTTAGTCATCTAGTTGGTTTGAC AAGTGAATTTCGGAAGTCGACATGAAATTCAGAAATTCATTAATTTTAGA AACAGCTCGACCATTTTAAGCGTCTTAGTgctaaaaaaatctgaaattat cCCTTGTCATTTTGTCATTTACAGATATGTTTCATTCAACGGGCTcaaaa aaagcgaaaatttgAGCTTTGACATGTGTTAATCCGAAGAAAAAACTACA GTGATCCTGGCAGTGTTTCTCTATATCCGCTCTGTCAGGGTTTTCATAAC CAATTAACTTTAATGAAGACtggtttcaaaagttttctttatttttccct cgttacttttcaattttttttttcagatcacCAAAAAATGGGAAGGTGCA CTGAAGAAGGACGTCCCTCAACAATTAAAAGAAgtactttgtttttttca tagtTGCAGCCTgttcaaaattgtattttgtccAAATTATGACagactaa agtctattcacgataagattgcactcttttttcatttacttataactttt gaaggaattcttcaatctttataaatttggtatcattggaaagatattag ttagtggaacaatttgaaataNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNgtcatcactgtgaaaaaatttctcaaaaataa tcattcagtcaaaagatatcaaacaaagttataagctgattgacgtctaa aaacgctgttttttgctgttttttggggtcaatcacttattgactttgta tcataactttgtattgaataaatattttagtgaaatttcttcacagtgat gacctccaaagatcaaagagtgatatctctccagtgaaaatgaaagttat agcacttttctacaagatcttcatttttttcttcttcattttcatcttca tttttagaattcttttgaagATNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNctctccaacgataccaaattta taaagattgaagaattccttcaaaagttataggtaaaagaaaaaagagtg cacacttatcgtgaatagacttcagtcaaagattgaaagtaaataagttt agatttttttgataaaaaaggtaCAAGAGTAAGTTTAGATTTCTTATTTT GAACTACATGTtttctatataagaacaaagtttATGGAAACATTGACTTT GAGGCCAAATTTAAgtacattttaagaaaattttcaaagctctgCAGTTT CTTAGGAAATTAGACCAAATCATTCACAAAGTGCTGGGAATAAGAAAACT TAaagaattattttaattttcaaaatctaaaaaaagttaagaacctCCGA AATCTGTTCTTTTTAGCGTGCGGCTGCATCCTTAGTTTAGCattatgtct atgagtgtggttGCTCGACTCGCTTATTTCGACAAATTGATAATCTACTT ACTTACTAGTTACTTACTTTAATCTCAGATGCTGGAATCACAACGTGAAC TATGTGACGAAATGATCGGTGAAAAAGACAACCTGATTGATGAGCTGCAA CaagatttaaaacaaaaagatgacCAGTATGTTAAAGACCTAAGAAAACA GGTAAAATATTTCTGGACCATCGAGGTCGTCTTTATCAGAAAGGAATGAC GTTGAAAGGTCTGTCTCTTTGAGACTATAATCAATTCAATGACTTCTGTT CATAAAGACCTAAGAAAGCAGGTAGAAATATTTTGATCCTTCGGCGATCT TCCCAATTTGATTACCCCTTTAATGCCAGTCAGGAGATGTTGACGAAAGT TGGTTCATAActttaaaggtttcatttttacataagttttcccgtttcat atcagacatataattcatatcaggacagtgtctggctattttatattatg ctgatataaacaaaaaattgtttttcttttcctcgttctgaccaatcttg ctccacatccgtatatcaaaaagcttgtgaattagaattgatgagtaagc aaacaatatctctcttatttgaaaacaaaacctttaaatcagAAAGCCAT TCCCTGAATGTGGAAGCGAaggcgaaaaaaatttttttcgcggaattaac tttcgcgaatggcgaCCTTCAGCATTTTTCGCGGAACTTAATATTCGAAA GTTTCTTCTGCGAAAGTATTATTAGAGGTTTCAGTTTGGGGTACTTTGGC TTTTATGTGttgttttattcaaattttcttttttttgtttcagtcaGAAG ATGCGGATCTCATGCTTGAACGAATGGAagaacaaatcaaaacattgaat cgTGCTCATAAGAAAGAACTTGACAATGTTGAGAATGCTTTCTATTCCGA GCGGAGAGATGTACTGCAATCGCACAAAAATAAAtggtatttttttatta aaggagactctactgtaataTGATTTATAATGGTAATCACGCAAACAAGA TCAacttatttagaaacaaaaccttttcccaggcacacaacgttgtctcA ACGTTTAttcaacgttcacaacgtccatataacgttagatgagcattgaa acaacgttgtgtgcccgCTGGGTTCAAAACTCTTTACTTGAACTTTGAGG CCTCGTATGATTATACCTAGTTTCTTACAAACAAAGTTTTACATGTTTTA GTTTAGTTTACAATTTGACCCTTACAAAATGGTATGCAAAATTTTTCAGG ACCAATCAGAGTGAACAACGGCGTCAGAAAGAACAAGAGTATTTAGAATT ACGTCAGAAACACGTGGAAAATTACGAGGAACAATTGAACACGTTGCGAG TTCAAGATGCAGAGGAGTATAACATGGTCAAAATCAAACTCGAAACTGAC GTTCAGGTATATCAGGAggcagtagcgtagccaagaggggcgcgaaattt gtgtaggagagaaGATTTTTATaacacagtaattatctttttatattaca AATAGAtcattacagtgtcataaaaatcttcTCTCCTACaaaaattttgc gcccctcttggctacgctacggGGGAGGCTCTTACATAAAACTTCTGAGc tttaaaaatttcttcaattaGACTTTTTGTCCAACGTAGCAATTTTTTTG AATGTAATAAAAACTTTATTAGAATATGTTTTAAAGAGCATAGTCGTATC ATTTCACATTCTGTTGTCTTTGGACTTGAAACNTTTTAAGAGCATAGTCG TATCATTTCACATTCTGTTGTGTTTGGACTTGAAATctgaataataattt ttttgtttgttcagattttggagCAAAATCTTCAACAGATGAAAGCAACA TACCAgttaaatcaagaaaaactcGAGTATAATTTTCAGGTATCGACACT TTGTTTTGGCAATATCCTAATGGGCTATCCCAGAAAATAATTGTACCCCC TATGAACGTTGATGAGGTCTTTTTGGGGGAAGGTGAACCCTTcttggttt tttttttatttttcaggaccctaattggattttttttcacatcTTTTGGA ACAACCTGGATTCTCAACCTCATTCTATTgactcattttactgaccacct tGGATTTTAACATTcgccattcattcattcatacaTTCATTCATTAACAG GTGTTGAAAAAGCGGGACGAAGAGAACACGATAACGAAATCACAACAGAA GCGTAAAATCACACGCCTCCAAGACCTTCtcaacaatttgaaatttaaac tcaAGAAGCAAGAACAACAGTACAAGTAAGCAAAACCTTAGGGCTATGTC AGAGAAACATTTACTCGTCATGTAGATTTTGTTTGAGGTCTGATTTTAGC TTCGGGCGTTATGCttagaaaagctgaaaaatccaGATAGCATTATATGT CAACAGAACAACAAAGGTCCAGtcactaccttaagggaagaaattttggc gggaatttaatttggtggatggctgaaaaatctaaaaatcagggaaaaag ctaattttggcgataatttaatttggcggatgacggatTTTTAAATCCGA AATCACGGTGAAAACATtgatattgggggggggggggaaaaaagggaaaa aaaaaaaaaagggggggggggggggggcgggccggggggggggggggggg cgggccgggggggggggggggggcgggccgggggggggggggggggcggg ccgggggggggggggggggcgggccgggggggggggggggggtgaaaaat cggacacaaaagaaaaaaattaaatttgccgggaatttaattttcttccc gccagaatttcttcccttaaggtattgtCTTTACGTTCGAAATGAAGGAC TTTTGATTTATAAAAGCAACTCTTGAAAGGAAATCTTACTAAGAAAGTCG CGTGTGTGATTTCATTAGATTTCACCTCAACTTTAAGGGGTTGGGAAGGG TACTTAGTGCCTACTTTTCTTGATTACGGACTCCCAAAACACTAGAAATG CTAGAACAAACCAGTCGGTACGCAACACCAGAAAGCAGGTGTTGCAAATT TAAGATGATAAGCTAAATTCATTTTTGCTGGTATTCTTTGTACTCCAACC AAATTTTCTTAAAGGGACGAGAACCAAGCTTTTTCAGATGATTTGAAACG AATGACTGAACAGTACAAGGAGctacaaaagaaatttaggtAAGTAGTAG CTAAAAGTCTGTAGACGTTTATAAAAGGTATACATACGTAGGATCAATTC TTGAAATAGTCACATTgcaatcggcgccgaaatatttggcacaaaggggg aattccctcaaaactttaaaactgaaagtgatttttaagtacTTTGAAGT ACGGTTTGAAagctgagttttaacattagacttaagacttacgacctcag gatctcaggatctcaagatctaaaagctcaaatatgttccaataaggctg agaatatagtctGGAAGCCATTTAAcacctccaaaatcgaaaaatccaat gaaacaaagtggaagtactgaaactgcaattctcgcccgatctttaaatt ctgaaaaacgttaaaatacccaaaattgctaATATATTTCGGCGCCAATC TCACCCAAAGACGAAAAGCTCTTATTTTTGGTTGAATTGGTGGAGGTTAT AAATCGGTGAGAAGATTATTTCTCGATTAATGATGAGGGAAAACCTCGAA AACTTGAAAAAGCAAACAGAGGGCACCTGACAGTACCTGATAAATGAACG GTATCTTGTATACGGTATACGGTAAACGGTATCAGCCGAGCCCATGCAAA GGCTCACTTCAGTGCATGCCTTCAAAAGACGATATCTTGTTACTCAACTA TTTTTCAGACATTTCCAAACAACGGACAACAAGAAGTTTGTGGATATTTG GAAAATGAATGAAGAACAAACAAGAGAGTTGATCGAAGATTTGTTATCCG CTGATCGTATCATCTTTGAACAGCAACTTGGTATGACGTGGCGTTCACCT GAAATGTAAGTTTTATGACTCTCATTTGATTTACCACTAGGAGGCTAGAT TCTGTAGGTTTGGGGAATGTTGAGGGCCGGACCCCTAACAACGAACCCAT AACTAAATCCGTTtgtcagaaaaaatatttgtgaAAAGGTTACAGTTAGA GATAAATCATCGGTGGAAAGGATAATCCTTGGATAGGTTATGAAAGCTGA GAAAATAAGCCTTTTAGTCAACACATTTTATTTCCGAAACTGCAATCCAA AAATGAcaacaaagaaatttttctctcttttaacATTTGTAGCAATTTTC TGCAAAAAGTTGGTCCTATCAACGGCTCGAAGAAAGCTATATCGAAGACT GCGTTGGATGCAGCTACGGAGATCTTAGCGTATGATGAATCCGCTGACAG TAACTCACACGGCAAAATGACTGCAAAGACCTCTACGAAGGAGGGCAGCA CCAAACAAGAGATTGAGCACAGCCATGAAGATTTGGACGCACCGCTTTCC ACCGGAGCGATCAAACGAATGCTGGAACTGCTTTGTGATGAATCGGTAAG TTAGTATAATGTTTTCACTGCTGAACCTATTTCAGGAATCAAAAAATTTA CCCGAACCAAAAATTTCAACCAAACTCTTCAGTGGCACCTGTGGcattag ttttgttttcagtgGCTTTAAGTATTAAACCAGAATTCTAAAACAAGCAA CAAACTGAGTTCTGTATCAAAATGTTATGGACATTCGAAGTACCACCGAG TGTACTCCTAATCGGCAGCGAACGTGTTTATGTGGTCGTGCCTTAAAACA ACGTGTTGTGTTTGAATTTCAgattgattttcattttcacggTGACTTCC ATGCTAACTTTTTCGGCTAATCTCCGCTAATCTCCTCTGCAAAACTGCAG GTAGTATTCAGCAGCCTACTAGCCCAGGCAAAGGCTCACTTCAGTGCAAT ACCTGtaaaaaaactctttaaaaacTATTTCAATCTACAAGTTTTGATAC CTTGTCTGATGTCAATCTAGCTTTTTTTATAATTGACAGGGATTTCTTGT TGAAGCAAAGTTGATCAAACTGTTGGCACCCATTGAAAAAGATGAACAAT CGCTGATGAAGTTGGATGCCATCTTTAATGTAAGTTTCCATGGTAATGGT GccgtttttatttttgaaaagtggagTGTTGGCTTTTTCCCAGGTCATAA TCTTAAAAAATTTGTCTAGCTCCTTCAGTTTACGAAATACAACTCTGAAA ACAGCAAAGAGTTCATTTTTGTTTGCTATCTCCTGTTGTGATCTATTCTG AAAGTTTCAGCTTTTAAAATGATATATAGTCCCAACGATGAGAAGGAGTT AGCAGGCATATAAAAGATAATTCCGTATGCTAAAGTTGAATTCAATAAAC GATCCCGTGTAGTTTGCACGAATAATGTTAATGTACATACAATTAAttaa ttttgtatttgattGTGTCAATGTGAGAACTGCTATATGAAACCCTATCT TCTTTTACCAGGCCATCGGTATCGAGTCAGAAAGAGACATCGTATCACTC GGCAAGTATTTCTATAATCGTTATTTGGAGAAACTCGAACAACCCGAAGA CGAAGAGGAACAGAATGGAGAAGAGTCcttgaccaatgaaaacgctccAA TAACAGAAGGAGCCAATCAGGATCAAGATCAGGTTGACACGCCAACCAAT CAGAAACAAGAAGCTTGTGATTTAACCAATCAGGAGACGGCATCAAATGA AAGTTTAGAATCGATACCGATGGTTGTTCGACAAGAGCTCATTCATCCAA ACGAAGTTGTGAAATCTTTGAGAAAGTTTATTGACGATAATCGAGAACCA TTCAAGTAAGATTTAAGTTGATATGGCGTAGCACTCACGTGTATGATAAA AGTTTTTTGTAGGTATAATCCCGGTGACCAGGTAGCTCCTTCGCTTTGTT TTAACCGCTTTAAagagataatcagatggtttgtaatatttggcatgtgg gatCCTTCTATCGTCTCgaacaaaatctcaaaatatttttgcctacctta agggaagaaattttcgcgagaagaaattttcgcggaagaaattttcgcgg aattcaatttcgcgaatttgggcataattcgcgaaattaaattccgcgaa acacaccaaaattgttaaatcgcgaaattaaattccgcgaaattcgattt tttttcttNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNAAAATTAGCATCGAAAAAGCTTTGAAACGCTACACATAGCta caaacaaaatattaaaGTTACTCCAAAATTCGGTCAAAGAATCTAGAACA CTTCAAAACTAGGTGAGAATTAATCCTAGACATCCTGTATCTTTGCTTTA GGGACAGTCGCAAATCAAACACCGTCCGTATCGGTAGTTCATCAGGACGT GATAGCAGTTACGACGAACAATATTGGACGCAGCTAGCTTCGGTTATTGA TCTACAGAGAGAACGCCTGTGGGATGGGATGGTATCAGGATTTGAGAAAT ACAGTCAGATATTGAAAGAACGATCGACTCTCATTGGTGAAACTGATTCC CTTAGACAACAGGTATTTACTTTTAACTGAACTAGTTGACCCaggaaact tttttctttagacTTTAGATGAACTGAGTAACCCGCCCCGCCGGGTGTTA TGTGTCCACGTCGTTGTGTCCACATAACGTAAGAACAACGCTCAGACACT TTGTGTCCCAGGCcatcattttaattttaatataAATTGAATCTTTTAAT GGAAATAATTTTGCTCGCGTTTGCTTATTTTTTCGGTTCCAGGAAACCCC GAAAATGTAAAATTTGTCCGAAAAAAGTACGAAATTAGTGTCCGCAGAAT GTTGTATTGTTATAAAacttttcgaccgcgaaaattaattttcttcagtt atggttttttgaaaagCCTCCAACTTCAAATCAATAGTATAATTTTCTTT TAGAATTCCGAACTGCGAATGCTTTTACATCAGTACCTAAGCTCTAAGGT AAGTTAGCACTTTTATTTAGGGGGGATCGATTGAATTGCGGGTATAGGAT TTTATTAAGCAACAAGAATATGTTACTTTTTAATACAACTTCAATAATCA ATATTTTGCGATTGGCAATTTGTCACTCAAATCTTCTAATGGAATACTTG TGCATAACATTTCCAATGCATACCTATAATATTTTTAGAAACGTATGTTA TGAATTTTATGTTTCGAGCGCGTTACAATTTTCCGATCTGTACTTTAAAT AACCAGTGACCTTTAACCCGTGCTTCCCACTAACCGACAATTTATCACGA TTTTGTTTGCAGGTCAATCAAGAATTGGAGATTCCACCGACACGTGTTTT GCAAGTTGAAACTGGACATTCAAAGTAGTAGTGCTTTTTTGTTTTGGGCC TATAAAAAATAGTTTAAAGCAGATGATACTGCTTCAAAATTTAGCCAACC GGGCTAGCCCGCTTCCTTCAACAGCCGACACTTTAGATTATATTTTATGT ATTCATTGCATAGTTCCTTTTCCGATTGGTTTTGATGAGAGAAAATATCT CCGGGTAGATTCTAATCATTCTGCATGGTTCTGCCGTGTGATGATCTTGA AGTTAGGTGATCTGTGTTGAGATTTGCGACCCGTTCCAATCCTCTACTtt aaagattacgtcattaattgaatgatttgaaaaattgttgtttAGAGAAG TCAATGAGAGAGAAAACGTTTTTTTCCTGCTGACGTAAAATTAGTAAACG AAATTGATATCCTCTTTATTCGCTAAAATCTACATCAATCCACtacttca aaaaaataaaatgaagataaaaatgctgacatcagcaaaatgTCATCAAT TGTCAATCAAAATATTCCCTTTATGTCACCATCGCTATCACACTACTATT TTAGTTCAAAATTCCACATTCtttccttttcaaaatattgacttttaaaa aaatagatTCAAAAAAATCGGagaatttaatgttgacacaaAGTTTCATA GACGTGACATCTTCGTCGCAAAAAAACACATACTCTCTCgaactttagtt tttttttctttcttttgaacacaaaaaaaagttgaaacgtTATAACTGGA CTGGCTGCGAGTGTgtacaaaaaatactttttcgTTGGTATGGTTTGCGT gtgcttattatttttttaaacaagggTCAAATTGTAAGCTTTATTTTTAC TTATGTTTATCGCCACAATCTGTGGTTTTTATCTAGCACTCGCCGTTCCA TGGTATGCTAAATCTATTTGTAATGTCGCCCCATTTTGCTGTAGTGATGG ATTTGGGCTAAAATTCTGTACACAGCCCTTACATTGAATTTCCAAAGCTG TATTGCTCAAAGTTTTTTCATCTCCATGATGGCTTTTGTCCAAGACAAAA AAAGTATTTCCAAAAAAGTTCAATAGACACCACCAGACTATTTGCCTGAT TTTCAGCCCAAATTTTGCCCCTTTATGGCGCTAATAGCGAGTCGATTTTT GATATtacgtgattttgggaccctgtTAGAGACTCGATTGCTGTTTTATG CTTTTTGTaccccctttgagagactttcgagggtgtaaaaaaagttttgc caaag

Coding sequence (CDS) from alignment at sc0000001:1853832..1880636+

>TCONS_00000099 ID=TCONS_00000099|Name=TCONS_00000099|organism=Clytia hemisphaerica|type=CDS|length=41364bp|location=Sequence derived from alignment at sc0000001:1853832..1880636+ (Clytia hemisphaerica)
ATGGCGTCACAAATCAAAGATCTTGCCATGGATGAAGATATTGGACCCTC
CGTTGATTCACCATTGATCGAGGAACGCATTGCTGCAAGACGATTGAGGA
TAACAAGGCGTATGGAGGCTTTAAAAAAAGACACTCTTGGAGAAGATGTT
ACAGTCAAAGTTTCATCCGAACCAACTAAAGAATTATCCAAAAGCCGAAA
ACAAATTGAAGAGAGTTTCCAACAATTAGCAAAGTTGATCTCAGATGGTA
CAGAGTTGGTATCGAATATCGAGGTAGCGTGTGACTCGAGGGAAGCTACA
CTACGacaagaagaagatgaaaatgtcaGACAAAGaacacaaaaattgca
agaTGAAGTCAAAACAGCTGCTATCAAATTCGAACAGatcacCAAAAAAT
GGGAAGGTGCACTGAAGAAGGACGTCCCTCAACAATTAAAAGAAATGCTG
GAATCACAACGTGAACTATGTGACGAAATGATCGGTGAAAAAGACAACCT
GATTGATGAGCTGCAACaagatttaaaacaaaaagatgacCAGTATGTTA
AAGACCTAAGAAAACAGtcaGAAGATGCGGATCTCATGCTTGAACGAATG
GAagaacaaatcaaaacattgaatcgTGCTCATAAGAAAGAACTTGACAA
TGTTGAGAATGCTTTCTATTCCGAGCGGAGAGATGTACTGCAATCGCACA
AAAATAAAtgGACCAATCAGAGTGAACAACGGCGTCAGAAAGAACAAGAG
TATTTAGAATTACGTCAGAAACACGTGGAAAATTACGAGGAACAATTGAA
CACGTTGCGAGTTCAAGATGCAGAGGAGTATAACATGGTCAAAATCAAAC
TCGAAACTGACGTTCAGattttggagCAAAATCTTCAACAGATGAAAGCA
ACATACCAgttaaatcaagaaaaactcGAGTATAATTTTCAGGTGTTGAA
AAAGCGGGACGAAGAGAACACGATAACGAAATCACAACAGAAGCGTAAAA
TCACACGCCTCCAAGACCTTCtcaacaatttgaaatttaaactcaAGAAG
CAAGAACAACAGTACAAGGACGAGAACCAAGCTTTTTCAGATGATTTGAA
ACGAATGACTGAACAGTACAAGGAGctacaaaagaaatttagACATTTCC
AAACAACGGACAACAAGAAGTTTGTGGATATTTGGAAAATGAATGAAGAA
CAAACAAGAGAGTTGATCGAAGATTTGTTATCCGCTGATCGTATCATCTT
TGAACAGCAACTTGGTATGACGTGGCGTTCACCTGAAATCAATTTTCTGC
AAAAAGTTGGTCCTATCAACGGCTCGAAGAAAGCTATATCGAAGACTGCG
TTGGATGCAGCTACGGAGATCTTAGCGTATGATGAATCCGCTGACAGTAA
CTCACACGGCAAAATGACTGCAAAGACCTCTACGAAGGAGGGCAGCACCA
AACAAGAGATTGAGCACAGCCATGAAGATTTGGACGCACCGCTTTCCACC
GGAGCGATCAAACGAATGCTGGAACTGCTTTGTGATGAATCGGGATTTCT
TGTTGAAGCAAAGTTGATCAAACTGTTGGCACCCATTGAAAAAGATGAAC
AATCGCTGATGAAGTTGGATGCCATCTTTAATGCCATCGGTATCGAGTCA
GAAAGAGACATCGTATCACTCGGCAAGTATTTCTATAATCGTTATTTGGA
GAAACTCGAACAACCCGAAGACGAAGAGGAACAGAATGGAGAAGAGTCct
tgaccaatgaaaacgctccAATAACAGAAGGAGCCAATCAGGATCAAGAT
CAGGTTGACACGCCAACCAATCAGAAACAAGAAGCTTGTGATTTAACCAA
TCAGGAGACGGCATCAAATGAAAGTTTAGAATCGATACCGATGGTTGTTC
GACAAGAGCTCATTCATCCAAACGAAGTTGTGAAATCTTTGAGAAAGTTT
ATTGACGATAATCGAGAACCATTCAAGGACAGTCGCAAATCAAACACCGT
CCGTATCGGTAGTTCATCAGGACGTGATAGCAGTTACGACGAACAATATT
GGACGCAGCTAGCTTCGGTTATTGATCTACAGAGAGAACGCCTGTGGGAT
GGGATGGTATCAGGATTTGAGAAATACAGTCAGATATTGAAAGAACGATC
GACTCTCATTGGTGAAACTGATTCCCTTAGACAACAGAATTCCGAACTGC
GAATGCTTTTACATCAGTACCTAAGCTCTAAGGTCAATCAAGAATTGGAG
ATTCCACCGACACGTGTTTTGCAAGTTGAAACTGGACATTCAAAGTAGAT
GGCGTCACAAATCAAAGATCTTGCCATGGATGAAGATATTGGACCCTCCG
TTGATTCACCATTGATCGAGGAACGCATTGCTGCAAGACGATTGAGGATA
ACAAGGCGTATGGAGGCTTTAAAAAAAGACACTCTTGGAGAAGATGTTAC
AGTCAAAGTTTCATCCGAACCAACTAAAGAATTATCCAAAAGCCGAAAAC
AAATTGAAGAGAGTTTCCAACAATTAGCAAAGTTGATCTCAGATGGTACA
GAGTTGGTATCGAATATCGAGGTAGCGTGTGACTCGAGGGAAGCTACACT
ACGacaagaagaagatgaaaatgtcaGACAAAGaacacaaaaattgcaag
aTGAAGTCAAAACAGCTGCTATCAAATTCGAACAGatcacCAAAAAATGG
GAAGGTGCACTGAAGAAGGACGTCCCTCAACAATTAAAAGAAATGCTGGA
ATCACAACGTGAACTATGTGACGAAATGATCGGTGAAAAAGACAACCTGA
TTGATGAGCTGCAACaagatttaaaacaaaaagatgacCAGTATGTTAAA
GACCTAAGAAAACAGtcaGAAGATGCGGATCTCATGCTTGAACGAATGGA
agaacaaatcaaaacattgaatcgTGCTCATAAGAAAGAACTTGACAATG
TTGAGAATGCTTTCTATTCCGAGCGGAGAGATGTACTGCAATCGCACAAA
AATAAAtgGACCAATCAGAGTGAACAACGGCGTCAGAAAGAACAAGAGTA
TTTAGAATTACGTCAGAAACACGTGGAAAATTACGAGGAACAATTGAACA
CGTTGCGAGTTCAAGATGCAGAGGAGTATAACATGGTCAAAATCAAACTC
GAAACTGACGTTCAGattttggagCAAAATCTTCAACAGATGAAAGCAAC
ATACCAgttaaatcaagaaaaactcGAGTATAATTTTCAGGTGTTGAAAA
AGCGGGACGAAGAGAACACGATAACGAAATCACAACAGAAGCGTAAAATC
ACACGCCTCCAAGACCTTCtcaacaatttgaaatttaaactcaAGAAGCA
AGAACAACAGTACAAGGACGAGAACCAAGCTTTTTCAGATGATTTGAAAC
GAATGACTGAACAGTACAAGGAGctacaaaagaaatttagACATTTCCAA
ACAACGGACAACAAGAAGTTTGTGGATATTTGGAAAATGAATGAAGAACA
AACAAGAGAGTTGATCGAAGATTTGTTATCCGCTGATCGTATCATCTTTG
AACAGCAACTTGGTATGACGTGGCGTTCACCTGAAATCAATTTTCTGCAA
AAAGTTGGTCCTATCAACGGCTCGAAGAAAGCTATATCGAAGACTGCGTT
GGATGCAGCTACGGAGATCTTAGCGTATGATGAATCCGCTGACAGTAACT
CACACGGCAAAATGACTGCAAAGACCTCTACGAAGGAGGGCAGCACCAAA
CAAGAGATTGAGCACAGCCATGAAGATTTGGACGCACCGCTTTCCACCGG
AGCGATCAAACGAATGCTGGAACTGCTTTGTGATGAATCGGGATTTCTTG
TTGAAGCAAAGTTGATCAAACTGTTGGCACCCATTGAAAAAGATGAACAA
TCGCTGATGAAGTTGGATGCCATCTTTAATGCCATCGGTATCGAGTCAGA
AAGAGACATCGTATCACTCGGCAAGTATTTCTATAATCGTTATTTGGAGA
AACTCGAACAACCCGAAGACGAAGAGGAACAGAATGGAGAAGAGTCcttg
accaatgaaaacgctccAATAACAGAAGGAGCCAATCAGGATCAAGATCA
GGTTGACACGCCAACCAATCAGAAACAAGAAGCTTGTGATTTAACCAATC
AGGAGACGGCATCAAATGAAAGTTTAGAATCGATACCGATGGTTGTTCGA
CAAGAGCTCATTCATCCAAACGAAGTTGTGAAATCTTTGAGAAAGTTTAT
TGACGATAATCGAGAACCATTCAAGGACAGTCGCAAATCAAACACCGTCC
GTATCGGTAGTTCATCAGGACGTGATAGCAGTTACGACGAACAATATTGG
ACGCAGCTAGCTTCGGTTATTGATCTACAGAGAGAACGCCTGTGGGATGG
GATGGTATCAGGATTTGAGAAATACAGTCAGATATTGAAAGAACGATCGA
CTCTCATTGGTGAAACTGATTCCCTTAGACAACAGAATTCCGAACTGCGA
ATGCTTTTACATCAGTACCTAAGCTCTAAGGTCAATCAAGAATTGGAGAT
TCCACCGACACGTGTTTTGCAAGTTGAAACTGGACATTCAAAGTAGATGG
CGTCACAAATCAAAGATCTTGCCATGGATGAAGATATTGGACCCTCCGTT
GATTCACCATTGATCGAGGAACGCATTGCTGCAAGACGATTGAGGATAAC
AAGGCGTATGGAGGCTTTAAAAAAAGACACTCTTGGAGAAGATGTTACAG
TCAAAGTTTCATCCGAACCAACTAAAGAATTATCCAAAAGCCGAAAACAA
ATTGAAGAGAGTTTCCAACAATTAGCAAAGTTGATCTCAGATGGTACAGA
GTTGGTATCGAATATCGAGGTAGCGTGTGACTCGAGGGAAGCTACACTAC
GacaagaagaagatgaaaatgtcaGACAAAGaacacaaaaattgcaagaT
GAAGTCAAAACAGCTGCTATCAAATTCGAACAGatcacCAAAAAATGGGA
AGGTGCACTGAAGAAGGACGTCCCTCAACAATTAAAAGAAATGCTGGAAT
CACAACGTGAACTATGTGACGAAATGATCGGTGAAAAAGACAACCTGATT
GATGAGCTGCAACaagatttaaaacaaaaagatgacCAGTATGTTAAAGA
CCTAAGAAAACAGtcaGAAGATGCGGATCTCATGCTTGAACGAATGGAag
aacaaatcaaaacattgaatcgTGCTCATAAGAAAGAACTTGACAATGTT
GAGAATGCTTTCTATTCCGAGCGGAGAGATGTACTGCAATCGCACAAAAA
TAAAtgGACCAATCAGAGTGAACAACGGCGTCAGAAAGAACAAGAGTATT
TAGAATTACGTCAGAAACACGTGGAAAATTACGAGGAACAATTGAACACG
TTGCGAGTTCAAGATGCAGAGGAGTATAACATGGTCAAAATCAAACTCGA
AACTGACGTTCAGattttggagCAAAATCTTCAACAGATGAAAGCAACAT
ACCAgttaaatcaagaaaaactcGAGTATAATTTTCAGGTGTTGAAAAAG
CGGGACGAAGAGAACACGATAACGAAATCACAACAGAAGCGTAAAATCAC
ACGCCTCCAAGACCTTCtcaacaatttgaaatttaaactcaAGAAGCAAG
AACAACAGTACAAGGACGAGAACCAAGCTTTTTCAGATGATTTGAAACGA
ATGACTGAACAGTACAAGGAGctacaaaagaaatttagACATTTCCAAAC
AACGGACAACAAGAAGTTTGTGGATATTTGGAAAATGAATGAAGAACAAA
CAAGAGAGTTGATCGAAGATTTGTTATCCGCTGATCGTATCATCTTTGAA
CAGCAACTTGGTATGACGTGGCGTTCACCTGAAATCAATTTTCTGCAAAA
AGTTGGTCCTATCAACGGCTCGAAGAAAGCTATATCGAAGACTGCGTTGG
ATGCAGCTACGGAGATCTTAGCGTATGATGAATCCGCTGACAGTAACTCA
CACGGCAAAATGACTGCAAAGACCTCTACGAAGGAGGGCAGCACCAAACA
AGAGATTGAGCACAGCCATGAAGATTTGGACGCACCGCTTTCCACCGGAG
CGATCAAACGAATGCTGGAACTGCTTTGTGATGAATCGGGATTTCTTGTT
GAAGCAAAGTTGATCAAACTGTTGGCACCCATTGAAAAAGATGAACAATC
GCTGATGAAGTTGGATGCCATCTTTAATGCCATCGGTATCGAGTCAGAAA
GAGACATCGTATCACTCGGCAAGTATTTCTATAATCGTTATTTGGAGAAA
CTCGAACAACCCGAAGACGAAGAGGAACAGAATGGAGAAGAGTCcttgac
caatgaaaacgctccAATAACAGAAGGAGCCAATCAGGATCAAGATCAGG
TTGACACGCCAACCAATCAGAAACAAGAAGCTTGTGATTTAACCAATCAG
GAGACGGCATCAAATGAAAGTTTAGAATCGATACCGATGGTTGTTCGACA
AGAGCTCATTCATCCAAACGAAGTTGTGAAATCTTTGAGAAAGTTTATTG
ACGATAATCGAGAACCATTCAAGGACAGTCGCAAATCAAACACCGTCCGT
ATCGGTAGTTCATCAGGACGTGATAGCAGTTACGACGAACAATATTGGAC
GCAGCTAGCTTCGGTTATTGATCTACAGAGAGAACGCCTGTGGGATGGGA
TGGTATCAGGATTTGAGAAATACAGTCAGATATTGAAAGAACGATCGACT
CTCATTGGTGAAACTGATTCCCTTAGACAACAGAATTCCGAACTGCGAAT
GCTTTTACATCAGTACCTAAGCTCTAAGGTCAATCAAGAATTGGAGATTC
CACCGACACGTGTTTTGCAAGTTGAAACTGGACATTCAAAGTAGATGGCG
TCACAAATCAAAGATCTTGCCATGGATGAAGATATTGGACCCTCCGTTGA
TTCACCATTGATCGAGGAACGCATTGCTGCAAGACGATTGAGGATAACAA
GGCGTATGGAGGCTTTAAAAAAAGACACTCTTGGAGAAGATGTTACAGTC
AAAGTTTCATCCGAACCAACTAAAGAATTATCCAAAAGCCGAAAACAAAT
TGAAGAGAGTTTCCAACAATTAGCAAAGTTGATCTCAGATGGTACAGAGT
TGGTATCGAATATCGAGGTAGCGTGTGACTCGAGGGAAGCTACACTACGa
caagaagaagatgaaaatgtcaGACAAAGaacacaaaaattgcaagaTGA
AGTCAAAACAGCTGCTATCAAATTCGAACAGatcacCAAAAAATGGGAAG
GTGCACTGAAGAAGGACGTCCCTCAACAATTAAAAGAAATGCTGGAATCA
CAACGTGAACTATGTGACGAAATGATCGGTGAAAAAGACAACCTGATTGA
TGAGCTGCAACaagatttaaaacaaaaagatgacCAGTATGTTAAAGACC
TAAGAAAACAGtcaGAAGATGCGGATCTCATGCTTGAACGAATGGAagaa
caaatcaaaacattgaatcgTGCTCATAAGAAAGAACTTGACAATGTTGA
GAATGCTTTCTATTCCGAGCGGAGAGATGTACTGCAATCGCACAAAAATA
AAtgGACCAATCAGAGTGAACAACGGCGTCAGAAAGAACAAGAGTATTTA
GAATTACGTCAGAAACACGTGGAAAATTACGAGGAACAATTGAACACGTT
GCGAGTTCAAGATGCAGAGGAGTATAACATGGTCAAAATCAAACTCGAAA
CTGACGTTCAGattttggagCAAAATCTTCAACAGATGAAAGCAACATAC
CAgttaaatcaagaaaaactcGAGTATAATTTTCAGGTGTTGAAAAAGCG
GGACGAAGAGAACACGATAACGAAATCACAACAGAAGCGTAAAATCACAC
GCCTCCAAGACCTTCtcaacaatttgaaatttaaactcaAGAAGCAAGAA
CAACAGTACAAGGACGAGAACCAAGCTTTTTCAGATGATTTGAAACGAAT
GACTGAACAGTACAAGGAGctacaaaagaaatttagACATTTCCAAACAA
CGGACAACAAGAAGTTTGTGGATATTTGGAAAATGAATGAAGAACAAACA
AGAGAGTTGATCGAAGATTTGTTATCCGCTGATCGTATCATCTTTGAACA
GCAACTTGGTATGACGTGGCGTTCACCTGAAATCAATTTTCTGCAAAAAG
TTGGTCCTATCAACGGCTCGAAGAAAGCTATATCGAAGACTGCGTTGGAT
GCAGCTACGGAGATCTTAGCGTATGATGAATCCGCTGACAGTAACTCACA
CGGCAAAATGACTGCAAAGACCTCTACGAAGGAGGGCAGCACCAAACAAG
AGATTGAGCACAGCCATGAAGATTTGGACGCACCGCTTTCCACCGGAGCG
ATCAAACGAATGCTGGAACTGCTTTGTGATGAATCGGGATTTCTTGTTGA
AGCAAAGTTGATCAAACTGTTGGCACCCATTGAAAAAGATGAACAATCGC
TGATGAAGTTGGATGCCATCTTTAATGCCATCGGTATCGAGTCAGAAAGA
GACATCGTATCACTCGGCAAGTATTTCTATAATCGTTATTTGGAGAAACT
CGAACAACCCGAAGACGAAGAGGAACAGAATGGAGAAGAGTCcttgacca
atgaaaacgctccAATAACAGAAGGAGCCAATCAGGATCAAGATCAGGTT
GACACGCCAACCAATCAGAAACAAGAAGCTTGTGATTTAACCAATCAGGA
GACGGCATCAAATGAAAGTTTAGAATCGATACCGATGGTTGTTCGACAAG
AGCTCATTCATCCAAACGAAGTTGTGAAATCTTTGAGAAAGTTTATTGAC
GATAATCGAGAACCATTCAAGGACAGTCGCAAATCAAACACCGTCCGTAT
CGGTAGTTCATCAGGACGTGATAGCAGTTACGACGAACAATATTGGACGC
AGCTAGCTTCGGTTATTGATCTACAGAGAGAACGCCTGTGGGATGGGATG
GTATCAGGATTTGAGAAATACAGTCAGATATTGAAAGAACGATCGACTCT
CATTGGTGAAACTGATTCCCTTAGACAACAGAATTCCGAACTGCGAATGC
TTTTACATCAGTACCTAAGCTCTAAGGTCAATCAAGAATTGGAGATTCCA
CCGACACGTGTTTTGCAAGTTGAAACTGGACATTCAAAGTAGATGGCGTC
ACAAATCAAAGATCTTGCCATGGATGAAGATATTGGACCCTCCGTTGATT
CACCATTGATCGAGGAACGCATTGCTGCAAGACGATTGAGGATAACAAGG
CGTATGGAGGCTTTAAAAAAAGACACTCTTGGAGAAGATGTTACAGTCAA
AGTTTCATCCGAACCAACTAAAGAATTATCCAAAAGCCGAAAACAAATTG
AAGAGAGTTTCCAACAATTAGCAAAGTTGATCTCAGATGGTACAGAGTTG
GTATCGAATATCGAGGTAGCGTGTGACTCGAGGGAAGCTACACTACGaca
agaagaagatgaaaatgtcaGACAAAGaacacaaaaattgcaagaTGAAG
TCAAAACAGCTGCTATCAAATTCGAACAGatcacCAAAAAATGGGAAGGT
GCACTGAAGAAGGACGTCCCTCAACAATTAAAAGAAATGCTGGAATCACA
ACGTGAACTATGTGACGAAATGATCGGTGAAAAAGACAACCTGATTGATG
AGCTGCAACaagatttaaaacaaaaagatgacCAGTATGTTAAAGACCTA
AGAAAACAGtcaGAAGATGCGGATCTCATGCTTGAACGAATGGAagaaca
aatcaaaacattgaatcgTGCTCATAAGAAAGAACTTGACAATGTTGAGA
ATGCTTTCTATTCCGAGCGGAGAGATGTACTGCAATCGCACAAAAATAAA
tgGACCAATCAGAGTGAACAACGGCGTCAGAAAGAACAAGAGTATTTAGA
ATTACGTCAGAAACACGTGGAAAATTACGAGGAACAATTGAACACGTTGC
GAGTTCAAGATGCAGAGGAGTATAACATGGTCAAAATCAAACTCGAAACT
GACGTTCAGattttggagCAAAATCTTCAACAGATGAAAGCAACATACCA
gttaaatcaagaaaaactcGAGTATAATTTTCAGGTGTTGAAAAAGCGGG
ACGAAGAGAACACGATAACGAAATCACAACAGAAGCGTAAAATCACACGC
CTCCAAGACCTTCtcaacaatttgaaatttaaactcaAGAAGCAAGAACA
ACAGTACAAGGACGAGAACCAAGCTTTTTCAGATGATTTGAAACGAATGA
CTGAACAGTACAAGGAGctacaaaagaaatttagACATTTCCAAACAACG
GACAACAAGAAGTTTGTGGATATTTGGAAAATGAATGAAGAACAAACAAG
AGAGTTGATCGAAGATTTGTTATCCGCTGATCGTATCATCTTTGAACAGC
AACTTGGTATGACGTGGCGTTCACCTGAAATCAATTTTCTGCAAAAAGTT
GGTCCTATCAACGGCTCGAAGAAAGCTATATCGAAGACTGCGTTGGATGC
AGCTACGGAGATCTTAGCGTATGATGAATCCGCTGACAGTAACTCACACG
GCAAAATGACTGCAAAGACCTCTACGAAGGAGGGCAGCACCAAACAAGAG
ATTGAGCACAGCCATGAAGATTTGGACGCACCGCTTTCCACCGGAGCGAT
CAAACGAATGCTGGAACTGCTTTGTGATGAATCGGGATTTCTTGTTGAAG
CAAAGTTGATCAAACTGTTGGCACCCATTGAAAAAGATGAACAATCGCTG
ATGAAGTTGGATGCCATCTTTAATGCCATCGGTATCGAGTCAGAAAGAGA
CATCGTATCACTCGGCAAGTATTTCTATAATCGTTATTTGGAGAAACTCG
AACAACCCGAAGACGAAGAGGAACAGAATGGAGAAGAGTCcttgaccaat
gaaaacgctccAATAACAGAAGGAGCCAATCAGGATCAAGATCAGGTTGA
CACGCCAACCAATCAGAAACAAGAAGCTTGTGATTTAACCAATCAGGAGA
CGGCATCAAATGAAAGTTTAGAATCGATACCGATGGTTGTTCGACAAGAG
CTCATTCATCCAAACGAAGTTGTGAAATCTTTGAGAAAGTTTATTGACGA
TAATCGAGAACCATTCAAGGACAGTCGCAAATCAAACACCGTCCGTATCG
GTAGTTCATCAGGACGTGATAGCAGTTACGACGAACAATATTGGACGCAG
CTAGCTTCGGTTATTGATCTACAGAGAGAACGCCTGTGGGATGGGATGGT
ATCAGGATTTGAGAAATACAGTCAGATATTGAAAGAACGATCGACTCTCA
TTGGTGAAACTGATTCCCTTAGACAACAGAATTCCGAACTGCGAATGCTT
TTACATCAGTACCTAAGCTCTAAGGTCAATCAAGAATTGGAGATTCCACC
GACACGTGTTTTGCAAGTTGAAACTGGACATTCAAAGTAGATGGCGTCAC
AAATCAAAGATCTTGCCATGGATGAAGATATTGGACCCTCCGTTGATTCA
CCATTGATCGAGGAACGCATTGCTGCAAGACGATTGAGGATAACAAGGCG
TATGGAGGCTTTAAAAAAAGACACTCTTGGAGAAGATGTTACAGTCAAAG
TTTCATCCGAACCAACTAAAGAATTATCCAAAAGCCGAAAACAAATTGAA
GAGAGTTTCCAACAATTAGCAAAGTTGATCTCAGATGGTACAGAGTTGGT
ATCGAATATCGAGGTAGCGTGTGACTCGAGGGAAGCTACACTACGacaag
aagaagatgaaaatgtcaGACAAAGaacacaaaaattgcaagaTGAAGTC
AAAACAGCTGCTATCAAATTCGAACAGatcacCAAAAAATGGGAAGGTGC
ACTGAAGAAGGACGTCCCTCAACAATTAAAAGAAATGCTGGAATCACAAC
GTGAACTATGTGACGAAATGATCGGTGAAAAAGACAACCTGATTGATGAG
CTGCAACaagatttaaaacaaaaagatgacCAGTATGTTAAAGACCTAAG
AAAACAGtcaGAAGATGCGGATCTCATGCTTGAACGAATGGAagaacaaa
tcaaaacattgaatcgTGCTCATAAGAAAGAACTTGACAATGTTGAGAAT
GCTTTCTATTCCGAGCGGAGAGATGTACTGCAATCGCACAAAAATAAAtg
GACCAATCAGAGTGAACAACGGCGTCAGAAAGAACAAGAGTATTTAGAAT
TACGTCAGAAACACGTGGAAAATTACGAGGAACAATTGAACACGTTGCGA
GTTCAAGATGCAGAGGAGTATAACATGGTCAAAATCAAACTCGAAACTGA
CGTTCAGattttggagCAAAATCTTCAACAGATGAAAGCAACATACCAgt
taaatcaagaaaaactcGAGTATAATTTTCAGGTGTTGAAAAAGCGGGAC
GAAGAGAACACGATAACGAAATCACAACAGAAGCGTAAAATCACACGCCT
CCAAGACCTTCtcaacaatttgaaatttaaactcaAGAAGCAAGAACAAC
AGTACAAGGACGAGAACCAAGCTTTTTCAGATGATTTGAAACGAATGACT
GAACAGTACAAGGAGctacaaaagaaatttagACATTTCCAAACAACGGA
CAACAAGAAGTTTGTGGATATTTGGAAAATGAATGAAGAACAAACAAGAG
AGTTGATCGAAGATTTGTTATCCGCTGATCGTATCATCTTTGAACAGCAA
CTTGGTATGACGTGGCGTTCACCTGAAATCAATTTTCTGCAAAAAGTTGG
TCCTATCAACGGCTCGAAGAAAGCTATATCGAAGACTGCGTTGGATGCAG
CTACGGAGATCTTAGCGTATGATGAATCCGCTGACAGTAACTCACACGGC
AAAATGACTGCAAAGACCTCTACGAAGGAGGGCAGCACCAAACAAGAGAT
TGAGCACAGCCATGAAGATTTGGACGCACCGCTTTCCACCGGAGCGATCA
AACGAATGCTGGAACTGCTTTGTGATGAATCGGGATTTCTTGTTGAAGCA
AAGTTGATCAAACTGTTGGCACCCATTGAAAAAGATGAACAATCGCTGAT
GAAGTTGGATGCCATCTTTAATGCCATCGGTATCGAGTCAGAAAGAGACA
TCGTATCACTCGGCAAGTATTTCTATAATCGTTATTTGGAGAAACTCGAA
CAACCCGAAGACGAAGAGGAACAGAATGGAGAAGAGTCcttgaccaatga
aaacgctccAATAACAGAAGGAGCCAATCAGGATCAAGATCAGGTTGACA
CGCCAACCAATCAGAAACAAGAAGCTTGTGATTTAACCAATCAGGAGACG
GCATCAAATGAAAGTTTAGAATCGATACCGATGGTTGTTCGACAAGAGCT
CATTCATCCAAACGAAGTTGTGAAATCTTTGAGAAAGTTTATTGACGATA
ATCGAGAACCATTCAAGGACAGTCGCAAATCAAACACCGTCCGTATCGGT
AGTTCATCAGGACGTGATAGCAGTTACGACGAACAATATTGGACGCAGCT
AGCTTCGGTTATTGATCTACAGAGAGAACGCCTGTGGGATGGGATGGTAT
CAGGATTTGAGAAATACAGTCAGATATTGAAAGAACGATCGACTCTCATT
GGTGAAACTGATTCCCTTAGACAACAGAATTCCGAACTGCGAATGCTTTT
ACATCAGTACCTAAGCTCTAAGGTCAATCAAGAATTGGAGATTCCACCGA
CACGTGTTTTGCAAGTTGAAACTGGACATTCAAAGTAGATGGCGTCACAA
ATCAAAGATCTTGCCATGGATGAAGATATTGGACCCTCCGTTGATTCACC
ATTGATCGAGGAACGCATTGCTGCAAGACGATTGAGGATAACAAGGCGTA
TGGAGGCTTTAAAAAAAGACACTCTTGGAGAAGATGTTACAGTCAAAGTT
TCATCCGAACCAACTAAAGAATTATCCAAAAGCCGAAAACAAATTGAAGA
GAGTTTCCAACAATTAGCAAAGTTGATCTCAGATGGTACAGAGTTGGTAT
CGAATATCGAGGTAGCGTGTGACTCGAGGGAAGCTACACTACGacaagaa
gaagatgaaaatgtcaGACAAAGaacacaaaaattgcaagaTGAAGTCAA
AACAGCTGCTATCAAATTCGAACAGatcacCAAAAAATGGGAAGGTGCAC
TGAAGAAGGACGTCCCTCAACAATTAAAAGAAATGCTGGAATCACAACGT
GAACTATGTGACGAAATGATCGGTGAAAAAGACAACCTGATTGATGAGCT
GCAACaagatttaaaacaaaaagatgacCAGTATGTTAAAGACCTAAGAA
AACAGtcaGAAGATGCGGATCTCATGCTTGAACGAATGGAagaacaaatc
aaaacattgaatcgTGCTCATAAGAAAGAACTTGACAATGTTGAGAATGC
TTTCTATTCCGAGCGGAGAGATGTACTGCAATCGCACAAAAATAAAtgGA
CCAATCAGAGTGAACAACGGCGTCAGAAAGAACAAGAGTATTTAGAATTA
CGTCAGAAACACGTGGAAAATTACGAGGAACAATTGAACACGTTGCGAGT
TCAAGATGCAGAGGAGTATAACATGGTCAAAATCAAACTCGAAACTGACG
TTCAGattttggagCAAAATCTTCAACAGATGAAAGCAACATACCAgtta
aatcaagaaaaactcGAGTATAATTTTCAGGTGTTGAAAAAGCGGGACGA
AGAGAACACGATAACGAAATCACAACAGAAGCGTAAAATCACACGCCTCC
AAGACCTTCtcaacaatttgaaatttaaactcaAGAAGCAAGAACAACAG
TACAAGGACGAGAACCAAGCTTTTTCAGATGATTTGAAACGAATGACTGA
ACAGTACAAGGAGctacaaaagaaatttagACATTTCCAAACAACGGACA
ACAAGAAGTTTGTGGATATTTGGAAAATGAATGAAGAACAAACAAGAGAG
TTGATCGAAGATTTGTTATCCGCTGATCGTATCATCTTTGAACAGCAACT
TGGTATGACGTGGCGTTCACCTGAAATCAATTTTCTGCAAAAAGTTGGTC
CTATCAACGGCTCGAAGAAAGCTATATCGAAGACTGCGTTGGATGCAGCT
ACGGAGATCTTAGCGTATGATGAATCCGCTGACAGTAACTCACACGGCAA
AATGACTGCAAAGACCTCTACGAAGGAGGGCAGCACCAAACAAGAGATTG
AGCACAGCCATGAAGATTTGGACGCACCGCTTTCCACCGGAGCGATCAAA
CGAATGCTGGAACTGCTTTGTGATGAATCGGGATTTCTTGTTGAAGCAAA
GTTGATCAAACTGTTGGCACCCATTGAAAAAGATGAACAATCGCTGATGA
AGTTGGATGCCATCTTTAATGCCATCGGTATCGAGTCAGAAAGAGACATC
GTATCACTCGGCAAGTATTTCTATAATCGTTATTTGGAGAAACTCGAACA
ACCCGAAGACGAAGAGGAACAGAATGGAGAAGAGTCcttgaccaatgaaa
acgctccAATAACAGAAGGAGCCAATCAGGATCAAGATCAGGTTGACACG
CCAACCAATCAGAAACAAGAAGCTTGTGATTTAACCAATCAGGAGACGGC
ATCAAATGAAAGTTTAGAATCGATACCGATGGTTGTTCGACAAGAGCTCA
TTCATCCAAACGAAGTTGTGAAATCTTTGAGAAAGTTTATTGACGATAAT
CGAGAACCATTCAAGGACAGTCGCAAATCAAACACCGTCCGTATCGGTAG
TTCATCAGGACGTGATAGCAGTTACGACGAACAATATTGGACGCAGCTAG
CTTCGGTTATTGATCTACAGAGAGAACGCCTGTGGGATGGGATGGTATCA
GGATTTGAGAAATACAGTCAGATATTGAAAGAACGATCGACTCTCATTGG
TGAAACTGATTCCCTTAGACAACAGAATTCCGAACTGCGAATGCTTTTAC
ATCAGTACCTAAGCTCTAAGGTCAATCAAGAATTGGAGATTCCACCGACA
CGTGTTTTGCAAGTTGAAACTGGACATTCAAAGTAGATGGCGTCACAAAT
CAAAGATCTTGCCATGGATGAAGATATTGGACCCTCCGTTGATTCACCAT
TGATCGAGGAACGCATTGCTGCAAGACGATTGAGGATAACAAGGCGTATG
GAGGCTTTAAAAAAAGACACTCTTGGAGAAGATGTTACAGTCAAAGTTTC
ATCCGAACCAACTAAAGAATTATCCAAAAGCCGAAAACAAATTGAAGAGA
GTTTCCAACAATTAGCAAAGTTGATCTCAGATGGTACAGAGTTGGTATCG
AATATCGAGGTAGCGTGTGACTCGAGGGAAGCTACACTACGacaagaaga
agatgaaaatgtcaGACAAAGaacacaaaaattgcaagaTGAAGTCAAAA
CAGCTGCTATCAAATTCGAACAGatcacCAAAAAATGGGAAGGTGCACTG
AAGAAGGACGTCCCTCAACAATTAAAAGAAATGCTGGAATCACAACGTGA
ACTATGTGACGAAATGATCGGTGAAAAAGACAACCTGATTGATGAGCTGC
AACaagatttaaaacaaaaagatgacCAGTATGTTAAAGACCTAAGAAAA
CAGtcaGAAGATGCGGATCTCATGCTTGAACGAATGGAagaacaaatcaa
aacattgaatcgTGCTCATAAGAAAGAACTTGACAATGTTGAGAATGCTT
TCTATTCCGAGCGGAGAGATGTACTGCAATCGCACAAAAATAAAtgGACC
AATCAGAGTGAACAACGGCGTCAGAAAGAACAAGAGTATTTAGAATTACG
TCAGAAACACGTGGAAAATTACGAGGAACAATTGAACACGTTGCGAGTTC
AAGATGCAGAGGAGTATAACATGGTCAAAATCAAACTCGAAACTGACGTT
CAGattttggagCAAAATCTTCAACAGATGAAAGCAACATACCAgttaaa
tcaagaaaaactcGAGTATAATTTTCAGGTGTTGAAAAAGCGGGACGAAG
AGAACACGATAACGAAATCACAACAGAAGCGTAAAATCACACGCCTCCAA
GACCTTCtcaacaatttgaaatttaaactcaAGAAGCAAGAACAACAGTA
CAAGGACGAGAACCAAGCTTTTTCAGATGATTTGAAACGAATGACTGAAC
AGTACAAGGAGctacaaaagaaatttagACATTTCCAAACAACGGACAAC
AAGAAGTTTGTGGATATTTGGAAAATGAATGAAGAACAAACAAGAGAGTT
GATCGAAGATTTGTTATCCGCTGATCGTATCATCTTTGAACAGCAACTTG
GTATGACGTGGCGTTCACCTGAAATCAATTTTCTGCAAAAAGTTGGTCCT
ATCAACGGCTCGAAGAAAGCTATATCGAAGACTGCGTTGGATGCAGCTAC
GGAGATCTTAGCGTATGATGAATCCGCTGACAGTAACTCACACGGCAAAA
TGACTGCAAAGACCTCTACGAAGGAGGGCAGCACCAAACAAGAGATTGAG
CACAGCCATGAAGATTTGGACGCACCGCTTTCCACCGGAGCGATCAAACG
AATGCTGGAACTGCTTTGTGATGAATCGGGATTTCTTGTTGAAGCAAAGT
TGATCAAACTGTTGGCACCCATTGAAAAAGATGAACAATCGCTGATGAAG
TTGGATGCCATCTTTAATGCCATCGGTATCGAGTCAGAAAGAGACATCGT
ATCACTCGGCAAGTATTTCTATAATCGTTATTTGGAGAAACTCGAACAAC
CCGAAGACGAAGAGGAACAGAATGGAGAAGAGTCcttgaccaatgaaaac
gctccAATAACAGAAGGAGCCAATCAGGATCAAGATCAGGTTGACACGCC
AACCAATCAGAAACAAGAAGCTTGTGATTTAACCAATCAGGAGACGGCAT
CAAATGAAAGTTTAGAATCGATACCGATGGTTGTTCGACAAGAGCTCATT
CATCCAAACGAAGTTGTGAAATCTTTGAGAAAGTTTATTGACGATAATCG
AGAACCATTCAAGGACAGTCGCAAATCAAACACCGTCCGTATCGGTAGTT
CATCAGGACGTGATAGCAGTTACGACGAACAATATTGGACGCAGCTAGCT
TCGGTTATTGATCTACAGAGAGAACGCCTGTGGGATGGGATGGTATCAGG
ATTTGAGAAATACAGTCAGATATTGAAAGAACGATCGACTCTCATTGGTG
AAACTGATTCCCTTAGACAACAGAATTCCGAACTGCGAATGCTTTTACAT
CAGTACCTAAGCTCTAAGGTCAATCAAGAATTGGAGATTCCACCGACACG
TGTTTTGCAAGTTGAAACTGGACATTCAAAGTAGATGGCGTCACAAATCA
AAGATCTTGCCATGGATGAAGATATTGGACCCTCCGTTGATTCACCATTG
ATCGAGGAACGCATTGCTGCAAGACGATTGAGGATAACAAGGCGTATGGA
GGCTTTAAAAAAAGACACTCTTGGAGAAGATGTTACAGTCAAAGTTTCAT
CCGAACCAACTAAAGAATTATCCAAAAGCCGAAAACAAATTGAAGAGAGT
TTCCAACAATTAGCAAAGTTGATCTCAGATGGTACAGAGTTGGTATCGAA
TATCGAGGTAGCGTGTGACTCGAGGGAAGCTACACTACGacaagaagaag
atgaaaatgtcaGACAAAGaacacaaaaattgcaagaTGAAGTCAAAACA
GCTGCTATCAAATTCGAACAGatcacCAAAAAATGGGAAGGTGCACTGAA
GAAGGACGTCCCTCAACAATTAAAAGAAATGCTGGAATCACAACGTGAAC
TATGTGACGAAATGATCGGTGAAAAAGACAACCTGATTGATGAGCTGCAA
CaagatttaaaacaaaaagatgacCAGTATGTTAAAGACCTAAGAAAACA
GtcaGAAGATGCGGATCTCATGCTTGAACGAATGGAagaacaaatcaaaa
cattgaatcgTGCTCATAAGAAAGAACTTGACAATGTTGAGAATGCTTTC
TATTCCGAGCGGAGAGATGTACTGCAATCGCACAAAAATAAAtgGACCAA
TCAGAGTGAACAACGGCGTCAGAAAGAACAAGAGTATTTAGAATTACGTC
AGAAACACGTGGAAAATTACGAGGAACAATTGAACACGTTGCGAGTTCAA
GATGCAGAGGAGTATAACATGGTCAAAATCAAACTCGAAACTGACGTTCA
GattttggagCAAAATCTTCAACAGATGAAAGCAACATACCAgttaaatc
aagaaaaactcGAGTATAATTTTCAGGTGTTGAAAAAGCGGGACGAAGAG
AACACGATAACGAAATCACAACAGAAGCGTAAAATCACACGCCTCCAAGA
CCTTCtcaacaatttgaaatttaaactcaAGAAGCAAGAACAACAGTACA
AGGACGAGAACCAAGCTTTTTCAGATGATTTGAAACGAATGACTGAACAG
TACAAGGAGctacaaaagaaatttagACATTTCCAAACAACGGACAACAA
GAAGTTTGTGGATATTTGGAAAATGAATGAAGAACAAACAAGAGAGTTGA
TCGAAGATTTGTTATCCGCTGATCGTATCATCTTTGAACAGCAACTTGGT
ATGACGTGGCGTTCACCTGAAATCAATTTTCTGCAAAAAGTTGGTCCTAT
CAACGGCTCGAAGAAAGCTATATCGAAGACTGCGTTGGATGCAGCTACGG
AGATCTTAGCGTATGATGAATCCGCTGACAGTAACTCACACGGCAAAATG
ACTGCAAAGACCTCTACGAAGGAGGGCAGCACCAAACAAGAGATTGAGCA
CAGCCATGAAGATTTGGACGCACCGCTTTCCACCGGAGCGATCAAACGAA
TGCTGGAACTGCTTTGTGATGAATCGGGATTTCTTGTTGAAGCAAAGTTG
ATCAAACTGTTGGCACCCATTGAAAAAGATGAACAATCGCTGATGAAGTT
GGATGCCATCTTTAATGCCATCGGTATCGAGTCAGAAAGAGACATCGTAT
CACTCGGCAAGTATTTCTATAATCGTTATTTGGAGAAACTCGAACAACCC
GAAGACGAAGAGGAACAGAATGGAGAAGAGTCcttgaccaatgaaaacgc
tccAATAACAGAAGGAGCCAATCAGGATCAAGATCAGGTTGACACGCCAA
CCAATCAGAAACAAGAAGCTTGTGATTTAACCAATCAGGAGACGGCATCA
AATGAAAGTTTAGAATCGATACCGATGGTTGTTCGACAAGAGCTCATTCA
TCCAAACGAAGTTGTGAAATCTTTGAGAAAGTTTATTGACGATAATCGAG
AACCATTCAAGGACAGTCGCAAATCAAACACCGTCCGTATCGGTAGTTCA
TCAGGACGTGATAGCAGTTACGACGAACAATATTGGACGCAGCTAGCTTC
GGTTATTGATCTACAGAGAGAACGCCTGTGGGATGGGATGGTATCAGGAT
TTGAGAAATACAGTCAGATATTGAAAGAACGATCGACTCTCATTGGTGAA
ACTGATTCCCTTAGACAACAGAATTCCGAACTGCGAATGCTTTTACATCA
GTACCTAAGCTCTAAGGTCAATCAAGAATTGGAGATTCCACCGACACGTG
TTTTGCAAGTTGAAACTGGACATTCAAAGTAGATGGCGTCACAAATCAAA
GATCTTGCCATGGATGAAGATATTGGACCCTCCGTTGATTCACCATTGAT
CGAGGAACGCATTGCTGCAAGACGATTGAGGATAACAAGGCGTATGGAGG
CTTTAAAAAAAGACACTCTTGGAGAAGATGTTACAGTCAAAGTTTCATCC
GAACCAACTAAAGAATTATCCAAAAGCCGAAAACAAATTGAAGAGAGTTT
CCAACAATTAGCAAAGTTGATCTCAGATGGTACAGAGTTGGTATCGAATA
TCGAGGTAGCGTGTGACTCGAGGGAAGCTACACTACGacaagaagaagat
gaaaatgtcaGACAAAGaacacaaaaattgcaagaTGAAGTCAAAACAGC
TGCTATCAAATTCGAACAGatcacCAAAAAATGGGAAGGTGCACTGAAGA
AGGACGTCCCTCAACAATTAAAAGAAATGCTGGAATCACAACGTGAACTA
TGTGACGAAATGATCGGTGAAAAAGACAACCTGATTGATGAGCTGCAACa
agatttaaaacaaaaagatgacCAGTATGTTAAAGACCTAAGAAAACAGt
caGAAGATGCGGATCTCATGCTTGAACGAATGGAagaacaaatcaaaaca
ttgaatcgTGCTCATAAGAAAGAACTTGACAATGTTGAGAATGCTTTCTA
TTCCGAGCGGAGAGATGTACTGCAATCGCACAAAAATAAAtgGACCAATC
AGAGTGAACAACGGCGTCAGAAAGAACAAGAGTATTTAGAATTACGTCAG
AAACACGTGGAAAATTACGAGGAACAATTGAACACGTTGCGAGTTCAAGA
TGCAGAGGAGTATAACATGGTCAAAATCAAACTCGAAACTGACGTTCAGa
ttttggagCAAAATCTTCAACAGATGAAAGCAACATACCAgttaaatcaa
gaaaaactcGAGTATAATTTTCAGGTGTTGAAAAAGCGGGACGAAGAGAA
CACGATAACGAAATCACAACAGAAGCGTAAAATCACACGCCTCCAAGACC
TTCtcaacaatttgaaatttaaactcaAGAAGCAAGAACAACAGTACAAG
GACGAGAACCAAGCTTTTTCAGATGATTTGAAACGAATGACTGAACAGTA
CAAGGAGctacaaaagaaatttagACATTTCCAAACAACGGACAACAAGA
AGTTTGTGGATATTTGGAAAATGAATGAAGAACAAACAAGAGAGTTGATC
GAAGATTTGTTATCCGCTGATCGTATCATCTTTGAACAGCAACTTGGTAT
GACGTGGCGTTCACCTGAAATCAATTTTCTGCAAAAAGTTGGTCCTATCA
ACGGCTCGAAGAAAGCTATATCGAAGACTGCGTTGGATGCAGCTACGGAG
ATCTTAGCGTATGATGAATCCGCTGACAGTAACTCACACGGCAAAATGAC
TGCAAAGACCTCTACGAAGGAGGGCAGCACCAAACAAGAGATTGAGCACA
GCCATGAAGATTTGGACGCACCGCTTTCCACCGGAGCGATCAAACGAATG
CTGGAACTGCTTTGTGATGAATCGGGATTTCTTGTTGAAGCAAAGTTGAT
CAAACTGTTGGCACCCATTGAAAAAGATGAACAATCGCTGATGAAGTTGG
ATGCCATCTTTAATGCCATCGGTATCGAGTCAGAAAGAGACATCGTATCA
CTCGGCAAGTATTTCTATAATCGTTATTTGGAGAAACTCGAACAACCCGA
AGACGAAGAGGAACAGAATGGAGAAGAGTCcttgaccaatgaaaacgctc
cAATAACAGAAGGAGCCAATCAGGATCAAGATCAGGTTGACACGCCAACC
AATCAGAAACAAGAAGCTTGTGATTTAACCAATCAGGAGACGGCATCAAA
TGAAAGTTTAGAATCGATACCGATGGTTGTTCGACAAGAGCTCATTCATC
CAAACGAAGTTGTGAAATCTTTGAGAAAGTTTATTGACGATAATCGAGAA
CCATTCAAGGACAGTCGCAAATCAAACACCGTCCGTATCGGTAGTTCATC
AGGACGTGATAGCAGTTACGACGAACAATATTGGACGCAGCTAGCTTCGG
TTATTGATCTACAGAGAGAACGCCTGTGGGATGGGATGGTATCAGGATTT
GAGAAATACAGTCAGATATTGAAAGAACGATCGACTCTCATTGGTGAAAC
TGATTCCCTTAGACAACAGAATTCCGAACTGCGAATGCTTTTACATCAGT
ACCTAAGCTCTAAGGTCAATCAAGAATTGGAGATTCCACCGACACGTGTT
TTGCAAGTTGAAACTGGACATTCAAAGTAGATGGCGTCACAAATCAAAGA
TCTTGCCATGGATGAAGATATTGGACCCTCCGTTGATTCACCATTGATCG
AGGAACGCATTGCTGCAAGACGATTGAGGATAACAAGGCGTATGGAGGCT
TTAAAAAAAGACACTCTTGGAGAAGATGTTACAGTCAAAGTTTCATCCGA
ACCAACTAAAGAATTATCCAAAAGCCGAAAACAAATTGAAGAGAGTTTCC
AACAATTAGCAAAGTTGATCTCAGATGGTACAGAGTTGGTATCGAATATC
GAGGTAGCGTGTGACTCGAGGGAAGCTACACTACGacaagaagaagatga
aaatgtcaGACAAAGaacacaaaaattgcaagaTGAAGTCAAAACAGCTG
CTATCAAATTCGAACAGatcacCAAAAAATGGGAAGGTGCACTGAAGAAG
GACGTCCCTCAACAATTAAAAGAAATGCTGGAATCACAACGTGAACTATG
TGACGAAATGATCGGTGAAAAAGACAACCTGATTGATGAGCTGCAACaag
atttaaaacaaaaagatgacCAGTATGTTAAAGACCTAAGAAAACAGtca
GAAGATGCGGATCTCATGCTTGAACGAATGGAagaacaaatcaaaacatt
gaatcgTGCTCATAAGAAAGAACTTGACAATGTTGAGAATGCTTTCTATT
CCGAGCGGAGAGATGTACTGCAATCGCACAAAAATAAAtgGACCAATCAG
AGTGAACAACGGCGTCAGAAAGAACAAGAGTATTTAGAATTACGTCAGAA
ACACGTGGAAAATTACGAGGAACAATTGAACACGTTGCGAGTTCAAGATG
CAGAGGAGTATAACATGGTCAAAATCAAACTCGAAACTGACGTTCAGatt
ttggagCAAAATCTTCAACAGATGAAAGCAACATACCAgttaaatcaaga
aaaactcGAGTATAATTTTCAGGTGTTGAAAAAGCGGGACGAAGAGAACA
CGATAACGAAATCACAACAGAAGCGTAAAATCACACGCCTCCAAGACCTT
CtcaacaatttgaaatttaaactcaAGAAGCAAGAACAACAGTACAAGGA
CGAGAACCAAGCTTTTTCAGATGATTTGAAACGAATGACTGAACAGTACA
AGGAGctacaaaagaaatttagACATTTCCAAACAACGGACAACAAGAAG
TTTGTGGATATTTGGAAAATGAATGAAGAACAAACAAGAGAGTTGATCGA
AGATTTGTTATCCGCTGATCGTATCATCTTTGAACAGCAACTTGGTATGA
CGTGGCGTTCACCTGAAATCAATTTTCTGCAAAAAGTTGGTCCTATCAAC
GGCTCGAAGAAAGCTATATCGAAGACTGCGTTGGATGCAGCTACGGAGAT
CTTAGCGTATGATGAATCCGCTGACAGTAACTCACACGGCAAAATGACTG
CAAAGACCTCTACGAAGGAGGGCAGCACCAAACAAGAGATTGAGCACAGC
CATGAAGATTTGGACGCACCGCTTTCCACCGGAGCGATCAAACGAATGCT
GGAACTGCTTTGTGATGAATCGGGATTTCTTGTTGAAGCAAAGTTGATCA
AACTGTTGGCACCCATTGAAAAAGATGAACAATCGCTGATGAAGTTGGAT
GCCATCTTTAATGCCATCGGTATCGAGTCAGAAAGAGACATCGTATCACT
CGGCAAGTATTTCTATAATCGTTATTTGGAGAAACTCGAACAACCCGAAG
ACGAAGAGGAACAGAATGGAGAAGAGTCcttgaccaatgaaaacgctccA
ATAACAGAAGGAGCCAATCAGGATCAAGATCAGGTTGACACGCCAACCAA
TCAGAAACAAGAAGCTTGTGATTTAACCAATCAGGAGACGGCATCAAATG
AAAGTTTAGAATCGATACCGATGGTTGTTCGACAAGAGCTCATTCATCCA
AACGAAGTTGTGAAATCTTTGAGAAAGTTTATTGACGATAATCGAGAACC
ATTCAAGGACAGTCGCAAATCAAACACCGTCCGTATCGGTAGTTCATCAG
GACGTGATAGCAGTTACGACGAACAATATTGGACGCAGCTAGCTTCGGTT
ATTGATCTACAGAGAGAACGCCTGTGGGATGGGATGGTATCAGGATTTGA
GAAATACAGTCAGATATTGAAAGAACGATCGACTCTCATTGGTGAAACTG
ATTCCCTTAGACAACAGAATTCCGAACTGCGAATGCTTTTACATCAGTAC
CTAAGCTCTAAGGTCAATCAAGAATTGGAGATTCCACCGACACGTGTTTT
GCAAGTTGAAACTGGACATTCAAAGTAGATGGCGTCACAAATCAAAGATC
TTGCCATGGATGAAGATATTGGACCCTCCGTTGATTCACCATTGATCGAG
GAACGCATTGCTGCAAGACGATTGAGGATAACAAGGCGTATGGAGGCTTT
AAAAAAAGACACTCTTGGAGAAGATGTTACAGTCAAAGTTTCATCCGAAC
CAACTAAAGAATTATCCAAAAGCCGAAAACAAATTGAAGAGAGTTTCCAA
CAATTAGCAAAGTTGATCTCAGATGGTACAGAGTTGGTATCGAATATCGA
GGTAGCGTGTGACTCGAGGGAAGCTACACTACGacaagaagaagatgaaa
atgtcaGACAAAGaacacaaaaattgcaagaTGAAGTCAAAACAGCTGCT
ATCAAATTCGAACAGatcacCAAAAAATGGGAAGGTGCACTGAAGAAGGA
CGTCCCTCAACAATTAAAAGAAATGCTGGAATCACAACGTGAACTATGTG
ACGAAATGATCGGTGAAAAAGACAACCTGATTGATGAGCTGCAACaagat
ttaaaacaaaaagatgacCAGTATGTTAAAGACCTAAGAAAACAGtcaGA
AGATGCGGATCTCATGCTTGAACGAATGGAagaacaaatcaaaacattga
atcgTGCTCATAAGAAAGAACTTGACAATGTTGAGAATGCTTTCTATTCC
GAGCGGAGAGATGTACTGCAATCGCACAAAAATAAAtgGACCAATCAGAG
TGAACAACGGCGTCAGAAAGAACAAGAGTATTTAGAATTACGTCAGAAAC
ACGTGGAAAATTACGAGGAACAATTGAACACGTTGCGAGTTCAAGATGCA
GAGGAGTATAACATGGTCAAAATCAAACTCGAAACTGACGTTCAGatttt
ggagCAAAATCTTCAACAGATGAAAGCAACATACCAgttaaatcaagaaa
aactcGAGTATAATTTTCAGGTGTTGAAAAAGCGGGACGAAGAGAACACG
ATAACGAAATCACAACAGAAGCGTAAAATCACACGCCTCCAAGACCTTCt
caacaatttgaaatttaaactcaAGAAGCAAGAACAACAGTACAAGGACG
AGAACCAAGCTTTTTCAGATGATTTGAAACGAATGACTGAACAGTACAAG
GAGctacaaaagaaatttagACATTTCCAAACAACGGACAACAAGAAGTT
TGTGGATATTTGGAAAATGAATGAAGAACAAACAAGAGAGTTGATCGAAG
ATTTGTTATCCGCTGATCGTATCATCTTTGAACAGCAACTTGGTATGACG
TGGCGTTCACCTGAAATCAATTTTCTGCAAAAAGTTGGTCCTATCAACGG
CTCGAAGAAAGCTATATCGAAGACTGCGTTGGATGCAGCTACGGAGATCT
TAGCGTATGATGAATCCGCTGACAGTAACTCACACGGCAAAATGACTGCA
AAGACCTCTACGAAGGAGGGCAGCACCAAACAAGAGATTGAGCACAGCCA
TGAAGATTTGGACGCACCGCTTTCCACCGGAGCGATCAAACGAATGCTGG
AACTGCTTTGTGATGAATCGGGATTTCTTGTTGAAGCAAAGTTGATCAAA
CTGTTGGCACCCATTGAAAAAGATGAACAATCGCTGATGAAGTTGGATGC
CATCTTTAATGCCATCGGTATCGAGTCAGAAAGAGACATCGTATCACTCG
GCAAGTATTTCTATAATCGTTATTTGGAGAAACTCGAACAACCCGAAGAC
GAAGAGGAACAGAATGGAGAAGAGTCcttgaccaatgaaaacgctccAAT
AACAGAAGGAGCCAATCAGGATCAAGATCAGGTTGACACGCCAACCAATC
AGAAACAAGAAGCTTGTGATTTAACCAATCAGGAGACGGCATCAAATGAA
AGTTTAGAATCGATACCGATGGTTGTTCGACAAGAGCTCATTCATCCAAA
CGAAGTTGTGAAATCTTTGAGAAAGTTTATTGACGATAATCGAGAACCAT
TCAAGGACAGTCGCAAATCAAACACCGTCCGTATCGGTAGTTCATCAGGA
CGTGATAGCAGTTACGACGAACAATATTGGACGCAGCTAGCTTCGGTTAT
TGATCTACAGAGAGAACGCCTGTGGGATGGGATGGTATCAGGATTTGAGA
AATACAGTCAGATATTGAAAGAACGATCGACTCTCATTGGTGAAACTGAT
TCCCTTAGACAACAGAATTCCGAACTGCGAATGCTTTTACATCAGTACCT
AAGCTCTAAGGTCAATCAAGAATTGGAGATTCCACCGACACGTGTTTTGC
AAGTTGAAACTGGACATTCAAAGTAGATGGCGTCACAAATCAAAGATCTT
GCCATGGATGAAGATATTGGACCCTCCGTTGATTCACCATTGATCGAGGA
ACGCATTGCTGCAAGACGATTGAGGATAACAAGGCGTATGGAGGCTTTAA
AAAAAGACACTCTTGGAGAAGATGTTACAGTCAAAGTTTCATCCGAACCA
ACTAAAGAATTATCCAAAAGCCGAAAACAAATTGAAGAGAGTTTCCAACA
ATTAGCAAAGTTGATCTCAGATGGTACAGAGTTGGTATCGAATATCGAGG
TAGCGTGTGACTCGAGGGAAGCTACACTACGacaagaagaagatgaaaat
gtcaGACAAAGaacacaaaaattgcaagaTGAAGTCAAAACAGCTGCTAT
CAAATTCGAACAGatcacCAAAAAATGGGAAGGTGCACTGAAGAAGGACG
TCCCTCAACAATTAAAAGAAATGCTGGAATCACAACGTGAACTATGTGAC
GAAATGATCGGTGAAAAAGACAACCTGATTGATGAGCTGCAACaagattt
aaaacaaaaagatgacCAGTATGTTAAAGACCTAAGAAAACAGtcaGAAG
ATGCGGATCTCATGCTTGAACGAATGGAagaacaaatcaaaacattgaat
cgTGCTCATAAGAAAGAACTTGACAATGTTGAGAATGCTTTCTATTCCGA
GCGGAGAGATGTACTGCAATCGCACAAAAATAAAtgGACCAATCAGAGTG
AACAACGGCGTCAGAAAGAACAAGAGTATTTAGAATTACGTCAGAAACAC
GTGGAAAATTACGAGGAACAATTGAACACGTTGCGAGTTCAAGATGCAGA
GGAGTATAACATGGTCAAAATCAAACTCGAAACTGACGTTCAGattttgg
agCAAAATCTTCAACAGATGAAAGCAACATACCAgttaaatcaagaaaaa
ctcGAGTATAATTTTCAGGTGTTGAAAAAGCGGGACGAAGAGAACACGAT
AACGAAATCACAACAGAAGCGTAAAATCACACGCCTCCAAGACCTTCtca
acaatttgaaatttaaactcaAGAAGCAAGAACAACAGTACAAGGACGAG
AACCAAGCTTTTTCAGATGATTTGAAACGAATGACTGAACAGTACAAGGA
GctacaaaagaaatttagACATTTCCAAACAACGGACAACAAGAAGTTTG
TGGATATTTGGAAAATGAATGAAGAACAAACAAGAGAGTTGATCGAAGAT
TTGTTATCCGCTGATCGTATCATCTTTGAACAGCAACTTGGTATGACGTG
GCGTTCACCTGAAATCAATTTTCTGCAAAAAGTTGGTCCTATCAACGGCT
CGAAGAAAGCTATATCGAAGACTGCGTTGGATGCAGCTACGGAGATCTTA
GCGTATGATGAATCCGCTGACAGTAACTCACACGGCAAAATGACTGCAAA
GACCTCTACGAAGGAGGGCAGCACCAAACAAGAGATTGAGCACAGCCATG
AAGATTTGGACGCACCGCTTTCCACCGGAGCGATCAAACGAATGCTGGAA
CTGCTTTGTGATGAATCGGGATTTCTTGTTGAAGCAAAGTTGATCAAACT
GTTGGCACCCATTGAAAAAGATGAACAATCGCTGATGAAGTTGGATGCCA
TCTTTAATGCCATCGGTATCGAGTCAGAAAGAGACATCGTATCACTCGGC
AAGTATTTCTATAATCGTTATTTGGAGAAACTCGAACAACCCGAAGACGA
AGAGGAACAGAATGGAGAAGAGTCcttgaccaatgaaaacgctccAATAA
CAGAAGGAGCCAATCAGGATCAAGATCAGGTTGACACGCCAACCAATCAG
AAACAAGAAGCTTGTGATTTAACCAATCAGGAGACGGCATCAAATGAAAG
TTTAGAATCGATACCGATGGTTGTTCGACAAGAGCTCATTCATCCAAACG
AAGTTGTGAAATCTTTGAGAAAGTTTATTGACGATAATCGAGAACCATTC
AAGGACAGTCGCAAATCAAACACCGTCCGTATCGGTAGTTCATCAGGACG
TGATAGCAGTTACGACGAACAATATTGGACGCAGCTAGCTTCGGTTATTG
ATCTACAGAGAGAACGCCTGTGGGATGGGATGGTATCAGGATTTGAGAAA
TACAGTCAGATATTGAAAGAACGATCGACTCTCATTGGTGAAACTGATTC
CCTTAGACAACAGAATTCCGAACTGCGAATGCTTTTACATCAGTACCTAA
GCTCTAAGGTCAATCAAGAATTGGAGATTCCACCGACACGTGTTTTGCAA
GTTGAAACTGGACATTCAAAGTAGATGGCGTCACAAATCAAAGATCTTGC
CATGGATGAAGATATTGGACCCTCCGTTGATTCACCATTGATCGAGGAAC
GCATTGCTGCAAGACGATTGAGGATAACAAGGCGTATGGAGGCTTTAAAA
AAAGACACTCTTGGAGAAGATGTTACAGTCAAAGTTTCATCCGAACCAAC
TAAAGAATTATCCAAAAGCCGAAAACAAATTGAAGAGAGTTTCCAACAAT
TAGCAAAGTTGATCTCAGATGGTACAGAGTTGGTATCGAATATCGAGGTA
GCGTGTGACTCGAGGGAAGCTACACTACGacaagaagaagatgaaaatgt
caGACAAAGaacacaaaaattgcaagaTGAAGTCAAAACAGCTGCTATCA
AATTCGAACAGatcacCAAAAAATGGGAAGGTGCACTGAAGAAGGACGTC
CCTCAACAATTAAAAGAAATGCTGGAATCACAACGTGAACTATGTGACGA
AATGATCGGTGAAAAAGACAACCTGATTGATGAGCTGCAACaagatttaa
aacaaaaagatgacCAGTATGTTAAAGACCTAAGAAAACAGtcaGAAGAT
GCGGATCTCATGCTTGAACGAATGGAagaacaaatcaaaacattgaatcg
TGCTCATAAGAAAGAACTTGACAATGTTGAGAATGCTTTCTATTCCGAGC
GGAGAGATGTACTGCAATCGCACAAAAATAAAtgGACCAATCAGAGTGAA
CAACGGCGTCAGAAAGAACAAGAGTATTTAGAATTACGTCAGAAACACGT
GGAAAATTACGAGGAACAATTGAACACGTTGCGAGTTCAAGATGCAGAGG
AGTATAACATGGTCAAAATCAAACTCGAAACTGACGTTCAGattttggag
CAAAATCTTCAACAGATGAAAGCAACATACCAgttaaatcaagaaaaact
cGAGTATAATTTTCAGGTGTTGAAAAAGCGGGACGAAGAGAACACGATAA
CGAAATCACAACAGAAGCGTAAAATCACACGCCTCCAAGACCTTCtcaac
aatttgaaatttaaactcaAGAAGCAAGAACAACAGTACAAGGACGAGAA
CCAAGCTTTTTCAGATGATTTGAAACGAATGACTGAACAGTACAAGGAGc
tacaaaagaaatttagACATTTCCAAACAACGGACAACAAGAAGTTTGTG
GATATTTGGAAAATGAATGAAGAACAAACAAGAGAGTTGATCGAAGATTT
GTTATCCGCTGATCGTATCATCTTTGAACAGCAACTTGGTATGACGTGGC
GTTCACCTGAAATCAATTTTCTGCAAAAAGTTGGTCCTATCAACGGCTCG
AAGAAAGCTATATCGAAGACTGCGTTGGATGCAGCTACGGAGATCTTAGC
GTATGATGAATCCGCTGACAGTAACTCACACGGCAAAATGACTGCAAAGA
CCTCTACGAAGGAGGGCAGCACCAAACAAGAGATTGAGCACAGCCATGAA
GATTTGGACGCACCGCTTTCCACCGGAGCGATCAAACGAATGCTGGAACT
GCTTTGTGATGAATCGGGATTTCTTGTTGAAGCAAAGTTGATCAAACTGT
TGGCACCCATTGAAAAAGATGAACAATCGCTGATGAAGTTGGATGCCATC
TTTAATGCCATCGGTATCGAGTCAGAAAGAGACATCGTATCACTCGGCAA
GTATTTCTATAATCGTTATTTGGAGAAACTCGAACAACCCGAAGACGAAG
AGGAACAGAATGGAGAAGAGTCcttgaccaatgaaaacgctccAATAACA
GAAGGAGCCAATCAGGATCAAGATCAGGTTGACACGCCAACCAATCAGAA
ACAAGAAGCTTGTGATTTAACCAATCAGGAGACGGCATCAAATGAAAGTT
TAGAATCGATACCGATGGTTGTTCGACAAGAGCTCATTCATCCAAACGAA
GTTGTGAAATCTTTGAGAAAGTTTATTGACGATAATCGAGAACCATTCAA
GGACAGTCGCAAATCAAACACCGTCCGTATCGGTAGTTCATCAGGACGTG
ATAGCAGTTACGACGAACAATATTGGACGCAGCTAGCTTCGGTTATTGAT
CTACAGAGAGAACGCCTGTGGGATGGGATGGTATCAGGATTTGAGAAATA
CAGTCAGATATTGAAAGAACGATCGACTCTCATTGGTGAAACTGATTCCC
TTAGACAACAGAATTCCGAACTGCGAATGCTTTTACATCAGTACCTAAGC
TCTAAGGTCAATCAAGAATTGGAGATTCCACCGACACGTGTTTTGCAAGT
TGAAACTGGACATTCAAAGTAGATGGCGTCACAAATCAAAGATCTTGCCA
TGGATGAAGATATTGGACCCTCCGTTGATTCACCATTGATCGAGGAACGC
ATTGCTGCAAGACGATTGAGGATAACAAGGCGTATGGAGGCTTTAAAAAA
AGACACTCTTGGAGAAGATGTTACAGTCAAAGTTTCATCCGAACCAACTA
AAGAATTATCCAAAAGCCGAAAACAAATTGAAGAGAGTTTCCAACAATTA
GCAAAGTTGATCTCAGATGGTACAGAGTTGGTATCGAATATCGAGGTAGC
GTGTGACTCGAGGGAAGCTACACTACGacaagaagaagatgaaaatgtca
GACAAAGaacacaaaaattgcaagaTGAAGTCAAAACAGCTGCTATCAAA
TTCGAACAGatcacCAAAAAATGGGAAGGTGCACTGAAGAAGGACGTCCC
TCAACAATTAAAAGAAATGCTGGAATCACAACGTGAACTATGTGACGAAA
TGATCGGTGAAAAAGACAACCTGATTGATGAGCTGCAACaagatttaaaa
caaaaagatgacCAGTATGTTAAAGACCTAAGAAAACAGtcaGAAGATGC
GGATCTCATGCTTGAACGAATGGAagaacaaatcaaaacattgaatcgTG
CTCATAAGAAAGAACTTGACAATGTTGAGAATGCTTTCTATTCCGAGCGG
AGAGATGTACTGCAATCGCACAAAAATAAAtgGACCAATCAGAGTGAACA
ACGGCGTCAGAAAGAACAAGAGTATTTAGAATTACGTCAGAAACACGTGG
AAAATTACGAGGAACAATTGAACACGTTGCGAGTTCAAGATGCAGAGGAG
TATAACATGGTCAAAATCAAACTCGAAACTGACGTTCAGattttggagCA
AAATCTTCAACAGATGAAAGCAACATACCAgttaaatcaagaaaaactcG
AGTATAATTTTCAGGTGTTGAAAAAGCGGGACGAAGAGAACACGATAACG
AAATCACAACAGAAGCGTAAAATCACACGCCTCCAAGACCTTCtcaacaa
tttgaaatttaaactcaAGAAGCAAGAACAACAGTACAAGGACGAGAACC
AAGCTTTTTCAGATGATTTGAAACGAATGACTGAACAGTACAAGGAGcta
caaaagaaatttagACATTTCCAAACAACGGACAACAAGAAGTTTGTGGA
TATTTGGAAAATGAATGAAGAACAAACAAGAGAGTTGATCGAAGATTTGT
TATCCGCTGATCGTATCATCTTTGAACAGCAACTTGGTATGACGTGGCGT
TCACCTGAAATCAATTTTCTGCAAAAAGTTGGTCCTATCAACGGCTCGAA
GAAAGCTATATCGAAGACTGCGTTGGATGCAGCTACGGAGATCTTAGCGT
ATGATGAATCCGCTGACAGTAACTCACACGGCAAAATGACTGCAAAGACC
TCTACGAAGGAGGGCAGCACCAAACAAGAGATTGAGCACAGCCATGAAGA
TTTGGACGCACCGCTTTCCACCGGAGCGATCAAACGAATGCTGGAACTGC
TTTGTGATGAATCGGGATTTCTTGTTGAAGCAAAGTTGATCAAACTGTTG
GCACCCATTGAAAAAGATGAACAATCGCTGATGAAGTTGGATGCCATCTT
TAATGCCATCGGTATCGAGTCAGAAAGAGACATCGTATCACTCGGCAAGT
ATTTCTATAATCGTTATTTGGAGAAACTCGAACAACCCGAAGACGAAGAG
GAACAGAATGGAGAAGAGTCcttgaccaatgaaaacgctccAATAACAGA
AGGAGCCAATCAGGATCAAGATCAGGTTGACACGCCAACCAATCAGAAAC
AAGAAGCTTGTGATTTAACCAATCAGGAGACGGCATCAAATGAAAGTTTA
GAATCGATACCGATGGTTGTTCGACAAGAGCTCATTCATCCAAACGAAGT
TGTGAAATCTTTGAGAAAGTTTATTGACGATAATCGAGAACCATTCAAGG
ACAGTCGCAAATCAAACACCGTCCGTATCGGTAGTTCATCAGGACGTGAT
AGCAGTTACGACGAACAATATTGGACGCAGCTAGCTTCGGTTATTGATCT
ACAGAGAGAACGCCTGTGGGATGGGATGGTATCAGGATTTGAGAAATACA
GTCAGATATTGAAAGAACGATCGACTCTCATTGGTGAAACTGATTCCCTT
AGACAACAGAATTCCGAACTGCGAATGCTTTTACATCAGTACCTAAGCTC
TAAGGTCAATCAAGAATTGGAGATTCCACCGACACGTGTTTTGCAAGTTG
AAACTGGACATTCAAAGTAGATGGCGTCACAAATCAAAGATCTTGCCATG
GATGAAGATATTGGACCCTCCGTTGATTCACCATTGATCGAGGAACGCAT
TGCTGCAAGACGATTGAGGATAACAAGGCGTATGGAGGCTTTAAAAAAAG
ACACTCTTGGAGAAGATGTTACAGTCAAAGTTTCATCCGAACCAACTAAA
GAATTATCCAAAAGCCGAAAACAAATTGAAGAGAGTTTCCAACAATTAGC
AAAGTTGATCTCAGATGGTACAGAGTTGGTATCGAATATCGAGGTAGCGT
GTGACTCGAGGGAAGCTACACTACGacaagaagaagatgaaaatgtcaGA
CAAAGaacacaaaaattgcaagaTGAAGTCAAAACAGCTGCTATCAAATT
CGAACAGatcacCAAAAAATGGGAAGGTGCACTGAAGAAGGACGTCCCTC
AACAATTAAAAGAAATGCTGGAATCACAACGTGAACTATGTGACGAAATG
ATCGGTGAAAAAGACAACCTGATTGATGAGCTGCAACaagatttaaaaca
aaaagatgacCAGTATGTTAAAGACCTAAGAAAACAGtcaGAAGATGCGG
ATCTCATGCTTGAACGAATGGAagaacaaatcaaaacattgaatcgTGCT
CATAAGAAAGAACTTGACAATGTTGAGAATGCTTTCTATTCCGAGCGGAG
AGATGTACTGCAATCGCACAAAAATAAAtgGACCAATCAGAGTGAACAAC
GGCGTCAGAAAGAACAAGAGTATTTAGAATTACGTCAGAAACACGTGGAA
AATTACGAGGAACAATTGAACACGTTGCGAGTTCAAGATGCAGAGGAGTA
TAACATGGTCAAAATCAAACTCGAAACTGACGTTCAGattttggagCAAA
ATCTTCAACAGATGAAAGCAACATACCAgttaaatcaagaaaaactcGAG
TATAATTTTCAGGTGTTGAAAAAGCGGGACGAAGAGAACACGATAACGAA
ATCACAACAGAAGCGTAAAATCACACGCCTCCAAGACCTTCtcaacaatt
tgaaatttaaactcaAGAAGCAAGAACAACAGTACAAGGACGAGAACCAA
GCTTTTTCAGATGATTTGAAACGAATGACTGAACAGTACAAGGAGctaca
aaagaaatttagACATTTCCAAACAACGGACAACAAGAAGTTTGTGGATA
TTTGGAAAATGAATGAAGAACAAACAAGAGAGTTGATCGAAGATTTGTTA
TCCGCTGATCGTATCATCTTTGAACAGCAACTTGGTATGACGTGGCGTTC
ACCTGAAATCAATTTTCTGCAAAAAGTTGGTCCTATCAACGGCTCGAAGA
AAGCTATATCGAAGACTGCGTTGGATGCAGCTACGGAGATCTTAGCGTAT
GATGAATCCGCTGACAGTAACTCACACGGCAAAATGACTGCAAAGACCTC
TACGAAGGAGGGCAGCACCAAACAAGAGATTGAGCACAGCCATGAAGATT
TGGACGCACCGCTTTCCACCGGAGCGATCAAACGAATGCTGGAACTGCTT
TGTGATGAATCGGGATTTCTTGTTGAAGCAAAGTTGATCAAACTGTTGGC
ACCCATTGAAAAAGATGAACAATCGCTGATGAAGTTGGATGCCATCTTTA
ATGCCATCGGTATCGAGTCAGAAAGAGACATCGTATCACTCGGCAAGTAT
TTCTATAATCGTTATTTGGAGAAACTCGAACAACCCGAAGACGAAGAGGA
ACAGAATGGAGAAGAGTCcttgaccaatgaaaacgctccAATAACAGAAG
GAGCCAATCAGGATCAAGATCAGGTTGACACGCCAACCAATCAGAAACAA
GAAGCTTGTGATTTAACCAATCAGGAGACGGCATCAAATGAAAGTTTAGA
ATCGATACCGATGGTTGTTCGACAAGAGCTCATTCATCCAAACGAAGTTG
TGAAATCTTTGAGAAAGTTTATTGACGATAATCGAGAACCATTCAAGGAC
AGTCGCAAATCAAACACCGTCCGTATCGGTAGTTCATCAGGACGTGATAG
CAGTTACGACGAACAATATTGGACGCAGCTAGCTTCGGTTATTGATCTAC
AGAGAGAACGCCTGTGGGATGGGATGGTATCAGGATTTGAGAAATACAGT
CAGATATTGAAAGAACGATCGACTCTCATTGGTGAAACTGATTCCCTTAG
ACAACAGAATTCCGAACTGCGAATGCTTTTACATCAGTACCTAAGCTCTA
AGGTCAATCAAGAATTGGAGATTCCACCGACACGTGTTTTGCAAGTTGAA
ACTGGACATTCAAAGTAGATGGCGTCACAAATCAAAGATCTTGCCATGGA
TGAAGATATTGGACCCTCCGTTGATTCACCATTGATCGAGGAACGCATTG
CTGCAAGACGATTGAGGATAACAAGGCGTATGGAGGCTTTAAAAAAAGAC
ACTCTTGGAGAAGATGTTACAGTCAAAGTTTCATCCGAACCAACTAAAGA
ATTATCCAAAAGCCGAAAACAAATTGAAGAGAGTTTCCAACAATTAGCAA
AGTTGATCTCAGATGGTACAGAGTTGGTATCGAATATCGAGGTAGCGTGT
GACTCGAGGGAAGCTACACTACGacaagaagaagatgaaaatgtcaGACA
AAGaacacaaaaattgcaagaTGAAGTCAAAACAGCTGCTATCAAATTCG
AACAGatcacCAAAAAATGGGAAGGTGCACTGAAGAAGGACGTCCCTCAA
CAATTAAAAGAAATGCTGGAATCACAACGTGAACTATGTGACGAAATGAT
CGGTGAAAAAGACAACCTGATTGATGAGCTGCAACaagatttaaaacaaa
aagatgacCAGTATGTTAAAGACCTAAGAAAACAGtcaGAAGATGCGGAT
CTCATGCTTGAACGAATGGAagaacaaatcaaaacattgaatcgTGCTCA
TAAGAAAGAACTTGACAATGTTGAGAATGCTTTCTATTCCGAGCGGAGAG
ATGTACTGCAATCGCACAAAAATAAAtgGACCAATCAGAGTGAACAACGG
CGTCAGAAAGAACAAGAGTATTTAGAATTACGTCAGAAACACGTGGAAAA
TTACGAGGAACAATTGAACACGTTGCGAGTTCAAGATGCAGAGGAGTATA
ACATGGTCAAAATCAAACTCGAAACTGACGTTCAGattttggagCAAAAT
CTTCAACAGATGAAAGCAACATACCAgttaaatcaagaaaaactcGAGTA
TAATTTTCAGGTGTTGAAAAAGCGGGACGAAGAGAACACGATAACGAAAT
CACAACAGAAGCGTAAAATCACACGCCTCCAAGACCTTCtcaacaatttg
aaatttaaactcaAGAAGCAAGAACAACAGTACAAGGACGAGAACCAAGC
TTTTTCAGATGATTTGAAACGAATGACTGAACAGTACAAGGAGctacaaa
agaaatttagACATTTCCAAACAACGGACAACAAGAAGTTTGTGGATATT
TGGAAAATGAATGAAGAACAAACAAGAGAGTTGATCGAAGATTTGTTATC
CGCTGATCGTATCATCTTTGAACAGCAACTTGGTATGACGTGGCGTTCAC
CTGAAATCAATTTTCTGCAAAAAGTTGGTCCTATCAACGGCTCGAAGAAA
GCTATATCGAAGACTGCGTTGGATGCAGCTACGGAGATCTTAGCGTATGA
TGAATCCGCTGACAGTAACTCACACGGCAAAATGACTGCAAAGACCTCTA
CGAAGGAGGGCAGCACCAAACAAGAGATTGAGCACAGCCATGAAGATTTG
GACGCACCGCTTTCCACCGGAGCGATCAAACGAATGCTGGAACTGCTTTG
TGATGAATCGGGATTTCTTGTTGAAGCAAAGTTGATCAAACTGTTGGCAC
CCATTGAAAAAGATGAACAATCGCTGATGAAGTTGGATGCCATCTTTAAT
GCCATCGGTATCGAGTCAGAAAGAGACATCGTATCACTCGGCAAGTATTT
CTATAATCGTTATTTGGAGAAACTCGAACAACCCGAAGACGAAGAGGAAC
AGAATGGAGAAGAGTCcttgaccaatgaaaacgctccAATAACAGAAGGA
GCCAATCAGGATCAAGATCAGGTTGACACGCCAACCAATCAGAAACAAGA
AGCTTGTGATTTAACCAATCAGGAGACGGCATCAAATGAAAGTTTAGAAT
CGATACCGATGGTTGTTCGACAAGAGCTCATTCATCCAAACGAAGTTGTG
AAATCTTTGAGAAAGTTTATTGACGATAATCGAGAACCATTCAAGGACAG
TCGCAAATCAAACACCGTCCGTATCGGTAGTTCATCAGGACGTGATAGCA
GTTACGACGAACAATATTGGACGCAGCTAGCTTCGGTTATTGATCTACAG
AGAGAACGCCTGTGGGATGGGATGGTATCAGGATTTGAGAAATACAGTCA
GATATTGAAAGAACGATCGACTCTCATTGGTGAAACTGATTCCCTTAGAC
AACAGAATTCCGAACTGCGAATGCTTTTACATCAGTACCTAAGCTCTAAG
GTCAATCAAGAATTGGAGATTCCACCGACACGTGTTTTGCAAGTTGAAAC
TGGACATTCAAAGTAGATGGCGTCACAAATCAAAGATCTTGCCATGGATG
AAGATATTGGACCCTCCGTTGATTCACCATTGATCGAGGAACGCATTGCT
GCAAGACGATTGAGGATAACAAGGCGTATGGAGGCTTTAAAAAAAGACAC
TCTTGGAGAAGATGTTACAGTCAAAGTTTCATCCGAACCAACTAAAGAAT
TATCCAAAAGCCGAAAACAAATTGAAGAGAGTTTCCAACAATTAGCAAAG
TTGATCTCAGATGGTACAGAGTTGGTATCGAATATCGAGGTAGCGTGTGA
CTCGAGGGAAGCTACACTACGacaagaagaagatgaaaatgtcaGACAAA
GaacacaaaaattgcaagaTGAAGTCAAAACAGCTGCTATCAAATTCGAA
CAGatcacCAAAAAATGGGAAGGTGCACTGAAGAAGGACGTCCCTCAACA
ATTAAAAGAAATGCTGGAATCACAACGTGAACTATGTGACGAAATGATCG
GTGAAAAAGACAACCTGATTGATGAGCTGCAACaagatttaaaacaaaaa
gatgacCAGTATGTTAAAGACCTAAGAAAACAGtcaGAAGATGCGGATCT
CATGCTTGAACGAATGGAagaacaaatcaaaacattgaatcgTGCTCATA
AGAAAGAACTTGACAATGTTGAGAATGCTTTCTATTCCGAGCGGAGAGAT
GTACTGCAATCGCACAAAAATAAAtgGACCAATCAGAGTGAACAACGGCG
TCAGAAAGAACAAGAGTATTTAGAATTACGTCAGAAACACGTGGAAAATT
ACGAGGAACAATTGAACACGTTGCGAGTTCAAGATGCAGAGGAGTATAAC
ATGGTCAAAATCAAACTCGAAACTGACGTTCAGattttggagCAAAATCT
TCAACAGATGAAAGCAACATACCAgttaaatcaagaaaaactcGAGTATA
ATTTTCAGGTGTTGAAAAAGCGGGACGAAGAGAACACGATAACGAAATCA
CAACAGAAGCGTAAAATCACACGCCTCCAAGACCTTCtcaacaatttgaa
atttaaactcaAGAAGCAAGAACAACAGTACAAGGACGAGAACCAAGCTT
TTTCAGATGATTTGAAACGAATGACTGAACAGTACAAGGAGctacaaaag
aaatttagACATTTCCAAACAACGGACAACAAGAAGTTTGTGGATATTTG
GAAAATGAATGAAGAACAAACAAGAGAGTTGATCGAAGATTTGTTATCCG
CTGATCGTATCATCTTTGAACAGCAACTTGGTATGACGTGGCGTTCACCT
GAAATCAATTTTCTGCAAAAAGTTGGTCCTATCAACGGCTCGAAGAAAGC
TATATCGAAGACTGCGTTGGATGCAGCTACGGAGATCTTAGCGTATGATG
AATCCGCTGACAGTAACTCACACGGCAAAATGACTGCAAAGACCTCTACG
AAGGAGGGCAGCACCAAACAAGAGATTGAGCACAGCCATGAAGATTTGGA
CGCACCGCTTTCCACCGGAGCGATCAAACGAATGCTGGAACTGCTTTGTG
ATGAATCGGGATTTCTTGTTGAAGCAAAGTTGATCAAACTGTTGGCACCC
ATTGAAAAAGATGAACAATCGCTGATGAAGTTGGATGCCATCTTTAATGC
CATCGGTATCGAGTCAGAAAGAGACATCGTATCACTCGGCAAGTATTTCT
ATAATCGTTATTTGGAGAAACTCGAACAACCCGAAGACGAAGAGGAACAG
AATGGAGAAGAGTCcttgaccaatgaaaacgctccAATAACAGAAGGAGC
CAATCAGGATCAAGATCAGGTTGACACGCCAACCAATCAGAAACAAGAAG
CTTGTGATTTAACCAATCAGGAGACGGCATCAAATGAAAGTTTAGAATCG
ATACCGATGGTTGTTCGACAAGAGCTCATTCATCCAAACGAAGTTGTGAA
ATCTTTGAGAAAGTTTATTGACGATAATCGAGAACCATTCAAGGACAGTC
GCAAATCAAACACCGTCCGTATCGGTAGTTCATCAGGACGTGATAGCAGT
TACGACGAACAATATTGGACGCAGCTAGCTTCGGTTATTGATCTACAGAG
AGAACGCCTGTGGGATGGGATGGTATCAGGATTTGAGAAATACAGTCAGA
TATTGAAAGAACGATCGACTCTCATTGGTGAAACTGATTCCCTTAGACAA
CAGAATTCCGAACTGCGAATGCTTTTACATCAGTACCTAAGCTCTAAGGT
CAATCAAGAATTGGAGATTCCACCGACACGTGTTTTGCAAGTTGAAACTG
GACATTCAAAGTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000049XLOC_000049Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000099-proteinTCONS_00000099-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000099-exon-sc0000001-1491911889:1853832..1854111TCONS_00000099-exon-sc0000001-1491911889:1853832..1854111Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1853832..1854111TCONS_00000099-exon-sc0000001-1510915933:1853832..1854111Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1853832..1854111TCONS_00000099-exon-sc0000001-1575043694:1853832..1854111Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1854682..1854775TCONS_00000099-exon-sc0000001-1491911889:1854682..1854775Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1854682..1854775TCONS_00000099-exon-sc0000001-1510915933:1854682..1854775Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1854682..1854775TCONS_00000099-exon-sc0000001-1575043694:1854682..1854775Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1855443..1855555TCONS_00000099-exon-sc0000001-1491911889:1855443..1855555Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1855443..1855555TCONS_00000099-exon-sc0000001-1510915933:1855443..1855555Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1855443..1855555TCONS_00000099-exon-sc0000001-1575043694:1855443..1855555Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1856078..1856129TCONS_00000099-exon-sc0000001-1491911889:1856078..1856129Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1856078..1856129TCONS_00000099-exon-sc0000001-1510915933:1856078..1856129Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1856078..1856129TCONS_00000099-exon-sc0000001-1575043694:1856078..1856129Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1869908..1869964TCONS_00000099-exon-sc0000001-1491911889:1869908..1869964Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1869908..1869964TCONS_00000099-exon-sc0000001-1510915933:1869908..1869964Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1869908..1869964TCONS_00000099-exon-sc0000001-1575043694:1869908..1869964Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1871360..1871482TCONS_00000099-exon-sc0000001-1491911889:1871360..1871482Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1871360..1871482TCONS_00000099-exon-sc0000001-1510915933:1871360..1871482Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1871360..1871482TCONS_00000099-exon-sc0000001-1575043694:1871360..1871482Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1872125..1872267TCONS_00000099-exon-sc0000001-1491911889:1872125..1872267Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1872125..1872267TCONS_00000099-exon-sc0000001-1510915933:1872125..1872267Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1872125..1872267TCONS_00000099-exon-sc0000001-1575043694:1872125..1872267Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1872581..1872737TCONS_00000099-exon-sc0000001-1491911889:1872581..1872737Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1872581..1872737TCONS_00000099-exon-sc0000001-1510915933:1872581..1872737Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1872581..1872737TCONS_00000099-exon-sc0000001-1575043694:1872581..1872737Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1873146..1873220TCONS_00000099-exon-sc0000001-1491911889:1873146..1873220Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1873146..1873220TCONS_00000099-exon-sc0000001-1510915933:1873146..1873220Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1873146..1873220TCONS_00000099-exon-sc0000001-1575043694:1873146..1873220Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1873482..1873606TCONS_00000099-exon-sc0000001-1491911889:1873482..1873606Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1873482..1873606TCONS_00000099-exon-sc0000001-1510915933:1873482..1873606Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1873482..1873606TCONS_00000099-exon-sc0000001-1575043694:1873482..1873606Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1874446..1874520TCONS_00000099-exon-sc0000001-1491911889:1874446..1874520Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1874446..1874520TCONS_00000099-exon-sc0000001-1510915933:1874446..1874520Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1874446..1874520TCONS_00000099-exon-sc0000001-1575043694:1874446..1874520Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1875190..1875336TCONS_00000099-exon-sc0000001-1491911889:1875190..1875336Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1875190..1875336TCONS_00000099-exon-sc0000001-1510915933:1875190..1875336Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1875190..1875336TCONS_00000099-exon-sc0000001-1575043694:1875190..1875336Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1875624..1875876TCONS_00000099-exon-sc0000001-1491911889:1875624..1875876Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1875624..1875876TCONS_00000099-exon-sc0000001-1510915933:1875624..1875876Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1875624..1875876TCONS_00000099-exon-sc0000001-1575043694:1875624..1875876Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1876371..1876460TCONS_00000099-exon-sc0000001-1491911889:1876371..1876460Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1876371..1876460TCONS_00000099-exon-sc0000001-1510915933:1876371..1876460Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1876371..1876460TCONS_00000099-exon-sc0000001-1575043694:1876371..1876460Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1876843..1877186TCONS_00000099-exon-sc0000001-1491911889:1876843..1877186Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1876843..1877186TCONS_00000099-exon-sc0000001-1510915933:1876843..1877186Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1876843..1877186TCONS_00000099-exon-sc0000001-1575043694:1876843..1877186Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1878383..1878593TCONS_00000099-exon-sc0000001-1491911889:1878383..1878593Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1878383..1878593TCONS_00000099-exon-sc0000001-1510915933:1878383..1878593Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1878383..1878593TCONS_00000099-exon-sc0000001-1575043694:1878383..1878593Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1878985..1879029TCONS_00000099-exon-sc0000001-1491911889:1878985..1879029Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1878985..1879029TCONS_00000099-exon-sc0000001-1510915933:1878985..1879029Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1878985..1879029TCONS_00000099-exon-sc0000001-1575043694:1878985..1879029Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1491911889:1879344..1880636TCONS_00000099-exon-sc0000001-1491911889:1879344..1880636Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1510915933:1879344..1880636TCONS_00000099-exon-sc0000001-1510915933:1879344..1880636Clytia hemisphaericaexon
TCONS_00000099-exon-sc0000001-1575043694:1879344..1880636TCONS_00000099-exon-sc0000001-1575043694:1879344..1880636Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1853832..1880636 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
37.4726 33.3893 47.1774 48.5695 132.232 104.056 43.1265 47.6884 29.5947 37.6402 33.9123 28.513 16.7302 15.5092 13.8834 16.5447 17.978 18.7733 10.7878 13.2004 18.1005 19.4957 18.2043 18.6724 70.1738 60.2464 14.2238 12.5901 11.4908 12.3204
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR029440DRC1_C
Blast
BLAST of TCONS_00000099 vs. Swiss-Prot (Human)
Match: DRC1 (Dynein regulatory complex protein 1 OS=Homo sapiens GN=DRC1 PE=2 SV=2)

HSP 1 Score: 486.108 bits (1250), Expect = 6.559e-155
Identity = 350/754 (46.42%), Postives = 481/754 (63.79%), Query Frame = 3
Query:  192 IGPSVDSPXXXXXXXXXXXXXXXXXXXXKKDTLGEDVTVKVSSEPTKELSKSRKQIEESFQQLAKLISDGTELVSNIEVACDSREATLRQEEDENVRQRTQKLQDEVKTAAIKFEQITKKWEGALKKDVPQQLKEMLESQRELCDEMIGEKDNLIDEXXXXXXXXXXXXXXXXRKQSEDADLMLERMEEQIKTLNRAHKKELDNVENAFYSERRDVLQSHKNKWTNQSEQRRQKEQEYLELRQKHVENYEEQLNTLRVQDAEEYNMVKIKLETDVQILEQNLQQMKATYQLNQEKLEYNFQVLKKRDEENTITKSQQKRKITRXXXXXXXXXXXXXXXXXXXXDENQAFSDDLKRMTEQYKELQKKFRHFQTTDNKKFVDIWKMNEEQTRELIEDLLSADRIIFEQQLGMTWRSPEINFLQKVGPINGSKKAISKTALDAATEILAYDESADSNSHGKMTAKTSTKEGSTKQEIEHSHEDLDAPLSTGAIKRMLELLCDESGFLVEAKLIKLLAPIEKDEQSLMKLDAIFNAIGIESERDIVSLGKYFYNRYLXXXXXXXXXXXXXXXXSLTNENAPITEGANQDQDQVDTPTNQKQEACDLTNQETASNESLESIPMVVRQE------LIHPNEVVKSLRKFIDDNREPFKDSRKSNTVRIGSSSGRDSSYDEQYWTQLASVIDLQRERLWDGMVSGFEKYSQILKERSTLIGETDSLRQQNSELRMLLHQYLSSKVNQELEIPPTRVLQVET 2435
            + PSV S   +ERI ARRLRI  R+EA +++ LGE +  K  SE  +  SKS KQ EES  +LAKL+  GTELV+NI+VA D RE   R EE+E  RQR +KL++EVKT+  KF++IT KWE   +K +PQ+L EML +Q+  C  ++ +K+ LI ELQQ+LK KDDQYVKDL+KQS+D  L+LERMEEQ+K + +  ++EL N+E AF  ER+++L S+K KW    +    KE EYL  R K VE+YE+QLN  R+ D EEYNM+KIKLE DVQILEQ LQQ KA YQLNQEKLEYN QVLKKRDEE+T+ KSQQKRKI RL D+LNNL+ K  KQ +Q+++ENQ+ + D KR+  Q+KELQK  RHF   D++KF +IW MNEE+ ++LI      DRII    LG+ W +P+  FL  VGP       IS+    +AT+I+            +M  ++  +E         S+ DL   +S    KR+L LLCDESGFL+E+KL+ LL P+E++E  L++LDAIF+A+GIESE D+  L  +F  +Y            +    S + +  P ++ + +     +T T  + E  + T  E    ESL        +E      +IHPN+V+K L  F+   ++P +DSR    V+    + RD+S D +YW  L +VI   ++ LWD + +  EKY  +L +R+ L+ E  SL QQN+EL+ LL QYL+SK+N EL++PPT+VL+V T
Sbjct:   23 LAPSVHSDNSQERIQARRLRIAARLEARRREALGEYLDGKKESEEDQ--SKSYKQKEESRLKLAKLLLCGTELVTNIQVAIDIREIHRRVEEEEIKRQRIEKLENEVKTSQDKFDEITSKWEEGKQKRIPQELWEMLNTQQLHCAGLLEDKNKLISELQQELKTKDDQYVKDLKKQSDDICLLLERMEEQVKNVMKTFREELYNIEKAFEVERQELLASNKKKWEQALQAHNAKELEYLNNRMKKVEDYEKQLNRQRIWDCEEYNMIKIKLEQDVQILEQQLQQRKAIYQLNQEKLEYNLQVLKKRDEESTVIKSQQKRKINRLHDILNNLRSKYAKQIKQFQEENQSLTSDYKRLVMQFKELQKAMRHFALIDDEKFWEIWLMNEEEAKDLIARAFDVDRIIHTHHLGLPWAAPDFWFLNNVGP-------ISQQPQKSATQIVE-----------EMLMRSEEEEAEEAAAEPESYLDLPKQISEKTTKRILMLLCDESGFLIESKLLSLLLPLEQNECYLLRLDAIFSALGIESEDDLYKLVNFFL-KY------------RAHRLSSSLQIKPCSQASMEKASMEETSTRSELELAEQTEMEGEKEESLVEGEKEEEEETPPSPWVIHPNDVLKILEAFVMGLKKP-RDSRAPLRVQ---KNVRDNSKDSEYWQALTTVIPSSKQNLWDALYTALEKYHLVLTQRAKLLLENSSLEQQNTELQALLQQYLNSKINSELQVPPTQVLRVPT 739          
The following BLAST results are available for this feature:
BLAST of TCONS_00000099 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DRC16.559e-15546.42Dynein regulatory complex protein 1 OS=Homo sapien... [more]
back to top