Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000090 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000090
Unique NameTCONS_00000090
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2107

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000090 ID=TCONS_00000090|Name=TCONS_00000090|organism=Clytia hemisphaerica|type=transcript|length=2107bp
ttcagtgtatCTGCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAG
CATGTCATCCAATACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGA
CAAAGACAGGGTCAAAATAATACACCAAACTGCTGCCAAACACAATTTCA
ACGTCTGGCCACCATTGAAGAATTTGTTGAATCGTGACGATCAGATCATT
ATGCACGTGGCCAGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAAC
AAAGATGCCGGATTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTC
AATTTTCAGTACCAAGCAATGACTACTTACAAAGTGCTGCTGAATGTTTG
CAATGGGTGTTACGCGTGGACGAGTACAGATTACCATTCGTAAATGCTGA
TGGTGTTGACAGCTTGGTATCGGTGCTTCTGAGTAATCTTGGATTTCAGC
TCCAATACCAATTCATTTTCTGTATTTGGATGTTATCTTTCAATGTTGAA
ATTGCTGGACGAATTGGAGAAAATAATGTTATTCCAGTAATGGCGGACAT
TTTGAGGACTTCGCAGAAAGAAAAAGTCACCAGGATCATCATTGCAACCT
TCAGAAATTTGTTAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCA
CTTATTCAAAGCAAGCTGTTACCGGTTTTCAATGTGTTGATCAACAAAAC
GTGGGGAGATGAAGACATCAAAGAAGACCTGGAATTCATCAGTGAAAAAC
TATCCCACAGTGTTCAAGATTTAAGCACTTGGGATGAGTATGTCGCAGAA
GTGAAATCTGGTCGATTAGAATGGAGTCCTGTCCACAGAGAGGAAAAATT
CTGGcGCGAAAATGCAATCAAGATCTGCGAAAAGAATTACGAACTCCTAA
AGATTCTGGTGAAGTTGTTGCAATTCAATACTGATCCAATCATTCAAGCT
GTTGCATGCCACGATTTGGGTGAATTCATTCGACACTACCCTCGTGCTAA
ACCaGCTTTTGATGCTTTGGGATGCAAAGAGTTGGTGATGCAGCGAATGG
GTCATGAGAACGAACAAGTAAAATatgaagcacttttagctgttcAAAAA
CTTATGGTTCATAATTGGGAATTCCTGGGTAAGCAAGTCAAGATCGAATG
ATTATTTAAATATGTTAGCACTGGTACAAAtatattgaatttgaatgacg
aataaaaaagaagttttttacacaaaattaGGACTATAAATTATATTTTA
TACCAGGcaattttaatttattgaagtttttttgggtcaagctggagttt
ttacaagttctttgatgactctgttggtcgttaagtgttgagacaaacga
ttttattactttttctaaagaacgcgtcatccctattgtttaaaaataac
caatcagttaagcatcttgtaaaaactccagctcatcccgttTTTTTAGA
TTAATTAAATTTATCCTTGAAGCAATCAGACCTATATTATTATTCTTTTT
ATATCTTACCTCCCCTCCTCAATCTTTGTTCAGTTCACAAACTGTGAACA
TTTCTCTACTACATACCGTATTTAGTTTatccatagtcattataaaaacc
ctggtctggcaatgtattgttttagctttttgtttttgatcacgttacca
aaatctcctcttgggattggtctattttccaaTCAGATGATCAAAAGGtc
tgcaaaataaatcgattttggtacgtaagctctatcttttaacaataaaa
agagacaaaaggtttccagaccagtgtttttataatgactatggtttaTC
ACTGCTTTTGTAAAACCTATTCCACATAGAAATAAATACCCAAAAAATAG
CTAATTTCTTTTGCATATtattcagaaaaatattttattttctatttgcA
ATTATAAACTCATTATCATattaaagtaaaagaaaataattacaATGATT
CATGTTCAATCACCTGTGTCCAATtattttgagactgaaattcaaGCTTT
TCTGgccttgaaatatttcatgcaAATATATGTGAAAATTTGTTACTTTA
AGTAAATCTCTGTTAAGTAAATCTCATTAGCTAGATAACCGTTGGTGcta
gaaaatt
Run BLAST on NCBI

protein sequence of TCONS_00000090-protein

>TCONS_00000090-protein ID=TCONS_00000090-protein|Name=TCONS_00000090-protein|organism=Clytia hemisphaerica|type=polypeptide|length=382bp
QCICTMMTLIREVAKEHVIQYVLVMLDDLLLVDKDRVKIIHQTAAKHNFN
VWPPLKNLLNRDDQIIMHVASRLLAKLSTFSKTKMPDSDLVFYLTWLKGQ
FSVPSNDYLQSAAECLQWVLRVDEYRLPFVNADGVDSLVSVLLSNLGFQL
QYQFIFCIWMLSFNVEIAGRIGENNVIPVMADILRTSQKEKVTRIIIATF
RNLLEKPEQSKNACVALIQSKLLPVFNVLINKTWGDEDIKEDLEFISEKL
SHSVQDLSTWDEYVAEVKSGRLEWSPVHREEKFWRENAIKICEKNYELLK
ILVKLLQFNTDPIIQAVACHDLGEFIRHYPRAKPAFDALGCKELVMQRMG
HENEQVKYEALLAVQKLMVHNWEFLGKQVKIE
Run BLAST on NCBI

transcript from alignment at sc0000001:1826493..1838565+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000090 ID=TCONS_00000090|Name=TCONS_00000090|organism=Clytia hemisphaerica|type=transcript|length=12073bp|location=Sequence derived from alignment at sc0000001:1826493..1838565+ (Clytia hemisphaerica)
ttcagtgtatCTGCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAG CATGTCATCCAATACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGA CAAAGACAGGGTCAAAATAATACACCAAACTGCTGCCAAACACAATTTCA ACGTCTGGCCACCATTGAAGAATTTGTTGAATCGTGACGATCAGATCATT ATGCACGTGGCCAGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAAC AAAGATGCCGGATTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTC AATTTTCAGTACCAGTAAGCTATTTCCTGTTTTATGAGTTTATCCATTGG GTTTTCCACATTGAATTACGATTATTGACCCCCTGAAAGAGATTTGGGCT GAATATAAACCTGCTCAAACCTGTCAGCATCTAgatgaattttcttttga acatttgaactcaaaacaaaataacCTAGGAAACCCCAGTCCAGGACCAC TGTcaagttttagatttttgataGGTATACTTCTCATAGTGTCATTCTAC CAACAAGCTAGCAGTAAAGTTAACAATTAGCTTTTCAAAAGACAGCCTCA TTGTGGCGTCGTCTTTCTAAAAGGAAAATGAGTGAAGCTTTGAAGTTTGT AAGTCTGACAGgagaaaatgtttgattttctaTATAATATGTACTACAGC ATCAGCATTATAAAGCAATTGAAACAATGGTTCATACTAACCCGTTGTTA AATTTCCTTTATTTATTCCAGAGCAATGACTACTTACAAAGTGCTGCTGA ATGTTTGCAATGGGTGTTACGCGTGGACGAGTACAGATTACCATTCGTAA ATGCTGATGGTGTTGACAGGTTTGTTATTCGAAAGGATATTTGAGAGTTT TATTTTTGGCCTACAGATAGATAACTATAGTCTTAAGATATTTGTGTTTC AGCTATCTGAAATAAAAGAATTTCTAGTAATACAAAACATTTTGGTAGAT TTTGACTGTCATTATTCAATGTCTATCCAACTTTTAAGGAGCAATTCTTT AATATAATATCGTCCCTTTGGAGTTTTACACCTGTATTTCTCGGCTTATG AGCTTTTAGCAATCTTAGCAGTACGTAATCAATCAGCTTTTTGCTTTCAT GTGACCATATATCTGTATGGGTATCTTAGGGTAAGAAAAAATAATGTTCT GAAAACGAGTTATTTCGATTCTTTTTTAGCTTGGTATCGGTGCTTCTGAG TAATCTTGGATTTCAGCTCCAATACCAATTCATTTTCTGTATTTGGATGT TATCTTTCAATGTTGAAATTGCTGGACGAATTGGAGAGTAAGTCAATGTT CAGTTGTTTGGGACCTTccataaaatttaaatttcctGAGTTTAAACTTT CACTACCCCAAGGATAAATTTTGAATTCTCTCAGGGATGAATTTTGATGG ACAGGTGTTCAATTTGCTTGCAGTTTGACAGAGTTTTAAGGGGTGTGCAA ATGGAAGTTATCAAAAACTCTACTGTGGTAACGTATATCGTTCCAAGACT TAATTTGATTGATAATTTATAACTGGTATTTTGCAACTATACTTAAGATT ATCCTGAGATACTGAGCGTATTATAAAATAATATCTTAAAGTTATCATGG GTTGGGATAATTTCCAACATTTTTTCAATCCTTTTAGAAATAATGTTATT CCAGTAATGGCGGACATTTTGAGGACTTCGCAGAAAGAAAAAGTCACCAG GATCATCATTGCAACCTTCAGAGTAAGTCTCcaactcaaaaattaaaaac tataaTTCTATATATAACACTTTCTATTAAAGAATTTAAGCCAGCCTATT TCTCAAATGTAAATATTCTTTCCTAGAAGTTGCTTTTCAGATTTTGCTGT AGTAATTCAACCAGCACAGGGTTCGATCAGAAAATGTAggctttcaaaaa atgtgttATCATTGTGTGAACCCTGCAATTACATTACAGTCTGAGAAAAT TCAAGTTCAGTTTAATCACAGACTGTAACACTTTGAGAAATCTAATAATT TTTGCTCTCTtgaataaacattttttggatGGTTGAAATATTCAAATAGA ATTGAGTGGGGTGAAGGGAGGCTGACTTAAAAAAGGGAGATTTGAAATTG TATTTAGTTTTTGTTGTTTGATTGATTATCactaatttttactttttgtc tTAGAATTTGTTAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCAC TTATTCAAAGCAAGCTGTTACCGGTAAGTGCCAAGTCTTGAACACTTTTG AGATTTCCATCTAGATAGAAAAGAGGAACTTATATGGAAAAGACCCAATT TCCAGCTGCTACTTAAAGCCTGAAATTCTGTCAGTCAGAGTATGTTCCGC CTTTATCTTCGTCTAGCTCGCCCTGAATCGGAAAAGATCTCTGAATGATG TGATTGTGAATGAGCAATTATTCCTTAAGCATCGACTTCCACCCGGGCCA TACCAAACAATCCATATAAAATtatacttaaaggttttgtttttacataa gtgttcccgtttcatattcccgtttcatatttcatatcaggacatcATAT CAGGAGGTGTCTacatattgttatattatgcttatataagcaaaaaatgt ttttcttttcctttttctgaccaatcttgctccacatccgtatcGATCCA ATGTGGAAAAGCTTGTAGATTTAAATTGATGATTAAGCAAacgttatcac tcttatttaaaaacaaaacctttaatgtagctctgcttgatgctcatcAA CTGAAGGGAGACGATAAGttgagaaatccagggaaacgAGTGGCGACGCC GTCTCGTTGCTTCAGGAGAATATACAGTAGCTAAAGATATGGGAGCTCTC AGGTCCTCGCCTTCAACTACGGTTGCAAACTTTCTTACTCATCTCGTTAG ATTATAAATCTTAAAATCACCTATTCTTTCTTTTAGGTTTTCAATGTGTT GATCAACAAAACGTGGGGAGATGAAGACATCAAAGAAGACCTGGAATTCA TCAGTGAAAAACTATCCCACAGTGTTCAAGATTTAAGGTATAATTTGTCT ATCTGTCTGTTTGTTTGTTATCATTCACAAAGTAGGGTAAGCTGGAGAAT TTCAAAATCAAGATTTGATCAAGATCTGTTGAGGCTTTGCCGAAGTTTTG ATCTTTGGTTGAATCTCATAGGAATGTATTTTGGGGGGCCTTCGGGCGAT TTTTAGGCAActtttgcttataaaaactaAGACAAATATTCTGAGCCAGA CTGGTCAGAGCCTGATTACCGAGTTTCATTGGCCCAGCAAAGattgaaga ttgaaaataatGCAGGATTTCttatttgaatcaaaaaaatataatttgaa gaatattaaaaatcaaaatctgtTTACATGTAAAAACTAGTTAAAGATAA TGTGTCTAAGCAATCTGGTGATTTTTGACGATTGGTGTTTACTACAGTTA CTGATAAATACCGTctcaatattttgattggtttcttTAAATATCACATT TCCTTTGAAATTGATCTTCTCTCGTCAACGAGTAAGATAAGAATACCCAA tcatttcaaagaattttgaatGTTGACTGTCATTTTTAAATTACTTGCAA TAGAGCTCTGAATAGAAAGttttattgtcttttatttATAAAGAGTTTTA TTACTATTTTATTCTATTTCATTATTACCACACAACAGTTTATTCATTCG TCCAATCAACATTCTATAGAATGTTTCATTATCCAGATCTTCTTCCACCA TGTAAATCACGCcgtcatttttcatctttggtGAACCCTGGGTTTTCTCA TCCACAACTACTTTCTGTACCCTGGGTAATGAGGCTGTAGCATTTTGTTG AACAGTGCTCGTTAAATCCTTAATATCAATATGGATAGCTGTATTATTCT TGTCATCGATAGCCTTTAATACTTCTTCGCTTGTTGGATAGTAAACTCTA TCAGAATACAATTTTGACAGATACCACTCTTTACCGGGTCGATTTGAGAA GGTCACTCCGTAAACTTGAGCTTTCGACAGTTTGCGATCCAGAAAATCTA ACAGCAGCAATGAAACAACGCTTGTCTCTTGCGAGGCCCAAACATAGACA TCTACTTTTCTGTAGGAGGGAGTAGTTTGACAGTCAGATTTCAAATCACT GAACAAATTCAACCGGTCGAAAGCTGGATTTTTTATTACGTCAACAACGa cctttttgaaattataatcGAACCCAGACTCTAGATCCAAATAAGGAATC ACATGATGTTTTGGCAGCCAATCATATTTTTGGCACGCCTGGTTAGCTTC AGAAATGAGACACATGGTTATAATATCGTACCCTGATTTCTGAAGTGACT TTAATTCTTTCATCACCTTCTTCCTACCATCAGAGTCACTCGTTTTAGCG TCCAAGTAAAACAAGACTCTAGTCTCGGAATCACGTTCTCTTGGCAAATC ATCAATTAAGTTTACCACATCGCCATCTTCCATTGCGCTGTATTGTTCAA ACTCGTAATAAAAAAACCCGCGCACGTCTCTTTTATTCAAACGTACAAAC TGACTGGTTAGTGGTGAATAAATCTCGATATCGGTACACACAACTGACCA TAACAGCTCGTCTGACACATACCTTAACAATCGGCGATAAAAATCGAACT TCTTTGGTTCTTCAGCATCGGCGTCATCATAACTGtccaataaaatgctg acagtTGTCTTGATAACCGCATCGCATGATAACCCTCCCGGGTGTCTAAA ATCAATCCAAAATCCGCTTGTTGTAGAAACTACAAATAGCAGTAAAATTA CGGTCACCTTTTTGCACTGCATCATCACTCTGTATGATTCGTTCTGCTTT ATTTTAAATAACTGCTAAAAAGTGGAATAAAGTAGTTATTAGAAAGAAGC TTTAATGATTGGATCGAAAATTTGAACCAacgttttaaaaaatgttttca aatcaaaagtgTGTTTTTTGGACCGCTAACGTTAAGAGATTTTTCCATTT TCGTCCATTTTACTATAATCCTTGGATTCTTGGTGCGAGTAGAAGCTTTA AAGTCGtaaaattatatcaaaatatatcagctttattttctcaaaattca aTACTTTCTGTGACCATGACATGATACTTTAGCTCAAGCATAGTTGCCAA GTTACTGATCTTATTTCATTGAAGTcaacataaaattttaaaatatcaaa gccaaagaaagttttaaaaatgataCTTTACTTGAGCTTTCATCTGGACT AAGTATCACGTCTAGCATTGACAAAAGACTTTATATATCGTAGCAAGGGG GAAAGAAAGctaatctgtttattttgttttttgtgaGGATCAAATAGACT GAAAGGTGATCTAGAAACTAGCGTCATCAGTTTTAAGATCAATAAAAACA CATAGGTCaaaaaattgcactttttactttatataagaaccagtaatttT TGGCTGAGGCTCCACTGCTCTTAATCATGATGTATCGGTATAAAAAGTTA GACTATTATTATGTTAAACTTCAATTAAATTTACTTATTGACTACTTCAA AGGGGTCTGAAATCAGTATTTTTTAAgccatttctgaaatctgagaaCGG AATTGTTTgattaatttgttcttagattttgttcaaatttaagTGTACtc atgttcttatgaaattattCTCATGAACAAGAAAAGCCTATATAACGTTT ATCGTTGACCTTTTAATAATAAGCTTTTTATTTAGATAAGATTATGACTA TGGGGTTTTGACGCAAACGGGGAATAACTTTAATCCTATTTTTAGCATCT TAAAAAAAGTACATTTCTTATACTGATGGTGTAAGTTAGATGTAATCAAA TCTTAGCGATTCTAAAAAATGTCTATTTCGGCtgacaaacatttttttaa actaacatcttttgattttttgtacttttcCTCGAtataagattttaaaa tttagaacTAAAATTTAGCTTCTTGAAAGTTAGAGTAAAACATCTAGCTA ATGTATGTAATTTGATAACCAAAGCAACGTTTTGGTCGATCTTAGGTCAA AGTTACAACAAGATAACATGTAAAGTACTACTACcttcccccccaaaaaa aaacaatagcgAGTTTGTACCTGTCTTTTCTGAACCAAAGACGGTTAATT TTCctagatcctgactgactgaggacgacggtaaatcagcgcTCACGCTG TTCTTGTTTTTGTGGGTTAAAAATACGGGATATAACTTTTCATTTCAAGC CAGTCATTCTTCCTCAAAGCCAAAGAGtagatacataaactcgttaATAA ACTGCCGAAAAGGTCAAATCCTTGTACGAAATATTTCTGGAACAGCTTGC TTTAGTAGCTTGattcatttttattgtttttttacagCACTTGGGATGAG TATGTCGCAGAAGTGAAATCTGGTCGATTAGAATGGAGTCCTGTCCACAG AGAGGAAAAATTCTGGGTATGCTTATATTTTACCTTTAAGGTTTTCGAAA TAAGCGAGAAGGAGGTGGAGGTGtggtggccgagtggtctaaagCGTCAG AAAGTGAAACCAGGGGTCtccgctccttccaattttcTGTTCAGTTCGGA TTTAAAACCATCAAAAGACTGTAAGTCATAGATTATTAGGCTATTATCCA ACCATCTTACTTATCTATCCAATTTTAGTCACTAAAACCAAATTGGGTAT GTACCTAGCTTAAATTATGAATTTGATATCTGatagtttttttttccaaa acaatgTTTATTTTGGGCTAAATATCTTTGGAATGACATTGTTGGGTAAA TTACTCCCCTTCTCTTTACCATCCCGACTTGACTTTACGCAATTGCATAT GGGAACTTTGCACATTTACTTGGCATTTGACTTTTACGATCatgtttttt tccaatttttagcGCGAAAATGCAATCAAGATCTGCGAAAAGAATTACGA ACTCCTAAAGTAAGACTTTTATCCCTGTCATCTGTGATAAGAGATATTTC TGGCCGTATTGATTAAAAATTTGTTTACGGTGTGAGGGTCAtcaaaaatt actaaaaattgATACTCGATGCCATTCTGCTTTTTGTCgaataatcaaac aaaaatcagGGGGGTGGAAATAAAGAAATTGAGGGAAAAATGAAGATGGC ATTTCTACTTAGCTgataccagatgtggaaatttGCTACGGCACGCTTTG CTTTCTATGTCGGGCGATTTCTACATTGGTAGTAATTTGGCCTGtccctt cagagctttagtgtgggcggccgccaatacaccATTGGAATATAAGATAG AATctctcccctaccttcgggtaaaaaaactatcaaaaaaggGAACCTGC GAATCAGCTTGGATTGTGTTAAACCTTTCTTATCTTCATTATCAATCAAT AAGCCATGCCATCCAGCATATATTAATATACATATATATTAAAAACAcat ttattggacctacctggaggtcctataaattaacctctgtccgtccatcc gttcgttcgtccgtccgtttgttaccagcttttctcaggattggctcatt agttttttctgatttttggcacaatgatgcaaaatgccaatgcccaaaat gtgacggagcccgattttcgaaaaaaattcatttccggccgaaaatgccg gaaatatgccggaaaaaccgtttttttggcatattctcaagatttcatca ttagttttttctgattttttgcacaaagatgcgtattagcaatgcccaaa ttAGCCgtgtccgatttttgagaaaaaaatttttccggtcgaaaatgccg gaaatatgccggaaatcgccgtttttgcagattttcatcggactttttcc ttatatttcgttgttttttcacacaaaaatattattaatagggatgtcca cgatcaagcatgattcaattgtcaataaaactgatatttgaagccggaac tttctgaAAATCGCCGGAatagccgattttcgccggaaaaacggtgtttc ttgaatttcttgagctgtactttatattttttcatgaaatttttcacact gatgcaaaatggtaatacctaaattgtgacgaagcccgattttcgaaaaa aattcatttccggccgaaaatgccggaaatatgccggaaaacgttttttc tgattttgcgcccaaagatgcgtattaacaatgtccaAATCATGGCCGAG Tccaattcttgagaaaaaattttttccggcggaaaatgcctgaaatatgc cggaaatcgccgtttttctagattttcattggactttttccttataattg gtagttttttcattcaaaaacattattaatagcaatgcccaccatcaagc atgtttcNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNtgacaatacctaaaatgtgacggagcccgatttttgaaaaacat ttttttccggccgaaaatgccggaaatatgccggaaaaccggttttttga cattttttatttttatttttttctgattttttgcataaagatgcgtattt cgcaatgctcaaaacatggccgacttcgatttttgagaaaaaattttttc cggttgaaaattccggaaattgctgtttttgcagattttcattggatttt ttccttatatttctatgtttttcacacaaaaacattattgataacaatgc tcaccatcaagcatgatNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNaccatcaagcatgattcaattttcaataaaactgat ttttgcgaccagaactttctatctattttttccctacaacccttccctct ccccccaccatcaatcaatgatgaatttcttgcgttatgcattttcgcta acaATATgcgttttctgactgattttttttcattttcctccttgcattgc tatctaactttcatcatcaggtaggtccattcagcatctagcttgttttc tAAGTAAAATACGAAGCTTCTCATGAGACAAACCTATATTATCAAgtaca gaattaaaaaaaaatNTTttttctagtttaaatttgccactaatgtactg gcaaaaaccggggtatttccgtagaaaacatcacgtcatgaatatcatga atagagttTAAAAACTATGTTCAAACGTCTTCATATATGTAcactttttg caaattttggatTTGCCACCAATTTCTTACCTTTGTACTTTTACTTTCAT TAATATAGGATTCTGGTGAAGTTGTTGCAATTCAATACTGATCCAATCAT TCAAGCTGTTGCATGCCACGATTTGGGTGAATTCATTCGACACTACCCTC GTGCTAAACCGTAAGTAGTGGCTTGGCCATAGTAGTGTTTAGAATTGTCG GATCATCTTATAAAAACCCGCCAAGGACCCAAGTTTTTCGGTCCTTGAAA TGTCCCGGAAAAAGTGGGGTTTTTTGGGGGTTTTTATTAGATTTTCCtga tttcttttttggacctaccccggtggagatcctataaattaaccgttgtc cgttcgttcgtccgtttgtTCGTTATGAGCTTTTCTCCAGATTGACTCAT TCAATTATCcgatattttgcacaaagaatcaaaatggtaaaccctcgaat gtgacggagcccgattttgggccaaaatatgcccaaaaataaggtttttt gagatttcctCGAGTTTGAATCATTAAATGTTTCTGAATTTAATGTATTT AATGTTTTCTGTTAAATAGCAAGGTGGGTCCTTAAAAGTATCacttgatt gttttttttttctgtagaGCTTTTGATGCTTTGGGATGCAAAGAGTTGGT GATGCAGCGAATGGGTCATGAGAACGAACAAGTAAAATatgaagcacttt tagctgttcAAAAACTTATGGTTCATAATTGGTAAGAGCTATGTTCATCT GTTTCTTTAGCGAGTGATTCAGACTTCTTTTCGAGTAAAcccaatttttg acaaaaacatTGCAATAATCCAAAAATACATTCAGCTTTTGATGTTAAAG GTCGTAGATCTATGTCTTGTTTTCGTAGTAGTATTTGTTTCTACCCCCTT TTTATACGTCGTATACCTAATAATCTTTAATTTGAATCGcaaacctctac aaaaccccaggtaaaACACATCGAATCCGTTaatggatgccagcagccta aataatctttgaaaatcttaattttaaaaTGTCTCATTAGTTATTCGAAG CGATTTCTATTCCCCTTGGGGCCTATTTATAGGCTAAATCACCCTcagtt attcgaatttttcgtATTGAGAGATTGATTTTCTACGattaaaaaacgtt ttttctgttaacaatagaccttttcataaattacgtcgggaacatcactt gtctcgttttgaaattattgccatggtgattaacttccagcagttttatt aaaactacttcctatttataaaagaatcatttattgtctcaagggacata atcaccatggtaattgtttgaatacgaggcaagcgaTGTTCCTGATGTAA CTTATGTAAAGgtctattttttcaaacttattcTTTCTTCCAAAAGCATA AGTAAAAATTCTGTGTTTATTACGCTCAACTCAACCACAATGCCTCGATT ACTTCAGAAAATTCCATCTTATTAAGGTTAAGTTGAGAATCTCGtgggaa aacaaatttttcatttatacgAAATCCCGcttattcgaagtaaattctta tccccCCTTGGAGTTTCGAATGATCAAGAGTCTACTGTATCCCATTTGAC TCTTTTCTTTTACTGTGGCACCAATTAGAACATTTGAGTAAGTAGAAAAA TGTCCTAGCCTTATTTTATCTTTCATCTTTCAGGGAATTCCTGGGTAAGC AAGTCAAGATCGAATGATTATTTAAATATGTTAGCACTGGTACAAAtata ttgaatttgaatgacgaataaaaaagaagttttttacacaaaattaGGAC TATAAATTATATTTTATACCAGGcaattttaatttattgaagtttttttg ggtcaagctggagtttttacaagttctttgatgactctgttggtcgttaa gtgttgagacaaacgattttattactttttctaaagaacgcgtcatccct attgtttaaaaataaccaatcagttaagcatcttgtaaaaactccagctc atcccgttTTTTTAGATTAATTAAATTTATCCTTGAAGCAATCAGACCTA TATTATTATTCTTTTTATATCTTACCTCCCCTCCTCAATCTTTGTTCAGT TCACAAACTGTGAACATTTCTCTACTACATACCGTATTTAGTTTatccat agtcattataaaaaccctggtctggcaatgtattgttttagctttttgtt tttgatcacgttaccaaaatctcctcttgggattggtctattttccaaTC AGATGATCAAAAGGtctgcaaaataaatcgattttggtacgtaagctcta tcttttaacaataaaaagagacaaaaggtttccagaccagtgtttttata atgactatggtttaTCACTGCTTTTGTAAAACCTATTCCACATAGAAATA AATACCCAAAAAATAGCTAATTTCTTTTGCATATtattcagaaaaatatt ttattttctatttgcAATTATAAACTCATTATCATattaaagtaaaagaa aataattacaATGATTCATGTTCAATCACCTGTGTCCAATtattttgaga ctgaaattcaaGCTTTTCTGgccttgaaatatttcatgcaAATATATGTG AAAATTTGTTACTTTAAGTAAATCTCTGTTAAGTAAATCTCATTAGCTAG ATAACCGTTGGTGctagaaaatt

Coding sequence (CDS) from alignment at sc0000001:1826493..1838565+

>TCONS_00000090 ID=TCONS_00000090|Name=TCONS_00000090|organism=Clytia hemisphaerica|type=CDS|length=12639bp|location=Sequence derived from alignment at sc0000001:1826493..1838565+ (Clytia hemisphaerica)
cagtgtatCTGCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAGCA
TGTCATCCAATACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGACA
AAGACAGGGTCAAAATAATACACCAAACTGCTGCCAAACACAATTTCAAC
GTCTGGCCACCATTGAAGAATTTGTTGAATCGTGACGATCAGATCATTAT
GCACGTGGCCAGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAACAA
AGATGCCGGATTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTCAA
TTTTCAGTACCAAGCAATGACTACTTACAAAGTGCTGCTGAATGTTTGCA
ATGGGTGTTACGCGTGGACGAGTACAGATTACCATTCGTAAATGCTGATG
GTGTTGACAGCTTGGTATCGGTGCTTCTGAGTAATCTTGGATTTCAGCTC
CAATACCAATTCATTTTCTGTATTTGGATGTTATCTTTCAATGTTGAAAT
TGCTGGACGAATTGGAGAAAATAATGTTATTCCAGTAATGGCGGACATTT
TGAGGACTTCGCAGAAAGAAAAAGTCACCAGGATCATCATTGCAACCTTC
AGAAATTTGTTAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCACT
TATTCAAAGCAAGCTGTTACCGGTTTTCAATGTGTTGATCAACAAAACGT
GGGGAGATGAAGACATCAAAGAAGACCTGGAATTCATCAGTGAAAAACTA
TCCCACAGTGTTCAAGATTTAAGCACTTGGGATGAGTATGTCGCAGAAGT
GAAATCTGGTCGATTAGAATGGAGTCCTGTCCACAGAGAGGAAAAATTCT
GGcGCGAAAATGCAATCAAGATCTGCGAAAAGAATTACGAACTCCTAAAG
ATTCTGGTGAAGTTGTTGCAATTCAATACTGATCCAATCATTCAAGCTGT
TGCATGCCACGATTTGGGTGAATTCATTCGACACTACCCTCGTGCTAAAC
CaGCTTTTGATGCTTTGGGATGCAAAGAGTTGGTGATGCAGCGAATGGGT
CATGAGAACGAACAAGTAAAATatgaagcacttttagctgttcAAAAACT
TATGGTTCATAATTGGGAATTCCTGGGTAAGCAAGTCAAGATCGAATGAc
agtgtatCTGCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAGCAT
GTCATCCAATACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGACAA
AGACAGGGTCAAAATAATACACCAAACTGCTGCCAAACACAATTTCAACG
TCTGGCCACCATTGAAGAATTTGTTGAATCGTGACGATCAGATCATTATG
CACGTGGCCAGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAACAAA
GATGCCGGATTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTCAAT
TTTCAGTACCAAGCAATGACTACTTACAAAGTGCTGCTGAATGTTTGCAA
TGGGTGTTACGCGTGGACGAGTACAGATTACCATTCGTAAATGCTGATGG
TGTTGACAGCTTGGTATCGGTGCTTCTGAGTAATCTTGGATTTCAGCTCC
AATACCAATTCATTTTCTGTATTTGGATGTTATCTTTCAATGTTGAAATT
GCTGGACGAATTGGAGAAAATAATGTTATTCCAGTAATGGCGGACATTTT
GAGGACTTCGCAGAAAGAAAAAGTCACCAGGATCATCATTGCAACCTTCA
GAAATTTGTTAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCACTT
ATTCAAAGCAAGCTGTTACCGGTTTTCAATGTGTTGATCAACAAAACGTG
GGGAGATGAAGACATCAAAGAAGACCTGGAATTCATCAGTGAAAAACTAT
CCCACAGTGTTCAAGATTTAAGCACTTGGGATGAGTATGTCGCAGAAGTG
AAATCTGGTCGATTAGAATGGAGTCCTGTCCACAGAGAGGAAAAATTCTG
GcGCGAAAATGCAATCAAGATCTGCGAAAAGAATTACGAACTCCTAAAGA
TTCTGGTGAAGTTGTTGCAATTCAATACTGATCCAATCATTCAAGCTGTT
GCATGCCACGATTTGGGTGAATTCATTCGACACTACCCTCGTGCTAAACC
aGCTTTTGATGCTTTGGGATGCAAAGAGTTGGTGATGCAGCGAATGGGTC
ATGAGAACGAACAAGTAAAATatgaagcacttttagctgttcAAAAACTT
ATGGTTCATAATTGGGAATTCCTGGGTAAGCAAGTCAAGATCGAATGAca
gtgtatCTGCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAGCATG
TCATCCAATACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGACAAA
GACAGGGTCAAAATAATACACCAAACTGCTGCCAAACACAATTTCAACGT
CTGGCCACCATTGAAGAATTTGTTGAATCGTGACGATCAGATCATTATGC
ACGTGGCCAGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAACAAAG
ATGCCGGATTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTCAATT
TTCAGTACCAAGCAATGACTACTTACAAAGTGCTGCTGAATGTTTGCAAT
GGGTGTTACGCGTGGACGAGTACAGATTACCATTCGTAAATGCTGATGGT
GTTGACAGCTTGGTATCGGTGCTTCTGAGTAATCTTGGATTTCAGCTCCA
ATACCAATTCATTTTCTGTATTTGGATGTTATCTTTCAATGTTGAAATTG
CTGGACGAATTGGAGAAAATAATGTTATTCCAGTAATGGCGGACATTTTG
AGGACTTCGCAGAAAGAAAAAGTCACCAGGATCATCATTGCAACCTTCAG
AAATTTGTTAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCACTTA
TTCAAAGCAAGCTGTTACCGGTTTTCAATGTGTTGATCAACAAAACGTGG
GGAGATGAAGACATCAAAGAAGACCTGGAATTCATCAGTGAAAAACTATC
CCACAGTGTTCAAGATTTAAGCACTTGGGATGAGTATGTCGCAGAAGTGA
AATCTGGTCGATTAGAATGGAGTCCTGTCCACAGAGAGGAAAAATTCTGG
cGCGAAAATGCAATCAAGATCTGCGAAAAGAATTACGAACTCCTAAAGAT
TCTGGTGAAGTTGTTGCAATTCAATACTGATCCAATCATTCAAGCTGTTG
CATGCCACGATTTGGGTGAATTCATTCGACACTACCCTCGTGCTAAACCa
GCTTTTGATGCTTTGGGATGCAAAGAGTTGGTGATGCAGCGAATGGGTCA
TGAGAACGAACAAGTAAAATatgaagcacttttagctgttcAAAAACTTA
TGGTTCATAATTGGGAATTCCTGGGTAAGCAAGTCAAGATCGAATGAcag
tgtatCTGCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAGCATGT
CATCCAATACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGACAAAG
ACAGGGTCAAAATAATACACCAAACTGCTGCCAAACACAATTTCAACGTC
TGGCCACCATTGAAGAATTTGTTGAATCGTGACGATCAGATCATTATGCA
CGTGGCCAGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAACAAAGA
TGCCGGATTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTCAATTT
TCAGTACCAAGCAATGACTACTTACAAAGTGCTGCTGAATGTTTGCAATG
GGTGTTACGCGTGGACGAGTACAGATTACCATTCGTAAATGCTGATGGTG
TTGACAGCTTGGTATCGGTGCTTCTGAGTAATCTTGGATTTCAGCTCCAA
TACCAATTCATTTTCTGTATTTGGATGTTATCTTTCAATGTTGAAATTGC
TGGACGAATTGGAGAAAATAATGTTATTCCAGTAATGGCGGACATTTTGA
GGACTTCGCAGAAAGAAAAAGTCACCAGGATCATCATTGCAACCTTCAGA
AATTTGTTAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCACTTAT
TCAAAGCAAGCTGTTACCGGTTTTCAATGTGTTGATCAACAAAACGTGGG
GAGATGAAGACATCAAAGAAGACCTGGAATTCATCAGTGAAAAACTATCC
CACAGTGTTCAAGATTTAAGCACTTGGGATGAGTATGTCGCAGAAGTGAA
ATCTGGTCGATTAGAATGGAGTCCTGTCCACAGAGAGGAAAAATTCTGGc
GCGAAAATGCAATCAAGATCTGCGAAAAGAATTACGAACTCCTAAAGATT
CTGGTGAAGTTGTTGCAATTCAATACTGATCCAATCATTCAAGCTGTTGC
ATGCCACGATTTGGGTGAATTCATTCGACACTACCCTCGTGCTAAACCaG
CTTTTGATGCTTTGGGATGCAAAGAGTTGGTGATGCAGCGAATGGGTCAT
GAGAACGAACAAGTAAAATatgaagcacttttagctgttcAAAAACTTAT
GGTTCATAATTGGGAATTCCTGGGTAAGCAAGTCAAGATCGAATGAcagt
gtatCTGCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAGCATGTC
ATCCAATACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGACAAAGA
CAGGGTCAAAATAATACACCAAACTGCTGCCAAACACAATTTCAACGTCT
GGCCACCATTGAAGAATTTGTTGAATCGTGACGATCAGATCATTATGCAC
GTGGCCAGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAACAAAGAT
GCCGGATTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTCAATTTT
CAGTACCAAGCAATGACTACTTACAAAGTGCTGCTGAATGTTTGCAATGG
GTGTTACGCGTGGACGAGTACAGATTACCATTCGTAAATGCTGATGGTGT
TGACAGCTTGGTATCGGTGCTTCTGAGTAATCTTGGATTTCAGCTCCAAT
ACCAATTCATTTTCTGTATTTGGATGTTATCTTTCAATGTTGAAATTGCT
GGACGAATTGGAGAAAATAATGTTATTCCAGTAATGGCGGACATTTTGAG
GACTTCGCAGAAAGAAAAAGTCACCAGGATCATCATTGCAACCTTCAGAA
ATTTGTTAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCACTTATT
CAAAGCAAGCTGTTACCGGTTTTCAATGTGTTGATCAACAAAACGTGGGG
AGATGAAGACATCAAAGAAGACCTGGAATTCATCAGTGAAAAACTATCCC
ACAGTGTTCAAGATTTAAGCACTTGGGATGAGTATGTCGCAGAAGTGAAA
TCTGGTCGATTAGAATGGAGTCCTGTCCACAGAGAGGAAAAATTCTGGcG
CGAAAATGCAATCAAGATCTGCGAAAAGAATTACGAACTCCTAAAGATTC
TGGTGAAGTTGTTGCAATTCAATACTGATCCAATCATTCAAGCTGTTGCA
TGCCACGATTTGGGTGAATTCATTCGACACTACCCTCGTGCTAAACCaGC
TTTTGATGCTTTGGGATGCAAAGAGTTGGTGATGCAGCGAATGGGTCATG
AGAACGAACAAGTAAAATatgaagcacttttagctgttcAAAAACTTATG
GTTCATAATTGGGAATTCCTGGGTAAGCAAGTCAAGATCGAATGAcagtg
tatCTGCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAGCATGTCA
TCCAATACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGACAAAGAC
AGGGTCAAAATAATACACCAAACTGCTGCCAAACACAATTTCAACGTCTG
GCCACCATTGAAGAATTTGTTGAATCGTGACGATCAGATCATTATGCACG
TGGCCAGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAACAAAGATG
CCGGATTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTCAATTTTC
AGTACCAAGCAATGACTACTTACAAAGTGCTGCTGAATGTTTGCAATGGG
TGTTACGCGTGGACGAGTACAGATTACCATTCGTAAATGCTGATGGTGTT
GACAGCTTGGTATCGGTGCTTCTGAGTAATCTTGGATTTCAGCTCCAATA
CCAATTCATTTTCTGTATTTGGATGTTATCTTTCAATGTTGAAATTGCTG
GACGAATTGGAGAAAATAATGTTATTCCAGTAATGGCGGACATTTTGAGG
ACTTCGCAGAAAGAAAAAGTCACCAGGATCATCATTGCAACCTTCAGAAA
TTTGTTAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCACTTATTC
AAAGCAAGCTGTTACCGGTTTTCAATGTGTTGATCAACAAAACGTGGGGA
GATGAAGACATCAAAGAAGACCTGGAATTCATCAGTGAAAAACTATCCCA
CAGTGTTCAAGATTTAAGCACTTGGGATGAGTATGTCGCAGAAGTGAAAT
CTGGTCGATTAGAATGGAGTCCTGTCCACAGAGAGGAAAAATTCTGGcGC
GAAAATGCAATCAAGATCTGCGAAAAGAATTACGAACTCCTAAAGATTCT
GGTGAAGTTGTTGCAATTCAATACTGATCCAATCATTCAAGCTGTTGCAT
GCCACGATTTGGGTGAATTCATTCGACACTACCCTCGTGCTAAACCaGCT
TTTGATGCTTTGGGATGCAAAGAGTTGGTGATGCAGCGAATGGGTCATGA
GAACGAACAAGTAAAATatgaagcacttttagctgttcAAAAACTTATGG
TTCATAATTGGGAATTCCTGGGTAAGCAAGTCAAGATCGAATGAcagtgt
atCTGCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAGCATGTCAT
CCAATACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGACAAAGACA
GGGTCAAAATAATACACCAAACTGCTGCCAAACACAATTTCAACGTCTGG
CCACCATTGAAGAATTTGTTGAATCGTGACGATCAGATCATTATGCACGT
GGCCAGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAACAAAGATGC
CGGATTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTCAATTTTCA
GTACCAAGCAATGACTACTTACAAAGTGCTGCTGAATGTTTGCAATGGGT
GTTACGCGTGGACGAGTACAGATTACCATTCGTAAATGCTGATGGTGTTG
ACAGCTTGGTATCGGTGCTTCTGAGTAATCTTGGATTTCAGCTCCAATAC
CAATTCATTTTCTGTATTTGGATGTTATCTTTCAATGTTGAAATTGCTGG
ACGAATTGGAGAAAATAATGTTATTCCAGTAATGGCGGACATTTTGAGGA
CTTCGCAGAAAGAAAAAGTCACCAGGATCATCATTGCAACCTTCAGAAAT
TTGTTAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCACTTATTCA
AAGCAAGCTGTTACCGGTTTTCAATGTGTTGATCAACAAAACGTGGGGAG
ATGAAGACATCAAAGAAGACCTGGAATTCATCAGTGAAAAACTATCCCAC
AGTGTTCAAGATTTAAGCACTTGGGATGAGTATGTCGCAGAAGTGAAATC
TGGTCGATTAGAATGGAGTCCTGTCCACAGAGAGGAAAAATTCTGGcGCG
AAAATGCAATCAAGATCTGCGAAAAGAATTACGAACTCCTAAAGATTCTG
GTGAAGTTGTTGCAATTCAATACTGATCCAATCATTCAAGCTGTTGCATG
CCACGATTTGGGTGAATTCATTCGACACTACCCTCGTGCTAAACCaGCTT
TTGATGCTTTGGGATGCAAAGAGTTGGTGATGCAGCGAATGGGTCATGAG
AACGAACAAGTAAAATatgaagcacttttagctgttcAAAAACTTATGGT
TCATAATTGGGAATTCCTGGGTAAGCAAGTCAAGATCGAATGAcagtgta
tCTGCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAGCATGTCATC
CAATACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGACAAAGACAG
GGTCAAAATAATACACCAAACTGCTGCCAAACACAATTTCAACGTCTGGC
CACCATTGAAGAATTTGTTGAATCGTGACGATCAGATCATTATGCACGTG
GCCAGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAACAAAGATGCC
GGATTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTCAATTTTCAG
TACCAAGCAATGACTACTTACAAAGTGCTGCTGAATGTTTGCAATGGGTG
TTACGCGTGGACGAGTACAGATTACCATTCGTAAATGCTGATGGTGTTGA
CAGCTTGGTATCGGTGCTTCTGAGTAATCTTGGATTTCAGCTCCAATACC
AATTCATTTTCTGTATTTGGATGTTATCTTTCAATGTTGAAATTGCTGGA
CGAATTGGAGAAAATAATGTTATTCCAGTAATGGCGGACATTTTGAGGAC
TTCGCAGAAAGAAAAAGTCACCAGGATCATCATTGCAACCTTCAGAAATT
TGTTAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCACTTATTCAA
AGCAAGCTGTTACCGGTTTTCAATGTGTTGATCAACAAAACGTGGGGAGA
TGAAGACATCAAAGAAGACCTGGAATTCATCAGTGAAAAACTATCCCACA
GTGTTCAAGATTTAAGCACTTGGGATGAGTATGTCGCAGAAGTGAAATCT
GGTCGATTAGAATGGAGTCCTGTCCACAGAGAGGAAAAATTCTGGcGCGA
AAATGCAATCAAGATCTGCGAAAAGAATTACGAACTCCTAAAGATTCTGG
TGAAGTTGTTGCAATTCAATACTGATCCAATCATTCAAGCTGTTGCATGC
CACGATTTGGGTGAATTCATTCGACACTACCCTCGTGCTAAACCaGCTTT
TGATGCTTTGGGATGCAAAGAGTTGGTGATGCAGCGAATGGGTCATGAGA
ACGAACAAGTAAAATatgaagcacttttagctgttcAAAAACTTATGGTT
CATAATTGGGAATTCCTGGGTAAGCAAGTCAAGATCGAATGAcagtgtat
CTGCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAGCATGTCATCC
AATACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGACAAAGACAGG
GTCAAAATAATACACCAAACTGCTGCCAAACACAATTTCAACGTCTGGCC
ACCATTGAAGAATTTGTTGAATCGTGACGATCAGATCATTATGCACGTGG
CCAGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAACAAAGATGCCG
GATTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTCAATTTTCAGT
ACCAAGCAATGACTACTTACAAAGTGCTGCTGAATGTTTGCAATGGGTGT
TACGCGTGGACGAGTACAGATTACCATTCGTAAATGCTGATGGTGTTGAC
AGCTTGGTATCGGTGCTTCTGAGTAATCTTGGATTTCAGCTCCAATACCA
ATTCATTTTCTGTATTTGGATGTTATCTTTCAATGTTGAAATTGCTGGAC
GAATTGGAGAAAATAATGTTATTCCAGTAATGGCGGACATTTTGAGGACT
TCGCAGAAAGAAAAAGTCACCAGGATCATCATTGCAACCTTCAGAAATTT
GTTAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCACTTATTCAAA
GCAAGCTGTTACCGGTTTTCAATGTGTTGATCAACAAAACGTGGGGAGAT
GAAGACATCAAAGAAGACCTGGAATTCATCAGTGAAAAACTATCCCACAG
TGTTCAAGATTTAAGCACTTGGGATGAGTATGTCGCAGAAGTGAAATCTG
GTCGATTAGAATGGAGTCCTGTCCACAGAGAGGAAAAATTCTGGcGCGAA
AATGCAATCAAGATCTGCGAAAAGAATTACGAACTCCTAAAGATTCTGGT
GAAGTTGTTGCAATTCAATACTGATCCAATCATTCAAGCTGTTGCATGCC
ACGATTTGGGTGAATTCATTCGACACTACCCTCGTGCTAAACCaGCTTTT
GATGCTTTGGGATGCAAAGAGTTGGTGATGCAGCGAATGGGTCATGAGAA
CGAACAAGTAAAATatgaagcacttttagctgttcAAAAACTTATGGTTC
ATAATTGGGAATTCCTGGGTAAGCAAGTCAAGATCGAATGAcagtgtatC
TGCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAGCATGTCATCCA
ATACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGACAAAGACAGGG
TCAAAATAATACACCAAACTGCTGCCAAACACAATTTCAACGTCTGGCCA
CCATTGAAGAATTTGTTGAATCGTGACGATCAGATCATTATGCACGTGGC
CAGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAACAAAGATGCCGG
ATTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTCAATTTTCAGTA
CCAAGCAATGACTACTTACAAAGTGCTGCTGAATGTTTGCAATGGGTGTT
ACGCGTGGACGAGTACAGATTACCATTCGTAAATGCTGATGGTGTTGACA
GCTTGGTATCGGTGCTTCTGAGTAATCTTGGATTTCAGCTCCAATACCAA
TTCATTTTCTGTATTTGGATGTTATCTTTCAATGTTGAAATTGCTGGACG
AATTGGAGAAAATAATGTTATTCCAGTAATGGCGGACATTTTGAGGACTT
CGCAGAAAGAAAAAGTCACCAGGATCATCATTGCAACCTTCAGAAATTTG
TTAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCACTTATTCAAAG
CAAGCTGTTACCGGTTTTCAATGTGTTGATCAACAAAACGTGGGGAGATG
AAGACATCAAAGAAGACCTGGAATTCATCAGTGAAAAACTATCCCACAGT
GTTCAAGATTTAAGCACTTGGGATGAGTATGTCGCAGAAGTGAAATCTGG
TCGATTAGAATGGAGTCCTGTCCACAGAGAGGAAAAATTCTGGcGCGAAA
ATGCAATCAAGATCTGCGAAAAGAATTACGAACTCCTAAAGATTCTGGTG
AAGTTGTTGCAATTCAATACTGATCCAATCATTCAAGCTGTTGCATGCCA
CGATTTGGGTGAATTCATTCGACACTACCCTCGTGCTAAACCaGCTTTTG
ATGCTTTGGGATGCAAAGAGTTGGTGATGCAGCGAATGGGTCATGAGAAC
GAACAAGTAAAATatgaagcacttttagctgttcAAAAACTTATGGTTCA
TAATTGGGAATTCCTGGGTAAGCAAGTCAAGATCGAATGAcagtgtatCT
GCACAATGATGACTCTAATCCGTGAAGTAGCCAAGGAGCATGTCATCCAA
TACGTCCTAGTCATGCTTGACGATCTTCTACTCGTCGACAAAGACAGGGT
CAAAATAATACACCAAACTGCTGCCAAACACAATTTCAACGTCTGGCCAC
CATTGAAGAATTTGTTGAATCGTGACGATCAGATCATTATGCACGTGGCC
AGCCGATTGTTAGCTAAATTGTCTACGTTCAGTAAAACAAAGATGCCGGA
TTCAGATTTAGTATTTTATTTGACATGGTTGAAAGGTCAATTTTCAGTAC
CAAGCAATGACTACTTACAAAGTGCTGCTGAATGTTTGCAATGGGTGTTA
CGCGTGGACGAGTACAGATTACCATTCGTAAATGCTGATGGTGTTGACAG
CTTGGTATCGGTGCTTCTGAGTAATCTTGGATTTCAGCTCCAATACCAAT
TCATTTTCTGTATTTGGATGTTATCTTTCAATGTTGAAATTGCTGGACGA
ATTGGAGAAAATAATGTTATTCCAGTAATGGCGGACATTTTGAGGACTTC
GCAGAAAGAAAAAGTCACCAGGATCATCATTGCAACCTTCAGAAATTTGT
TAGAGAAGCCTGAACAATCAAAAAATGCATGCGTTGCACTTATTCAAAGC
AAGCTGTTACCGGTTTTCAATGTGTTGATCAACAAAACGTGGGGAGATGA
AGACATCAAAGAAGACCTGGAATTCATCAGTGAAAAACTATCCCACAGTG
TTCAAGATTTAAGCACTTGGGATGAGTATGTCGCAGAAGTGAAATCTGGT
CGATTAGAATGGAGTCCTGTCCACAGAGAGGAAAAATTCTGGcGCGAAAA
TGCAATCAAGATCTGCGAAAAGAATTACGAACTCCTAAAGATTCTGGTGA
AGTTGTTGCAATTCAATACTGATCCAATCATTCAAGCTGTTGCATGCCAC
GATTTGGGTGAATTCATTCGACACTACCCTCGTGCTAAACCaGCTTTTGA
TGCTTTGGGATGCAAAGAGTTGGTGATGCAGCGAATGGGTCATGAGAACG
AACAAGTAAAATatgaagcacttttagctgttcAAAAACTTATGGTTCAT
AATTGGGAATTCCTGGGTAAGCAAGTCAAGATCGAATGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000046XLOC_000046Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000090-proteinTCONS_00000090-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000090-exon-sc0000001-1491911889:1826493..1826806TCONS_00000090-exon-sc0000001-1491911889:1826493..1826806Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1510915933:1826493..1826806TCONS_00000090-exon-sc0000001-1510915933:1826493..1826806Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1575043694:1826493..1826806TCONS_00000090-exon-sc0000001-1575043694:1826493..1826806Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1491911889:1827264..1827361TCONS_00000090-exon-sc0000001-1491911889:1827264..1827361Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1510915933:1827264..1827361TCONS_00000090-exon-sc0000001-1510915933:1827264..1827361Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1575043694:1827264..1827361TCONS_00000090-exon-sc0000001-1575043694:1827264..1827361Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1491911889:1827722..1827829TCONS_00000090-exon-sc0000001-1491911889:1827722..1827829Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1510915933:1827722..1827829TCONS_00000090-exon-sc0000001-1510915933:1827722..1827829Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1575043694:1827722..1827829TCONS_00000090-exon-sc0000001-1575043694:1827722..1827829Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1491911889:1828180..1828264TCONS_00000090-exon-sc0000001-1491911889:1828180..1828264Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1510915933:1828180..1828264TCONS_00000090-exon-sc0000001-1510915933:1828180..1828264Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1575043694:1828180..1828264TCONS_00000090-exon-sc0000001-1575043694:1828180..1828264Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1491911889:1828697..1828765TCONS_00000090-exon-sc0000001-1491911889:1828697..1828765Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1510915933:1828697..1828765TCONS_00000090-exon-sc0000001-1510915933:1828697..1828765Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1575043694:1828697..1828765TCONS_00000090-exon-sc0000001-1575043694:1828697..1828765Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1491911889:1829479..1829579TCONS_00000090-exon-sc0000001-1491911889:1829479..1829579Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1510915933:1829479..1829579TCONS_00000090-exon-sc0000001-1510915933:1829479..1829579Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1575043694:1829479..1829579TCONS_00000090-exon-sc0000001-1575043694:1829479..1829579Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1491911889:1832930..1833008TCONS_00000090-exon-sc0000001-1491911889:1832930..1833008Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1510915933:1832930..1833008TCONS_00000090-exon-sc0000001-1510915933:1832930..1833008Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1575043694:1832930..1833008TCONS_00000090-exon-sc0000001-1575043694:1832930..1833008Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1491911889:1833455..1833501TCONS_00000090-exon-sc0000001-1491911889:1833455..1833501Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1510915933:1833455..1833501TCONS_00000090-exon-sc0000001-1510915933:1833455..1833501Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1575043694:1833455..1833501TCONS_00000090-exon-sc0000001-1575043694:1833455..1833501Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1491911889:1835951..1836052TCONS_00000090-exon-sc0000001-1491911889:1835951..1836052Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1510915933:1835951..1836052TCONS_00000090-exon-sc0000001-1510915933:1835951..1836052Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1575043694:1835951..1836052TCONS_00000090-exon-sc0000001-1575043694:1835951..1836052Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1491911889:1836510..1836623TCONS_00000090-exon-sc0000001-1491911889:1836510..1836623Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1510915933:1836510..1836623TCONS_00000090-exon-sc0000001-1510915933:1836510..1836623Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1575043694:1836510..1836623TCONS_00000090-exon-sc0000001-1575043694:1836510..1836623Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1491911889:1837576..1838565TCONS_00000090-exon-sc0000001-1491911889:1837576..1838565Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1510915933:1837576..1838565TCONS_00000090-exon-sc0000001-1510915933:1837576..1838565Clytia hemisphaericaexon
TCONS_00000090-exon-sc0000001-1575043694:1837576..1838565TCONS_00000090-exon-sc0000001-1575043694:1837576..1838565Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1826493..1838565 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
32.3792 36.0935 24.4982 19.7745 23.3033 15.3303 34.4413 39.722 28.7946 24.4821 25.5737 21.3273 15.0902 14.1703 19.4667 20.4714 21.3555 23.2024 14.461 15.3769 32.9374 27.1551 25.3737 24.148 14.0402 17.9351 40.3517 29.1551 50.0716 40.5514
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR011987ATPase_V1-cplx_hsu_C
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: Cellular Component
TermDefinition
GO:0000221vacuolar proton-transporting V-type ATPase, V1 domain
Vocabulary: Biological Process
TermDefinition
GO:0015991ATP hydrolysis coupled proton transport
Vocabulary: Molecular Function
TermDefinition
GO:0016820hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
GO:0005488binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0015991 ATP hydrolysis coupled proton transport
cellular_component GO:0000221 vacuolar proton-transporting V-type ATPase, V1 domain
molecular_function GO:0005488 binding
molecular_function GO:0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
Blast
BLAST of TCONS_00000090 vs. Swiss-Prot (Human)
Match: VATH (V-type proton ATPase subunit H OS=Homo sapiens GN=ATP6V1H PE=1 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 4.106e-120
Identity = 202/403 (50.12%), Postives = 271/403 (67.25%), Query Frame = 3
Query:    3 QCICTMMTLIREVAKEHVIQYXXXXXXXXXXXXXXXXKIIHQTAAKHNFNVWPPLKNLLNRDDQIIMHVASRLLAKLSTFSKTKMPDSDLVFYLTWLKGQFS---------------VPSND---YLQSAAECLQWVLRVDEYRLPFVNADGXXXXXXXXXXNLGFQLQYQFIFCIWMLSFNVEIAGRIGENNVIPVMADILRTSQKEKVTRIIIATFRNLLEKP---EQSKNACVALIQSKLLPVFNVLINKTWGDEDIKEDLEFISEKLSHSVQDLSTWDEYVAEVKSGRLEWSPVHREEKFWRENAIKICEKNYELLKILVKLLQFNTDPIIQAVACHDLGEFIRHYPRAKPAFDALGCKELVMQRMGHENEQVKYEALLAVQKLMVHNWEFLGKQVKIE 1148
            QC  T + L+  + KE  +QY+L M+DD+L  +  RV I    A       WP    +LNR D   +H+A+R++AKL+ + K  M  SDL +Y  W+K Q S               V S+D   Y+Q  A CLQ +LRV+EYR  +V ADGV+ ++ VL +  GFQLQYQ IF IW+L+F+ ++   +   N+IPV++DIL+ S KEKVTRII+A FRN LEK    E  +   +A+IQ K+L     L  + + DEDI ED++F+ EKL  SVQDLS++DEY +E+KSGRLEWSPVH+ EKFWRENA+++ EKNYELLKIL KLL+ + DP + AVA HD+GE++RHYPR K   + LG K+LVM  M HE++QV+Y ALLAVQKLMVHNWE+LGKQ++ E
Sbjct:   72 QCAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKNTAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCGFQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE 474          
The following BLAST results are available for this feature:
BLAST of TCONS_00000090 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
VATH4.106e-12050.12V-type proton ATPase subunit H OS=Homo sapiens GN=... [more]
back to top