Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000078 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000078
Unique NameTCONS_00000078
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4652

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000078 ID=TCONS_00000078|Name=TCONS_00000078|organism=Clytia hemisphaerica|type=transcript|length=4652bp
TAGGAATTTAATAAGTGTGTCCAGAATGATAATCGAAAGTATTACGACGA
TGCCGTCAAGAAGGATTTTGCTGAGATAAAGTGCTGTTTGTTTTTGGTAG
GCTTGTGAGAATGTTTTGTGGTTTTTCTAACACCTCTAGACAAAATGGAT
TTGAACGACTTATGTGACCTTGAAAATCCTGATGATGATGTTATTGTTGA
CGCTATCAAAAAGAGATATGAGTGTGGGTATTTCTATACTTGTATTGGAG
ATATTCTCATCTCAATCAACCCATACAAAGAGTCCATCTTGAATTCGCTT
GAGGTATCACACAGATATAAAGATGAACCTTCTCTTACGCAAACCAACCC
ACATGTCTTTGGTACCACAAACAATTTATATCATTTCCTCAATGTCAACA
AAGAAAGTCAATGCTTCATCGTCTCTGGTGAATCTGGTTCTGGAAAAAGT
GAAGTCATTCATCAAGCTGTCACACATTTTTTATGTCTAGTTTCAACGTC
TGATAGGAGTTTCAAAGAAAGAATTTTACAGGCAAATGTAATTCTGGAAG
CTTTTGGAAATGCACGGACAAGTTTAAATTCAAATGCAACaagattttgc
aaatatttaaaGTTCCATTTCGATAGCAAGTTACATCTATCCGGAGTATC
AATCACAGATTATTTGCTTGAGTTGCCGAGAGTTTCAAATCAAAGACAGG
GAGAAGCAAATTTCAATATCTTTTATTACATGTTTTCTGGGCGAACCGAA
GATGAGCTATCAAAACAATTACTTGATACCCCTACACAACACAAATATTT
GAAGTATGGTGAGTTTTTTGGGGATGATTTACTTTCTTGGAGTCAGGCTT
ATGAAAGTCTTATTGATGCATTTCAAGTTGTCGGCTTCACACAAGAGact
gTCAAAGAGATATTTGGTATTTTGTCAGCCATTTTGAATATAGGTGATTT
GAAGTTCAAATGTGAAGACGAAACAACAGGTGTTTTTGTGGACAATCTAG
AAATACTTGATAAAGtTTCTATTCTACTTGGAGTGgacacaagcgatttg
gaactTTGTTTAACCAGTAATTTGTTTGTGAAACCAgATGATGGTGTTTC
TGGCTTCAAAAGTCTGAGTGAAGCTGAACAAACCAGAGATTTCATGGCCA
ATTTCATGTATGCAAGATTGTTTAGTTGGATAGTCAGCAACATTAACACT
TTCTTGAACCCTGGCGAACCAAAAAAGAAACAATCTGAGCATGTGCATGT
TggatttcttgatatttttgggTTTGAAGATTTCCAGAAAAACACACTAG
AACAATTGTGTATTAACACCACAAATGAACAGATTAATTTGCACTTTATA
CAACACGTCTTTGCACGGGAACAGgttgatTACCAAGAAGAAGGGCTTTC
AGAATTACAATTAGTGGAATATTTTGATAACAAGAATATTGTTAATCTTC
TCCTTGAGACACCTCACGGCATCTTTGCATTATTGGAGGAAGAAAGCAAA
TGTTTGCAAGCAGATGATCAGACGCTTGTCTCTTCTTTCAATGCTCATTG
TTCAGAATTGAAGTTCTATATTCCGTCCACCGCAAACGCATCCACTTTCA
GTATCGTACActacaataaaaaaGTAACTTACGCAGCAGATGACTTCATT
TTGAGGAATAATGCAAAACTTGATGGCTGTCTGATTGAATGTTTAAGAGG
TTCAAAGGGACAGTTAACGAGTACTCTATTCAACTCGTCCTTAACCAAGA
CAGGAGCACTAATCATCAAgCAAGGACATGGTACAGTGAATTGTTGCCAA
GGGGATCTTCGAGGGGCTTACACCAAACGTATTAATCATAGGTTAAAGAA
AGAGGGGAAATGCAATACGAGCAAAGCTTGCCACAACACGAAGAGCAAGC
AACGCACATTCACCGCtagaaaacataaaaataattcaGTTGCCGTTCAG
TTCAGGAACTCGTTAGTGGATTTGATAGAGACCATCCTGCTATGTCAGGC
TCATTTCGTCAGGTGCATAAAGCCGAACAAAGTAAAAGAAGCAGATAACT
TTGACGTGGATTTTGTTAGAGCTCAAATCAAATGCAACGGCATCCTGGAT
TCCGTTCGTATTCGCAAAGACGGTTTTCCTGTTCGGCTGCCGTTCAAAAT
CTTTGTGGAGAGaTATCGTTTTGTGAAATTTGATATGACGTCACCATTGG
AGAACACTGGAGAAATATGTCAACAGATTCTTCAACATTGCAACATTGAT
GACGGCTACAAGATTGGTGCCACCAGgGTGTTGCTTCGCCTTGAGCACGT
ACAGAAATTGTTATCCTCACTTGATGAACAAACTCGAAGAATCGTCATCG
CGCAGAAAATGGTAAGAGGAAAATTAGCGCGCATCGATTTTGATTTCTTA
CAAACGTCACGCAAACAAGAAGATCGAAACGTCGGCAATTTGTTGGTCTC
GATCTCATCACGCAGCAGCAAGATGCATGACAATCTCTTGATATTGAACG
ATTACGATTTGAAGCGACATCAACGTGTTAAAGATAAGGAGATGAAGAAA
GAAATTGAGAAGGAGAACTTCATCCAAAAACGCAAATTGACGAGTGCCAC
AGATCCTGAATTGAAACTTCGTGAAAGTCAACAACGACCCGCCCCTGAAA
ACTCACCAAACAGAAAGGTTCCACGCAACAAACAACGCACACAAACAGAA
CCATTGATTCGCAACTTCATCTCGGGTCCACAATCAGCATGGTGTATGGT
CAAATGCTACGAACGCCAATTCCACATTGCATCTTTCCAAATGGAAGAAG
CTGTCATTTGTGTTGACGGCACACACACATTCAGTGATAAAAACCGCATC
GCCTTTGCCACCCTCCCCGTACGGGCGGACGATCCAAAAGTCGCCAAAGT
GAAAAGTTGTATCGGGAAAGGAGTCCAGTTACACCAAGACGAGCGACAAA
ACTTGTGGGCTACGCGACTTGGTAAAAACCCTATATTTGTGCGTGGTCAT
ACCTTATGTCCAGAACTGGTCAAACTGAACGGCAAACTTACGCAAGGCGT
ACCCATGAAAGTGTTAGATACGGCCGCTTTCAAGGATTACATGCGTGAAG
AAGTTGAGAAAAATGGCGGCGTCACTGAAGACCTCAAAGATCGAATCATG
TCTAAACTGAAGATTTGCATGAGTTTCATCAAAGATACACACTTAGACGA
AGAAACGCCGTGTTGGTTCGAAATTTGGCTTGTCAAAGTCAAGGAGCATG
TTAGACGTTACCTTGACAACCAACAGAAACGAGAGAAACGAAAATCAGGA
CATTTAGACATGCGTATTACACAAACACAAGAATCCGTTAAACGAATTGC
AGCCATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATCATTTACGTAGAC
CACGAAGTAATACGGCAGGCCCGAATCCTGCCGAAACGACGGGAAAACCG
GCCCGTTCATCAAGACCGCCGTCACAAATAATCGGCGAAAAATCCATCGC
ACGTCATCGAGGGACGACATCAGCAGACACAACGGCGCAATGGCGTGTGG
AACAAAAGATTACGCAAGAAATGTTACAACGTGAACGTAGTATGGACATG
ATTCGACGTGAGAAAAGCATGGACGTACGGCTGGAGTCGCGACTTTTAAT
GGAACGCGAATATCGAAACAGTATGGGAAAACCTTTAGTTGAATCTCAAC
ACGTGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCA
CCGCAATCACTGGCCCGTAGTACGGGAAGCAGTATGGGATCACGTAAAGA
CAATTCGACCACAGCCAACGATTCCCCTCGTATAGTTAACGGTCCACATA
CGCCCGTTTCACGTATGCCCGCCCACTCTCAACAAAATCCTCATGAAGAA
TTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAATGAGTTATCG
ACAAGTATTTGGACTTCAATCATCAGACTATTTATTTAACGTGACGCCGC
CTAATTACACGCGCCATCGACGTTTCTCAGACTCAGATACTGAATCCCTt
cacaatttcaatttcatacaCAAAGTAATCACACAACCTTCAACGCCCAC
TCACCAATCCACCCAACAATTAACAAACGCCCAACAAACGCCCTCCCAAC
AAACAGAAGATCCGAAGAAATCGAAAGTACTTCAACAACCGAAAAGttgg
atgaaaaaagtacgACGAAAGTCGGAAGATAATCCAAAACGAAAAGTTGT
AGCGCAACTTTCTAACAAATAAATAGATAGGATGagatattttgactttt
agatGAACATATTATTTTTAGGAGAGGAATTTAAGTCTTTTTGCTTAATA
TTTACATTAAGattcatttttatgacgtctAATTTTCTTAGTACTAGATA
TTGTATGAAATTAAGTATTCTTAGAGTGCCTTTAAACCATTTAATCTTAA
CTGCTAttgaaatttagaaaacttggaaatttatttggaaatttttattc
tcaaaaattttggcTTACAAATTATCTTCAATGCAtctcaatattttttc
tttttaattttctgtAATATAGTTATTGGTAAAAAAAcgaagttattttt
ttctgtttcatttttgtaaattatgtGAAGAAACAAGCACCGTTATACAa
ag
Run BLAST on NCBI

protein sequence of TCONS_00000078-protein

>TCONS_00000078-protein ID=TCONS_00000078-protein|Name=TCONS_00000078-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1375bp
MDLNDLCDLENPDDDVIVDAIKKRYECGYFYTCIGDILISINPYKESILN
SLEVSHRYKDEPSLTQTNPHVFGTTNNLYHFLNVNKESQCFIVSGESGSG
KSEVIHQAVTHFLCLVSTSDRSFKERILQANVILEAFGNARTSLNSNATR
FCKYLKFHFDSKLHLSGVSITDYLLELPRVSNQRQGEANFNIFYYMFSGR
TEDELSKQLLDTPTQHKYLKYGEFFGDDLLSWSQAYESLIDAFQVVGFTQ
ETVKEIFGILSAILNIGDLKFKCEDETTGVFVDNLEILDKVSILLGVDTS
DLELCLTSNLFVKPDDGVSGFKSLSEAEQTRDFMANFMYARLFSWIVSNI
NTFLNPGEPKKKQSEHVHVGFLDIFGFEDFQKNTLEQLCINTTNEQINLH
FIQHVFAREQVDYQEEGLSELQLVEYFDNKNIVNLLLETPHGIFALLEEE
SKCLQADDQTLVSSFNAHCSELKFYIPSTANASTFSIVHYNKKVTYAADD
FILRNNAKLDGCLIECLRGSKGQLTSTLFNSSLTKTGALIIKQGHGTVNC
CQGDLRGAYTKRINHRLKKEGKCNTSKACHNTKSKQRTFTARKHKNNSVA
VQFRNSLVDLIETILLCQAHFVRCIKPNKVKEADNFDVDFVRAQIKCNGI
LDSVRIRKDGFPVRLPFKIFVERYRFVKFDMTSPLENTGEICQQILQHCN
IDDGYKIGATRVLLRLEHVQKLLSSLDEQTRRIVIAQKMVRGKLARIDFD
FLQTSRKQEDRNVGNLLVSISSRSSKMHDNLLILNDYDLKRHQRVKDKEM
KKEIEKENFIQKRKLTSATDPELKLRESQQRPAPENSPNRKVPRNKQRTQ
TEPLIRNFISGPQSAWCMVKCYERQFHIASFQMEEAVICVDGTHTFSDKN
RIAFATLPVRADDPKVAKVKSCIGKGVQLHQDERQNLWATRLGKNPIFVR
GHTLCPELVKLNGKLTQGVPMKVLDTAAFKDYMREEVEKNGGVTEDLKDR
IMSKLKICMSFIKDTHLDEETPCWFEIWLVKVKEHVRRYLDNQQKREKRK
SGHLDMRITQTQESVKRIAAMPEMRRAKSGDHLRRPRSNTAGPNPAETTG
KPARSSRPPSQIIGEKSIARHRGTTSADTTAQWRVEQKITQEMLQRERSM
DMIRREKSMDVRLESRLLMEREYRNSMGKPLVESQHVNRVRGSEKSSPGQ
SPPQSLARSTGSSMGSRKDNSTTANDSPRIVNGPHTPVSRMPAHSQQNPH
EEFRRGGSVAAAREGMSYRQVFGLQSSDYLFNVTPPNYTRHRRFSDSDTE
SLHNFNFIHKVITQPSTPTHQSTQQLTNAQQTPSQQTEDPKKSKVLQQPK
SWMKKVRRKSEDNPKRKVVAQLSNK
Run BLAST on NCBI

transcript from alignment at sc0000001:1683867..1745865+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000078 ID=TCONS_00000078|Name=TCONS_00000078|organism=Clytia hemisphaerica|type=transcript|length=61999bp|location=Sequence derived from alignment at sc0000001:1683867..1745865+ (Clytia hemisphaerica)
TAGGAATTTAATAAGTGTGTCCAGAATGATAATCGAAAGTATTACGACGA TGCCGTCAAGAAGGATTTTGCTGAGATAAAGTGCTGTTTGTTTTTGGTAG GCTTGTGAGAATGTTTTGTGGTTTTTCTAACACCTCTAGACAAAATGGAT TTGAACGACTTATGTGACCTTGAAAATCCTGATGATGATGTTATTGTTGA CGCTATCAAAAAGAGATATGAGTGTGGGTATTTCTATGTAAGTTTTATCA GTTTAAGTTCACattatttgtttaaaaaaatgtcgTCGAAAGCAAAGCCC TGCTTTTTTTATATTACCtgtaatttgtttttctttcttctgtGACTGCC TTTGAATTGCCTGATCAATGATGATCAGCTGTTTTTTGGCTATCCCTGAG GTTTTGAATCAGATCTTCAGGTCTAAGATCTTCATTCTTCGCACATTTTA GAGatatttattgtttaaaaattatataatcGCATATCAAGTTGCAAACC AATTTGGCAAGTTGCATAGTTTTGCAGCGCTGCAAAATTTGGCGAAATTG CAGTTTTTCTAGTCATTCTACCCAATACTTCCCAGTGTGGAAACGATGCA AAGTCCACACCAAATTGTTATTTGATTAAAGTGAGCTCGCCGGTCCACGC CAAAAGAAGTTCGCCTTGTGGAAAggcatggtttggcccgagggggggaa gtttgaaatatagagctctaaattggctaaaaacacactcaaaaaacaaa aataattcgaataaaggcaaaatttaaaggtaaaatactccattttatga agaaaatcactcttaaaaaattattggggggggggggggggtaaaaaccC CCGGGAGCttcggaaaaaaaaaaaaaaaaacaaaaaaaaaaaaaattaaa gagatGAATccccaattttaagaaaattaccCCCCTaaaaatattggggg gggggggggggttaaataCCCCCGGTAGCTACGGAACTGAATGAATCATG ACCATGAGCCATATTTTAGGAATTAATGGGATTAGGGATTAATGAATTAA AAGCCCTTTATGTTCTATTTACACTCTACTATGTTGTTATATGACGGTCA AGGGAGAGCAAAGTGGATGCGTTTGAACCTGGCGTAATGAAATCGGGCGT CAGAATGGCAGTGCTCCTCTTgtcttgaaaagctttgacttTCGCCGATA TTTTACTTTATATTCACTCCTTAtgctaatacacgttttttttttataag gaaccttaactttgctctgagcctggagttccttatttttacagagaatt tcagtctcaaagttccttatcgagttccttactacatagaNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNctcagcctgagcagttccttaacaattc cttattttttgaaccattttcagcctcgagttccttataaacgtgttcct tataaaaaaaaaaacgtgtatgccaAAAGAAGTTACTGCCTCACGTCAAA TATATTCAGCGTGCTGTTCACTAATTCTAGCCTGGAATACTTCCAATACT CCTTTTTTAAGACGAACATGGCAGCGCGGTCTATTTGCATATttacgatg tcaatcgaacgaatcaaaCGCCtaatcaattgaacacaatcgaacacaat caaataaatgcgattcgattgtcgaacgcaatcaaatcataattgcgatt cgattgtcgaacgcaatcaattgcgattcgattgtcgaacgcaatcaaat cgtaattgaatattttgtttgattaagtttgattgattcaattgtattcg tTTCCTTGCTTTAATCTCTCTTGTGCCATACTTATGCAGGCTAGCTCTAC AGCTCTGAAACATCATCTAATAACACGAAAACCAGAATTTGATTCTTCAA TTGGAATCAAACCTATGAAAATTAATAGgtgccgtggtatagtggtatcg accttggcttctgtgcaggaggccagggttcgattcccactcacggcagt tcacttggcaagtgaacattccttcgcccgggtcaacccatgccatgtga ggggaattggatagtcagttcaaggtgctgacgggacgctcattagtaag cgtctatagctgcgagaataggcctctaaagcctcctgcaactcaaccaa atagaaatagaaatagaaatgaaGTGCACtgacaaacatcaatatgtcgg attcaacaaaattaataacggcactgtcatcattcagTCACAGAAATACT TGCATTTGCACAGggtgtgcatttgcaacggttacaacaattttttccaa ccctgtgcaaatgagctagaattaataacggcactgtcatcattcagTCA cagaaatccttgcatttgcacagggtgtgcatttgcaacagtttcaacaa ttttttccaaccctgaaaaaaaatgaaaaaatcgcTTTTTTTTGTCTCAC TTTTGCGGGACTTTAGCTtaaagtgcttgcgtgcagcgtAGGATACAAAG TCTAAATATTCGTTTTCCGtaattttttgtatgaagattTAGGTCTATAC TGTATGTGCTCGCTCTTATCTTATTTTCTAATGGCATTGGCCAATTTAAT TGCAATCAAACTTAACTTTGAACAATGTCATAATCGAACATAATCTAAGC tcaatcaaacgtaattgaCAGTCAATTGAACTGATTGAACGTTATTTGAA GGCAATCGAACATAATAGAATATTACACCAGGGATCAGTCGTTCAATTGC AATTTTCTTTCGaacttgttcgattgacaccgtctggaaaactaattact ccacaccTCAGTGGATGCAAGTAAAACAAGCCGGAAATTAGACATTACCT ATAAATAAGTTTGAAAAGTTTATATCCTCTTGATAACTTTGTTTCCTGAA TTCAAATTTGGGGAAATCCTGATATTCTAACACTGTTTTTCCAAAGATTA ATAAAACTATCCCTCAAATTGATCTTCcttgtgaaatggcctattcaTTA CCAGAATTGAATTTTAAGAATTTACATTCACAAAAAGATAGTTATATAAC ATGAACCTTGTGCAGCAAACTAAAAAGGTTTgctctaaaattcaaaatcc ttGTGAAGAATGAAACGTTTTATGGCAGGGGGGgatcggtagtaaaatct cagacataatgacgtttactacagtggtggtgtgacaaaaaatcgaaaaa aaatttactacccagggtagttaaatactaaaatgggtggtatctatgtg ttaaatgttgaaaacattttactacctgggtaattaaaacaggtaaaatt agcaaattttagctatttttgtaattcttttctgaaaaaatctgaaagtt tttataatttgaaaagattttctgttggaaagttgtttgctaagggcaaa atattaatttttacactaagtgaaaaatgtgtcacagaaataatcatttt ttagcttttttgtaaaatcagtccgaaaagcaaccaaaaaaataggtggt ctccatgacaaattgtcccaaaaacttttactaccagggtagtaaaattc ctcttccaagagtctgggtggtggtatgtaaaattcgtaaaaatcatttt actactcatatatgtctgagattttactaccgaccccccccctgtttatg GCAAAATGTATGTGGTTGAGCGATAGCATTtgtctttctttaaaaatttt gttaatattctCAAGCTAAATTGGGCATATGCAGGGTGACACATTATAGA AAATTAGATAACAGAGAGCAAGGATTGTATTAAGTTGTATAGAGATAGGT GTTTATTATaacatttgtttttgtttctttgttttagACTTGTATTGGAG ATATTCTCATCTCAATCAACCCATACAAAGAGTCCATCTTGAATTCGCTT GAGGTAAGAGTATtgtatgattttgatttttgaccaAAGAATAATTTACc aaaaaagtcattataaaacatgatttttaactcgtttttttttatttcat caaaTAAGATCTTTTATCAACAAAGCATTCCAATcaattattttgtcttt ttttatgatGAACAATCAAAAATATCTATAGGTCATCAAGTTTAATGCTT GTAAATTATGATTTTGCAAGCCTAATCTCGTTATACAAAATGAGAATACC ACTTAATGCTCTTTATCATACCAAAAATTAATCtgctaaataaattttta atttgtctTTTCAATTTGTCAGTTTTTATCTGATATGATTCATGTTATTT GCATTTCATTTTTACTGCTTTTTACTTCTATGTATTTATGAAAATAGGCA TAACATGGAcgtttttaaaatagaaaatccTTTTCCAGGTAGTTATATTC ATGCTCAGTATGAGCATCCTATTCAGTGAAATTTGGATTAGATTCAACAA ATCCCTTTCATTGTCTTGTCCAGTTAAAATCCATCCCGTCAAGATAAAGC AAACAATACCCCCTACCAGTAAGACAGCTCTTGGTCAAATGAATTGCAAC ACTGCAAGGGAATTTACTATAACTACGCTGCTTTCCATATTGTAGCAAAA AAGAGTACATACCTGTACATACTTGAAAATGAGTAGCATTAGTAGCAAAT GAACTTTATGAAAAGTGTTGTCCGAAAAACTTAGATGGTTAGCTCGAAAT TTGCTTTGTTTATTCTAAAAAATACCTTCTGTAGACGAGGGAAATTGTAA ATCAAACAATGAAATTTGCCTTTATACCTGCTTACCTGTTACACTTatat attattataaaaaagtcAATGGATTAACATAGTCTGGTAACTTAACTGAA GATTTTAAacatgttttgatattttatatcGTCATCAGTCACTAAAAAAT TTAGTTCTAAAATGAATAAATATGGGTTATCAAATGTGCATCATTAAAAA CAGATATCAGATAAATTTCAAGAtcatataccgggtgcaccaaaaaaaag tatacaggtttgtcgagatattgtgagcttcaggatttatattttttgtt cattctttttttattgtatagaggatgcNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgtagt tcgaaagttatttccaaaaaactgactttttttccatgtcgaaatttcaa aaaatcattaaaaacagcaatcacgctataaataagacaaaatgacaaaa cacaatttcattgtctttttgattcttttttctcctatcttatattttgc caacggtTTGTCCATCTTATTTACACGACATGAATATTTTCAACACCAGC AAACTAAAtacagacccaagttctttgagcaactagttgaggaatggtga tttaatttttcaaaaattttctcacgttGCACACCACACCTGTCTTGgag atttcccaaaaaaaatttcagccttaccaaaaatatttttccacatggga atagcttgttttaccatattcttaaattccgtaacgagttttgaacacag ttgcatttttttggtatttttatgtgtaaaaaAGGTAAGtgccaagagaa aagtttgctcgctgtttttgatgatttttggaaatttcgacattaaaaaa aaGTCAGTTTTTTTTTAATAATTTTCGAATTACTTTTTCAAACCTAATTG atagctcaaaattcaagttagagcatcctctatgcgataaaaaaagaatg aacaaaaaatttaaatcctgaagctcacaatatctcgacaaagttgtata cttatTTTGGTGCTACCggtataaaatcaacttttcaaagttttttgaat gtTGAGTACACCCCAAAAACGTTCATTCCAAAGATATTCTTTCTCAGTGA GGGAATATTTTCCTCTTGACTACATGCATTCTATTTATCATATTATTTAC TGCTTTTTCCCTAATCAGCACTGATTTGCAATGTAGTAAATGGCAGTATG ATCTTTGGTAGAatatataaaattgttttttattctttacCCTAGGTATC ACACAGATATAAAGATGAACCTTCTCTTACGCAAACCAACCCACATGTCT TTGGTACCACAAACAATTTATATCATTTCCTCAATGTCAACAAAGAAAGT CAATGCTTCATCGTCTCTGGTGAATCTGGTTCTGGAAAAAGTGAAGTCAT TCATCAAGCTGTCACACATTTTTTATGTCTAGTTTCAACGTCTGATAGGA GTTTCAAAGAAAGAATTTTACAGGTAATTTGTTTTGTTACAtgaatcttg atttttttgcatgactTTTGTGTAGTAAAACTTTAAGTGGTTTCAGTTTG TAGAGATATCTGaaaatccaattgaaaatttctaaaataaaatcagAACA TCGTAGAAAATGGGAAATTTTTGCCCTGAAAGtaaaagaaatattgaaaa atatttttttaaattgaaacatGTTGATAAAAATCCTTTGTCCTGATTAC ATGTCATAGTTTTACAATCCAATACTTTCTATCTTTAGGCAAATGTAATT CTGGAAGCTTTTGGAAATGCACGGACAAGTTTAAATTCAAATGCAACaag attttgcaaatatttaaaGTTCCATTTCGATAGCAAGTTACATCTATCCG GAGGTAAGTGTTTAAAAAGTATTATTTAACATATCTCCATTCGCTGACAT AtcatttataaacaaaaaagaaaaattttctgcTCGTCCAGCCCTATGCG AGCACAAATTTATAGAAATGCTATTGTCAATTTTGCTTAGTCAGCATAAG AGATATAGAAAATATCTTGTCATGGTGTTATTTGTTTTATCGTGGGAATG CTACGTGTTTTGTACATACATTGACGAGTATGGTCTGTTCATCAAAGAAT TGCAACGTTTGACAAagaataaactttttttatagTATCAATCACAGATT ATTTGCTTGAGTTGCCGAGAGTTTCAAATCAAAGACAGGTACTTATAATT TTATCTAATACTACGCCTTTTCTATTCTGGTCAGGTTTTTCCATTACGCA TTAGCCGCTTACCAGAAAATCACTTTTTGTAATTTGCTAAATTGTATCAT TTATTGTTCTACCCTAGGGAGAAGCAAATTTCAATATCTTTTATTACATG TTTTCTGGGCGAACCGAAGATGAGCTATCAAAACAATTACTTGATACCCC TACACAACACAAGTAAGTTCAATAATTTCTCATTTTATCGATTTTTGTAT TCATCTGCATATTCATATAATGCAACTTCTTTTATACCATGTGGGCTCTA GCATCCATCTGTGATGCCCATATTTAAGGGTTCaatccattgagtttaaa gcccgaaggcccggggggggggtcactcatatgatctggcctacgtcatg tgccgcgcttaagggggGGGTTTTTctgcatcccaaaatgcactgtaagg gtgtgtttctgtgagattgcactgcaagggtcgaattttaaaacaaattc aaaataattattaaaaagaaaaggtttttacttctcgtttgtttgaaaaa gtttctattgtctgataattacagctgacaataataattttctcagtttt tctttgaaaccagttgaaacagaaaatttcccaagcttcttctcTTCACG CAGAtatacagctgagaaatatagtgcactagaAGGGTTGGGTGNACCTG GGTTACTACCCTAcctcgaaaaatggaccctaatAGTGGGACTCGTTTTT CTTAAATTCCAAAATCTTCTCAAAATCTTCCATATTCTTTTCCGAATTcc cccaaaaaggtaccctgcacgagggactgatttttcttttttggtgtTTA TAGTAGGTAAGATTAAACCAGTGCGTGCGTGATAGCCTGGTGACTAGCCT GTACTACCCCGCCGCTACgggttttatattttgaaaaaacttgcccTTGG TCGAACCATTGAGTTTAgggcccgaagggctagagtagaatttctaacct ttctcaggcaagaaaaagtgaagccttagaaAATACGTCGTATTTTTGac aacagattgaatctagcagttcctttgtttacgattgatatttttttcga aatttagcggtaaattttacattcaatctgtcatttgtgtaaaaaccagg cgagccgctcaaggccgcgcaactttggtaggatttgttggcttcaaatc ctaccaacaagattcgattctagcccttcgggcttatacttcattggttc aatCCCTAGCCAGATCATAGAGAGACTCTTAGTACAAATTGGTATTGGTG CCTCTCTGCTTGGTTCTCAGCAGTAAAGGGAAGGATCAAGCGTAAAAGTG GAGCAattcagggagaaagagtggcaccctccactacctttgggtagaca gTTCTCAAAAGAGGAGCTTCCAACTAATgttgcagacttacttactttag CATTTTCCCTTCATTTCAAATGTTTAGATATTTGAAGTATGGTGAGTTTT TTGGGGATGATTTACTTTCTTGGAGTCAGGCTTATGAAAGTCTTATTGAT GCATTTCAAGTTGTCGGCTTCACACAAGAGGTAAGATTGATGTTAAAGAT TTGATTTGTAAATCGTTGTTGACAAATTGAAAAGggaaatctcaaaatta gtgtcTGAGAAAAGTTAGAGTTTTTCTGTTAAGCCAACCTTAAAACTTAA GATCGTTCCTTTTGACATAGTGAGGAAGGTCCTATAtacgaaaaaagaaa aattcttagTTTTCTCAGGCACTAAAATTTTGGGATTGACCTTTTTGATT TGCCAGCGACAAAAtctataaatatataaataaataaatattattagCTA TTTTTCGGCTTTGACTGTTAAATTTTAGGTAAagtttgtttcaattttac caTTTCCAGGAANCAGCTTTGACTGTTTTTAAATTAGGTAAAATGTGTTT CAAATTTACCATTTCCAGGAAGTTAGTATCAGGAGATGATGATCATTGAa tttcaattacttttttagactgTCAAAGAGATATTTGGTATTTTGTCAGC CATTTTGAATATAGGTGATTTGAAGTTCAAATGTGAAGACGAAACAACAG GTGTTTTTGTGGACAATCTAGAAATACTTGATAAAGGTTTGAGAATGTTT ACGTTATTATTTCAATAGTACAGCAGTTGGTTAGTTTTAAAGGCagcttt taaaaatgttttatgcCAATAAAACAATGTTCCTTGTAAACTCATTACCA GTCCCTGCAAAGCTGACCACGCCTCTAAAGTTTGTTAGGTGTATGATTTC GAAATCAAATTCTTTCAGGCAAATACACTTGCCCGAAATATGAGCCTTTT GAGGGCTCTCCTTTTTAATTAGATGCTCTGAATCCACAAAATTAAATTGA GGTTtttacccccggggggggggggggcccccgaTTTCGAAACAActgta tgtgccgcgcaaaaacTGCCTTTCAAAATTGCACCCTTATAGTGCAGTTT GAGATGgttgaaaaggtaccctttcagtgcattttgtcttgatttaccca acccttatagtgcattatgtttctcaactttttctcaaataaaacgggta aatatttaattttaaagtTATAAGCCTTGCTGTGAAAGAAATTTACGGAA ATAACAGTATAACATTATTTTTAACTTATCTGCAGTCAAGCAAGGTTATC ATTTAATATTGGATGAAAACTGGTTAACAATATTGTAAaattcgaccctt acagtgcaataCCACAGAAACacatccttacagtgcattttgggatgcta aaaaaacctacccttaagcgcggcacatgacgtaggatCATAtgggtgcc cccccccccgggtttttaCTTAATCCCTTCTCAGAATAGAGATGTATTAA TGAATTTTGGAATGAAATGatgaatttcaatttattttagtTTCTATTCT ACTTGGAGTGgacacaagcgatttggaactTTGTTTAACCAGTAATTTGT TTGTGAAACCAggtaaaatattttgcttgaaaTTCATTACTTGTTGCTTA TAAGCCCCATACTAAGTGATGTTTTATCATTGACAGCCACATTTTGATTC TGAAAACTCCCTTTTCTTTAGATGATGGTGTTTCTGGCTTCAAAAGTCTG AGTGAAGCTGAACAAACCAGAGATTTCATGGCCAATTTCATGTATGCAAG ATTGTTTAGTTGGATAGTCAGCAACATTAACACTTTCTTGAACCCTGGCG AACCAAAAAAGAAGTaaggaaattgtttttttatttcaattcatTGGAAA AAAGTTACCAAATTCGAATTTTAACTCCTTTTCATTACATTGTGGGCTGT TTTCAAAGCTTCCTGGAACTTTTTTTAGTAATTAAAGTGACTTGCCAAGG CTGGAAATaaatacattaaaggaagaaaatttgggggatttggtggattt aagttcccgccaaatttaatttttttcatcaaccgccaaattaagttctc gccaaattAAAGTTACTCTATTATTCCCCCAAATGTGTACTATTTCAagc tttaaaacaggtttttccttttttaatggcattttttggacaaaaatgtc cttcgtCCGTCAAATTAAagtcccgccaaatttaatttttcaagttaacc gccaaaattaaattccctctgaaaaatctttttcggccatccgccaaatg aAATTCCCCAAAAATTTCGTCCTTTAATGTGCAATCGTTAAAGCTGGCCA GATAAGGAAGAAATAGAGGATTTGAGACCTTAATGATGATCTGGTATTAT TTACACTCTACTTTTATTATTCTTTATTTCAGACAATCTGAGCATGTGCA TGTTggatttcttgatatttttgggTTTGAAGATTTCCAGAAAAACACAC TAGAACAATTGTGTATTAACACCACAAATGAACAGATTAATTTGCACTTT ATACAACACGTCTTTGCACGGGAACAGGTAAATCAAAGCACAACTCAATG TTCCTGCATGTTTCTTGCACTTTGTTTGCGGTCAACCACCTTTCAAATTG ATTCcaaacaaatgaaaacaaagaataaaATCTCCTTGCCAAAGTTTATC CCCAAAACCCCTTATAAACGACAATCTGGTCATCCTTTAATCTAAAGTAC TTTACAGTCTACCCCCTGTAAGATTTTGTAACTATTTTCTTTCAAGCTGG TACACAAGGCTGcttcaacgttcatataacgtcgtatggacgttgtgaat attgGATAAACGTGGAAACAATTTTATGTGCCGGCTGGGCTGCCTAAGAA AAAGACAACCTTTCTGACTGTCTACTGTGTGTAATGTCCTTTACAAACAA ACTTCTAGTCCTCTCTTAATCTAAGGAACTTGTTAGTCTATCCTCTGCAA AACTTTATTCTTAGCCTAAGAACAGGACAACCTATCTGGGTTTCTTCAGT GATGACAAAATATGACATGGCCATGTATGGAATGGTATCTTctctatatg ttttttttttcaggttgatTACCAAGAAGAAGGGCTTTCAGAATTACAAT TAGTGGAATATTTTGATAACAAGAATATTGTTAATCTTCTCCTTGAGGTT TGGCCTTAGATTACTTTTTACGTCTGAAAAAATGTGTCTAAGAGCAGTGT TGATTTTGAAGGTTTGGATTAGATTCTATACATGCGTTTTTTTAGCAAAC CCATAAACCCTAATTTTGttcttccctcaagctaaaaTATTGCCGTTTCT TAAGCTTTATTCTGAATCAATATCTTTTGGTACTTAAGTCTTGATTTATA CTCAACTTTTCTTCGATCGAACTAtcccgaactaatcgaactaattgaac tattcacaaatttttgaaaatttccaaaagttCGAGTAAAGGAACTTACT TATTCGAGTAAGTTCGAGCAGTTTTTATTTAACGGTCTTTTACATGAAGT TTTCCTTCTCATTTTAATGTCTCTGAATTTAAGTTTGAAAGCTGAAATCT GCCAACAGTTTTCAGAAAAACTATATCCATTATTATAGTAATGAATCTCT GAGGTTGAAGCATAGATAatgtgtcaactctttattatatcCACTATTAT ATATTTTCAGACACCTCACGGCATCTTTGCATTATTGGAGGAAGAAAGCA AATGTTTGCAAGCAGATGATCAGACGCTTGTCTCTTCTTTCAATGCTCAT TGTTCAGAATTGAAGTTCTATATTCCGTCCACCGCAAACGCATCCACTTT CAGTATCGTACActacaataaaaaagtaaattgcCATCCTTTCTCATGAT CTTTTTGGAGGactggaattcccgagttaatttttcgtgatgacgtcata atgacgTTACAAAACTGAAATTATAACGTCACATGCataataactcggaa aaaataactcgggaaaaaaataactcgggaattccaggcTCCATCTTTTT GTTGCTAGTTCATGTTTGTTGTTTTTACCCTctgaaattattgaattttt gataaaagctaTTTCGTCGGTGACcatgaattttctttgaataaaaGAGA GAATCAGATTATGGGGTTGATGGGATCGAAATATAGAGGTTTGAAATATA GAGAGTCTACTGGATATGGCCTACTAAACAGTGCTGGTCTCTTCATCTTT ATAAGTATttagtggagcaatccagggagaaggAGTCAggtgagatggag tttttataagatactttaataattggtcatttgaagtaataaaaatgacg cgttctttagaaaaagtaacaaaattgttttattattggttaacgaccaa ccaaatcaaataagagcttgtaaaaacttcatctcGTCCCGAAAGAGTGG CACCTTCCCCTTGGCTATCAAAAGTTGAGCCTTCGGGTTGCCTGCCATGC CTGGCTAATTATTTTTATGATCGTTTGACAGTgatgggaaaaaatgaaaa tttacagaAACCATTACCATTCGACTACGCCTAAATTTTTTACTCTAGGT AACTTACGCAGCAGATGACTTCATTTTGAGGAATAATGCAAAACTTGATG GCTGTCTGATTGAATGTTTAAGAGGTACATCGTATAGATTTATAAGAACg taactatataagaacataaggtttcgatggccaaaatgctaagaacaatt taagaacattttaagactttgcggACTCAAAACACCCGTATCTTTAGGAA AATGGGTCAAAATGTTCACgaaatggaaaaaataagaacattttaagagc atttttaggcttgaaacccaaaaagttaagaacatccaaaggcttcaaaa attctggATGTTTTTGCAAAAACTCGTATAGATTTAGtgattatttgaaa aaagtgaacgTTATTCTTCTTTTCAAGGGATGAATCAAAGTTTGCAATAT TATATTTTATTCTAACAATGTGGAGTTTCTTTACCATAGGTTCAAAGGGA CAGTTAACGAGTACTCTATTCAACTCGTCCTTAACCAAGACAGGAGCACT AATCATCAAGTATTAAATTATATATTAAAACTTTTTAGAAACTATATTTA ACAGTatcaaaagttaggtttgaaTCGCTATGAAAAAATGCTGAGCTTGC TGCAAAAACATTGCAGATTTTAGATTTCCTCGGAAGATCAGTAcaaaatc agtacttttttatttatatagaTTGGCTTTAATTTGGCTATTTCAATCTT CTAAAGTCACGAAATTCAAttacataaataaaaaaatatttatattatta tcAAATGTTCAGAATACCAGCTGGACAATAAGTTGAGTAacataaaattt atattttttacaggCAAGGACATGGTACAGTGAATTGTTGCCAAGGGGAT CTTCGAGGGGCTTACACCAAACGTATTAATCATAGGTAAGAACCctcatt attatttttttgccaaatacTCTGGTTTGATCATTGGTCTCTATTGCACA CCCATGAACCCTTAACGGTGTGGTCGGCTTTCAAGGGGGTTCGGTAATGA ATTTACGaggaaatgacgtcaaaattcttTGTATGTAAGGatgtcaatgc aacgacttcagtCATGACGTCATTCCTACATTCGAACCCAATCTTCTTGG TCCggtttttcaaaagtggattagcTTAATTTTTGATTAAATCTCGATTA GCGCCGATTAGCATAGTAACGTCAGCTGCTCGAAAGCccatagcctatac tagacgtcacggctTTTTTCTACGCTGTAActggatgaaaaatcccggtt caTAGTGAGGTACTCGCTAGAAAGCCCACGGTTCGAACTGACGCTCGAAC AACGGAAGTTAATCGCCGGGGTTAAATAATCGAAATCTAATTGCGATTAG CGGTAATCGGGATTAATTCTAATCGACTTTTGAACAACCAGGCCCTTGTG TTTAAaggtaaaatgattttgaagaaTGAGTTAATAAGTTGCCTTTCTTT TTCTTCCAGGTTAAAGAAAGAGGGGAAATGCAATACGAGCAAAGCTTGGT TAGTAGTGAACTGCTCTTTAAATCTTTCATAAAGCGatacaaaatctttg aagcctttgaaGTCCTTAGTTCTCTAAATGTTCAtactttcaccattttt tgagtattttagtGCAATCTCCTACAAAACTGGGTGTTTTATAGagtcaa aaagccttaaaatgttcttaaatatatagtttgttcataAAAAAGGTATA GTTGCACAATATTAAAATCGAGTCAACCACCATCAAATGAAGtcttttcc attgtttttctTGTAGCCACAACACGAAGAGCAAGCAACGCACATTCACC GCtagaaaacataaaaataattcaGTTGCCGTTCAGTTCAGGGTATGAAG CTACCTTAAATGATTTTGTGTATCAAATCATTACTGGTTTCTTATCTATT GTTAATATATCCTTTCTTTCCATCATTTTTTAGCTCAGCAATGCCCCATT TAGTTGTTCTTGATGAACTTGAAGTTGTTGTGTTTGGGCGTTACAGAGTC TTTGGTGATTgcagaataaaataaaatgtctAAAATTCTGCATTAAACTT TATCGAACtatctaaaaatgaaatcaaaattagttTTGCTTGACACCAGC AATACTAAAGAAAGTTCTAGCAGTTTTGGTTTTGCTTCCCTTCTTAcaca taatttttctttcaacatTCCTACTTTTCTTATTTCAGAACTCGTTAGTG GATTTGATAGAGACCATCCTGCTATGTCAGGCTCATTTCGTCAGGTAAAA ACTTACGATTTTTGACGTAAACTATCTTTTCCTTTTTCCTGATTTCATCA GTTTCTTTAAGCTGAACTTTTtgtgttttaagcctaaaatgttcatATAA TGTTCTTAATGTTACCATTTTGTCAGTATTTTTGTGCATTCtcttgggtg ttttagagtccataaagccttaaaatattatAAAGCTGTTTTTATAAAGC TAAAACATgtttcaacttttttgcttcactttATTTCTCACCAGGTGCAT AAAGCCGAACAAAGTAAAAGAAGCAGATAACTTTGACGTGGATTTTGTTA GAGCTCAAATCAAATGCAACGGCATCCTGGATTCCGTTCGTATTCGCAAA GACGGTTTTCCTGTTCGGCTGCCGTTCAAAATCTTTGTGGAGAGgtagat tattttattttttgaagtaaATGGATTTTGCGTGGTTTTTTATAGGCTCG TGATTGAAAATTTAGCTTCGCCGAATTCTACATCCTAGGCcggcgaattc ttagcaagtccagtgtattgattagcgtgAATATGTTATTGAATCGACGA AATTTTTAGACCGATGCTGACCGATGAACTGTAATCTTTTTGTGCATTGG ACTGGCGAAATTCGCCGTTCTCTGGGCATGAACAAGACTTCTGATAAAGA CTATCATCTTTTATGTCAAATGAACTGTTTTTAAATCTATACCGATGGCT AGTTTGGCTACTGAGTtagaattttgaattgattttctgAATTTACCTAC CAAATACTTTTCAAATAAGTATACAAGTAATAAATTAACGAAATTATATT ATTTCTTTGAAGCATAAGCTCGGAGTAtgaattttcgttttttcaacatt tttttagaTATCGTTTTGTGAAATTTGATATGACGTCACCATTGGAGAAC ACTGGAGAAATATGTCAACAGATTCTTCAACATTGCAACATTGATGACGG CTACAAGATTGGTGCCACCAGggtcattttcttatttatttcacTGATCA AATCTCCTTTTTTACAAACGGATTTTCCAGAAtaatttttggttttggtt gggttttcttgaatttaattttatttttcaagagtGTTTCAATGGGATTT TCGATCTGTATACTGCGTTTCTCgtctgcaatttgagctttacgTAGCTT ATTTGACGCCAATTGATACTTAGATCATCAACCGGTTCGAGAGAGAGTGA TAATACAGTGAATGTAGATAGTCTATCCCATGTCTCCTTAACACCCTTCC CGgaagtgcttgggattcgaTCACAAACTTTTACCGCAATGAACTGGCAC CTTCGTTTCATCAAGCTTTTAGAGAAAAGGGTTGACAAATTATTTAATCA TGAATAAAGCTAATTAAGGAGACTTTGCTCTCTATATTCAAACTATTTTC GTTGCTTTTTCAGGTGTTGCTTCGCCTTGAGCACGTACAGAAATTGTTAT CCTCACTTGATGAACAAACTCGAAGAATCGTCATCGCGCAGAAAAGTAAG TTTTTGTCCAACCCTACTTTATGTTCTTGGTAAGAAAATTTTCGTACGAA GATTTGTTTAACCCTGCAAAAGTTATTATCATTTATATTTGTGAAAATGT GCGAATCACTCAAAAGCTGGGCTGAGAGGAATGCTTTTGATTTCAATCTT CTTATTGTTATTTTCCAAGTTATTTCTGGACAATCACATTTCATGGTGAA ATAAtttagttttttacaaaaatggtTGATTTTAGCTCAGGTGTTTCATA TTCTGTTTCAGCTGTAGTTTGCCCTAAATTAGCAGTTTTGATTTTACCTT GTAGTATATGCTGTATAgataattaaagtctgtccagatataattggcag tggaaacaagaatgcctgtaacttttgatagtcaaatataattatggaaa ttttttttgcttgttttagagaatcaaaagctatatttgaatgttttttg gttgaaaaattcgcgatttttagcggtaaAAATATGccattgcaaaaatt gagctttttttctacttatgctataacgttcatttttacactagtggtag ttcaaccttaggttaagaagtttgttaaatttcgaggcaaacagaaatac cccttggtagcacttttctgtgaaatatcaaatctccaacttattactaa aaactaatctcaaatatagcgcttttgattctctaaaacaagcaaaaaaa atttccatagttatatttgactatcaaaagctagaggcattcttgtttcc actgccaattatatctggacagactttagataTAAACCCTCCAAAGAAAT AGAAATCATGGCGCTGACCAGTAATTACACCCCCTTTTCATAGACCCGGT GAGAACCCCGCTGCActtaaatttttggccaaattttaatttcgcgagct gaaaacaatataatttctatccccatctgTCCCCATTGGCATTTCGATAt taattttcatccccactgtggTGAAAAGTTCTCAGGGGTGgggctgtgac acaggggttGTATAACCCAAAACTTCGGTCTTTATCGAAATCATATACTG TATTTTATAAATCAGCTGTTTCACAGCAGACTTCAGACCATCAAAAATCT CAGcttaaaactttttgttgaaGTACTACTCGCGTCGCGTGATTATATTC AGTTTTGTGTTATGATAGAATAAGATTttgatatcaaaaataaaaagcaG GCGAttaactttgaataaaatgtaaaatagaTCTGATGGTGAGGTGAAAA ATCTCTAGTACATGAGAAAGAATCATGTCGAAAAGATATATTTTAGACAG GTCGGAATTTCTCCTTTTTCATGGAAAGAGAAGAAGTCTGTCAAAATAAT TAAAACCTTTTAGGTTggtaaaatatttgagaaattcACCAAGCCAGTCT AAGCCATTAGAAAATgctgtcaaaatatttttcacttaaTACCCTCTCAT TCGTGTGGCCAGACTTAAAATAGTTTCATGCGTTTATGATatcctttttg aaaatcaaatggGTTGACTTATAAGGTAGCATAACTATTCCTGTTCAATG TCTCGAGATCTTCAGTCAACTGTCTGTTTTCTAATAAGAAGGTAAGTTAA CAAATGAGCTGATTTTATATAAGCTTGGGGCTACCACGATTTGGAGCTAC GTTTTGGGTGATCGATCTGGGGACTGAGCTTATAattcaaataattttca attttcaataattttgataTATCAAGTTAATTTAGCTGGTCCTTTGTGAC AATGCATCATGTTGATATATTGTTACTTTATTTTAATGACCTTGgtgatt attttgttttcaagcatacttttttgaatttccgcTCAAAATTACGCTAG AGGCTATTTTCATAAGCCCCACCCTGAAAATGGCTGAAGGCTAGACCTCT CTGCACTCTATGACGAGCAAGAGCTTTGTTTAAGGTTTTATTAAAGTTAA ATGAATTGCCGATGTCTCACATAGCACTTGCAATTATTTTGTATGGTATT TGTGGAATTTCCTGCTTTGGAACTCAAGGTGTTGCAATAGGGAGGGGCTG ATAAGTTAAGTTACATATGGCATGTTAATATCAAATCGAAGTTTAGAATG ATACCACTTTCTCATTTGAGCTTTGGAAAGCCGTGGTGCTGCAAGGTTTG GAATCCACAGCCTGTGTCTGACATCGCCAATTTACATTTTTGGAGTATAT CTTTATGCCATCTATCGTCGTTCGTCAatgagttttgaaaatttcgagaa CAGTCTTATAGGAACAATGAGGTTCAAAATTGCTGCaaaataagaacttt ttgagAACAATACTGAGCCTAGGTATCTTTGGGTAAGGTATATCTTTGGG TAAAGTAAAggtcaaaattgttaaaaaattaacaaaagagTTCAATAGga gaagaacaattttaggctcaaagtgccaaaagaaTAACAACCGCCGAGct tcgtcaaaaaaaataataaaaaaaggaTTGTACGCCATTAATATGTGGAG AGATTAATGAACTTTCATACTTTCTGAAGGGCTTGTTAAAAGCTCAACAC TTCAATTAACAAGCTCTTAAAATACTGTTAAGGATCGATTTCAAACCTAT TTAATGAGCGATAATGTCATAGGTAttgctttcagaaaaatatataggTA TGACTTTTAACATAACTGGTATAAAAAGTCAAGTTAAAAGAAATAGTTCA CATTCTGGCCATATCATCGTaattttagtttgttttgcttgttgatagat acacgtttttataagaacatcctaaattttttgaagccttcagaagTTTT TAGTTTTACGAGTTTCATCTGGTTTCATGCCTAATTCATGCCtagttctt aatttcaccatttcgtAAGTATTTTGGTGGAAGGCAATTTGCTAAGAAAT TGGGAGTCCATAGAGCCTTAAAATGcgcttaacttgttcttaatatcttG GCACTTGAAATCTGATGTTCctatatagcttgttcttataaaaaaacgtt tatgtACCTACCACGTGATTAGTTTTATTGTTTCCGTTACGTCTGGCTGT GGTTTGTGTTTCGGTGAAGGGCCCTTCAGTGACAAGGTAAATAGCACTCG AACAACACAAATTGACAGGCTAGAGAGAGGTGTTTGGGTACACTTTATTG TGAAAGAATTGTTCCATTCTTTTTATACTagagagtttatgtatgtgcgg tttttctgcgacggagacgtttagcttctgatttgtctaTATCTTGAACG ACTGAGGATACAACAAAAAATCGGCACTTTTAAcgtcctcgattttgtgg gTAAGAAGTGCGGGTTATTCCacatcgcttcagtcactccgccGTCCTCA ACAGTGCAAATACAAACTCGCTATTTACTCTCGAGTAAAGtgttgtgttt tctttttgttcactTTGTGATAATCCGTCTGGTGTGAGAGTATTGTTTAA ATCACATCTTGATCAATTTGTTGCTTTCCTTTGGATGGACCTTTTGTGTG GTGCTTCAAAGTGTGGAACCAAGAATTCTAAGACAGGTCAGAAACTTTTT ATCAAGATTGAGGTCAAGCAAGAATATTTTAACGACCGTTAGATCCTGTG GATTACTGTACTCAAAGACTGTTTTCTTGGTCAGACTGAGGGGATCTAAC GAGGGCTCTGATTTTTGAAATACCGAAGAATTTCACCGTttcagtttgtt tgtttttgaaccatttttccGAAATTCCTAAATCTAAGAATGAAATCTTC TCTTTACCGGGATTTTGAAATAGGGTTAAAATAGGGTTAATTCCGATACC GAACCTTACTTTTTGccctaaatattttcatatttttgcttTCTCAAACT CTAGGCGAATTATTTTATAAGTTATCGGGTCTATAAGTAAGAAACTGAAA CTAAGTGACATTTAACATTGCTTCGGAAGAATAGTTTGTGAAATTTATCC TTACCTACTTTTTTATCTCAAGATGCAAGATAGATTTTAAAGGTTTCGTG AGGaccatttttaatttgattaatCATAGAGAGAGATACGAAAATTGGAA GATATGGAGGATTTGCACGAAAAGATGGATATCGAGATATCTCGCTTTAT TTACTAAAAACATCCagtatttttgaagccttcggctGTTCTTAAGccta taaatgttcttaacatgttcttattttcactatcttTAGAATAGTTTTGT GTAAtttgtgcaatttcttaagaagtTTCGTGTTTCAGAGTCCGCGAAAT GTTAAAaacttattcttaacatttagGCTATGACAGCCTAAtattcttat atactttgttcttataaaaaaacatggatATGAGGAATGAGAGATGAGAG ATGAGTAGGTTCTCGTGATGGTTTGGTTCCGTTGTGTTTGAAAGTTGATA ACCAATTCTATCACTTCTAATTGAATTAGAtgcaatgtttttaaaatttg ttgATCTTTTGTGGGTTAGCACGAAACATGTGTGTcgttttgatcaaaat ttttgttttaaaatgttaTGGTTACCAAGATTTTGAAATCTCTTTTTTCG ACTCTTAAACCTTTCAGTCCGTACAGTGTAGGGCATTGATAATATTCATA TTCTGAGGttatctttaaaatttatttcttCTGTAGATTTTTGCTAGAAT TTTTCCttgactttattacaattttagtgGAAACGAAGGTATCAACCAGG ATCAGAAGTGTGGTGGCAGTTGGCGGGCCCCCCAGCCGATTATTTTTGGt cgtgaaaaagtgaaattacAAAAGGCGCCTCCAGCCCCTTTGCTTTTTCG CGGCCAAAAATAAGCAGTTCTCAACCaagaatttgataaagtatCAAAGA ATTTTTAAGCACTTCACTTaagcaaaattgggtacgggacGTGCCGCTGG GCATGGTccctttttaggctctgaagtcATCtcacagggtcccaaattta caaattttcaagaaatgtggatcgacttttggttattttgaacaatttcg tTACGTTCTATCAGAGTCCAGAATTTACCAacatatctgacagggttctt ttttcaaactccagcggcacttCCACGttggccgtcaaggtcagtgccct cCCTTGAAGTAGTTCcaaacttattttttcaataagtGACACAAAAAGCT ACTTTGGAGAAATTGCCTCCCGAGTTTGCCCCAATTTTAGTCAACCCACC ACGCTTCTGCCGTGGAGTATCatttattgtttttctttacCTTTTAAAAA CACTTCATGACAGCCTCTAAAACACGTGTCACTTTTTGGATTGGCCCTTT GTCAGGCTTATTGACATATTCCCAGAGTAGTCAGACAGGGTTTTCGTCTG GTCTTGTCAATCACTGTCAACTTATGGAGGGTGATCTTCTTTCTGAACCA GTAATGGGTGCACAGATTGTCCATACGAAGAAAGTTTTTCGTTCTGTTTC TTATATAGATCCCACACGATCTTACCTTGAGACCTgtgtaagtctgcgac cgcagtcggaggcgacctgAAGGCTGCGATAGCTGTTTACCCGAAGGCAG AGGAGGGCGCCACTTTTTCTCCATGGATTCCTCCACTcaccttgatcctt ctcttaattgatgagcatcaagcagagaggtatcaagtaTCATTTTGGAA ATccttggtatgacccggctgggggttgaacccacaattTTGTCCCTTGA GACCTACCAGTGGTCCTCTTCCTTTTTTAGGTTCAACGTTTTTGAACCGG CAGCATATAATCATAAGTTTTTGACGTTTTCACGTCGGTGTTTatgtaga ctagagtctacttctggctgaactttgcttttaattttttatgacgctga gtccagtgaagtagactaggagcatttgacgaggttgccattttgaaaga aattattAAAGATCCAAATAACTAAAAAATACCTTCTGAAACGTCTAAAA TCTGGCGGCCTGTTTTACAGTCcacctaagcaaaagcatattaccatata ctaccgggccacttaattgcgccatccagtctataaaaaagcttcaagtg gaccccgggctagcgTTTATGTTGATGTTCCATGTGAAGGAATGTACCTT TCATAAAATACGACACACAGAGAAGCTGTTCATACCTCCATCTATTTTTA CAACATACCACTGTACGCTCTTAATCCTATTTAATTGATCTATTGCGTCa cttttttctcgttttttctactttctaaatagctaagaatctttttttct tcgaaGCAATTATTTACCTATTGGACGCCTAGCAATCAAAATTGTACTAT CCCAACTATGTGCTGAATTATTGAAAGTATTTCCACTCCCACTATGCTGG TGTTGGGTGCTAATTTTGTTTCGTAACCTTTAAGAGAATGTATATCTTTT TATCTAGCATTTTACTATACCGAACTAGCACAATCTCCTCGTCATCTTAC TTTTAGTCTTTTTCCTAATTCATAAACCATGTGCTTTCCTCTTTCGTGTA AGAACAACAACAATGTGACCGCCTGATAGATATCTAAGTACGGTCGCATT ATTCACAAACCAGCACTCACATACCTTTTTTGATGAAGTCAGTGATCTTT TACTCACAAGATTAAAGTCAAACTTAGGAAGTTTAAGCTGATGGAAGCTT TATAAATTCAATAACCTTTCAACTTTTCAACGTGACGCACAAAGTTTTAT CTGAAATGTCATCAAAGTCGGTGTTCTCTTTGAAAAAAAGCAATATGCCT CAATAACTATATTCTACTTTGCCAAGCATCGAAttaagttttcttaaaac aaacACTGCTCAATATTACCTtttctaccgggtgcaccaaaaaaagtata caactttttcaagatattgtgaacctcaggatttaaattttttgttcatt ctttttttatcgtatagaggatgctctaacttgaattttgagctatcata taATAAATTTGAAAAGGTAGTTCGAaagctatttccaaaaaactgacttt ttttccatgtcgaaatttcaaaaaattattaaaaacagcgagcaaacttt tctcttgacacttaccttTTTTACACataaataccaaaaaaatgcaactg tgttcatcgAATCTCGTtacggaatttaagaatatggtaaaataaGCTAT TCCCTtgtgggataatatttttggaaaggctgaaaattttttctggaaat ctCCAAaagaggttttgatgttatgtgtgtgctatgtgagaaaacttttg aaaaaatagatcaccattccttgactagttgctcaaagaacttgggtttG CATTGAGTTTGCTGGTGTTGGAAATGTTCATGACGTGCAAATAAGATGGa caaactgttggcaaaatataagataagagaaaaaggaataaaaaaaacaa tgaaattgtgtttttgtcattttgtcttatttatagcgcgagtgctgttt ttaatgattttttgaaattttgacatggaaaaaaagtcagttttttggaa atagcttTTGAACTACTTTTTGAAATCTAAtatatgatagctcaaaatat aagttagagcatcctctatacaataaaaaaagaatgaacaaaaaatttaa atcgtgaagctcacaatatctcgacaaacctgtctacttttttttggtgc acccggtatagcATGGCAAATCTGTATTTTATACAAAAAACAGAATCCAT ATACACTTTTTCTTATAtagaaacaattttataagaacaacgaggctcaa aatcgccaaaaaataagaacaatttgagaacgatgctgagcctgaaatta cttaAATTCAAGCAAATTAGGGGTTAAAGTAGCAAAAATTGGATATGAca cctaaaatacctcaattacatcttaagaatatgataagaacaatttgagg ctcaaagtgccaaaaaggAATAATAACGACCGAGCCTCAGAAAaagttta ctggttcttataaaaaagtgtatacgGTTAATACTCTACAAAAACGCAGC GTGTTTGCGCGTGCAGACTTTCGTCGTTAAAATACACGGTTTTTAATAAG AACGGTGTTTTTCCATTCCATCATGGATATTCATCTTTTACTGTTATACT TATTCTTAGGTTAGATTCAAATTCAACCTAAATTTATCATTTAATACACA CCTGaagcataaaatgacatttttgtgatGAAAGTTTTGAGCCTTACTGG GGCAATTTACAGTTATAgtcaaaatgctctaaaaatgacattcttagttT CTGTTGCCATATTCTATGATGATATTTTTAgcatattcttcatttttcgg ccaatttcatattttcttataaaaaagcgtgtacatcgCAGTTCATTTCA ATTAAACGATCCATTATAATCTGAAGGCTTGTTGATCCAAAAGGCTCAGA ATCTCCCTATGAAAGCGGATCGCTGGTATTATGCTCTTGCTGTTTTGTAG TTTTTTCAGTCTCcaaatgtagaaaaagaattgatGAGCTTAACTATAGG AAGTATAGTAATTCAACTCCAATGGCTCGCACTCCAATGCACTGTATAGG GGTTTAATGTGCTCCCGCCGATCCGATAATACAGGTGTTgttaagaaagt tttaaatttctgATTTAAAGTCATTGTTTAATGCATACGTAAATGCTTTC GGACTATAAGGAACACAGCCTTATTATCAAACACTTCAGACATTTTTACG AGCACAATTCAAGGTCTGTCTGTTCTCGGTAGCACTGGTAAAGAAGTAAT TTTCAATAGCATTCTCAACTAAAATGACTGTTTCGACGAGGCTGATTCGA AGCTCAGATAGTTCTTATAGTAAAAAGAGGTTTTCGAAGTATTGTATTTT AAGTGCATCCGATCAAAGCAAATCAATTCATTAATTGTCTCAAGAATCAT TTCTTGTTCAGTACATTAAACCCTAGATTTGATCGGATTAGGGCTAACGG GATTAGACATGTTTAAAGAAgtatgttttgtttgttttaatgaTATTATT TGTATTGGTTGCATTCAATTTCTTCCTATGTGATTATGTTTTGTGTTGTT TGTCCCTTTAAATATGGCATGTTACACAGATCTGATGTGATCTTGATCAA TTGTGATTGTAGTTGAGACAAATCAAggtaatttgatttttgaattttga tttctcTTGAATTAATATTTTAATTTGCTTGAACGTTTTTGTCGATATAC ATTGCGTGCTAAGTTGATTGAAATGTAGTGCCTACAGAAGATGTGATTGC TGACGGCTGGAGCTTATCAAGGTCTTTGTTCACATTTTCCTTTAGCTATG GACACGTGCTTTCGTGATTTTGAATCTTGTCCTTTCTAACCGTTCGTTTA TTGGAAGGAGAGTCCATGGAAAAGTTTTCCTCAaaagaggggcgtttatt cgaggggctGTTTAAAAGAatgggggcgtttattcgaagtaatacgttAG TTATGCTCGTCCATTCGTCCTGAGTTCGgctgaaaatgacgtcattgcaT GTTATGCTGGACTGTTCAACCAGCATATGGTTTTTGTGTTCAAAGAAACG TAGGAGCTTTTGATAACAGTCATCCAAACTATTCAAACTGCGATTAATTT GCTCTGATTTCTTTCTTCGTACCTTTCTCTCAGCGGGTTCATAGTACGAT CTGCATTTATTGCATAAATATGTGTTTCTGATTTTATGGTATGCGATGTG CCGTGATTGctcattttaaacttttttacatACCTCGGTTAAAAATGACA GGCGGATTTTCGATGGAGATTGACTTGTTAAGAATGATTTATGGTTTGCC TGGTTTGCCGTTACCCTACCCGCAAATACAGATTACTCATATATCACAAT TAATCCGCAATGGGTAAAGACTCTCTAAAAAGAGAGTAACGCCTTAATAC CAACATCACATTTATTATAGCCCACATTTATGGGGGATGTAGGTCTTTCG GAGATTTTACCACAGTCAACTTTAAGTACAATTGAATGTCTCTGAATAGG TACTGTATTGTAAAATTAAAATGCTGCGCAGTTGATGACGGGtttctgtt tctttttttcaactGTCGGTTCTGAACTGGATCGATATTAACAAAGACTA CAAAGCCAAAAATagatatttcaaattgaaaatttggtaGGGCCTATTTT TCTTTCCGTGTGATTTAGATAGATATAATTCTGAAACTAAAAACAAGTCG ATTTTGCGAAAACAAGAAGTGTCCTAGCTAGTAATCCTACGCTACAGTGG CTTATTTTGCAAGGAACTTCCCATCAATTACGTAGTATAACCATTAACCG TCCGTGTAAAAATATGCGAACAACCAGCTGATTCGCAGCCTGTTTTCTAT CCTCGATTATAAAACTGTTTCTTTAAGCATACCATGGAGGTTTCGATTAA ACGCCGAAGTGAAATCTAGCGGTCTGGGCTAACAAAAAGATTAGGTCAGT CGTGAAGATTAGTCTTTGATACTCAGAAGGGAAATTTCTCCATAGAAAGT CATTTTCGGCTTCTTTGCGGTTTTAAAGCTCTTACAGAAggtaacttttt ttaaaaaatgacacgCTTTTTAAAAAGTTAATATGTAGGCACGCAAGCCG AAAATGTTGAAAAgttattattttgatgtttcgCGAACTTTCATTTTCTA ACAAGAACCATATTCTATAACCTTTCAACAGCAAGAGTTTCGCAGGAATG AATCTCATGAAATACGTTTCATTTGCTTTCTCATTAGACACAAAACCCTT CAAAACTTCAAGTCATATTAGTTCTATCTATCTTTCTATGCTTTTATCAG ACTCTGAACTTTTCCAAGGTTCATTCTTatacaaaattgttcttatagct ttttaagcagTTCAATACATTCAATAAAAGGTGACTGATTAAAATCCGTT TTTTATGTCTCCGACAGAACAGTGTCATTGCTTTGTCTTTAAAAACTTGA CAAAAGTATTGTCCCTTTAAATAAGGGCTTCTTTTTATTCTTGACGCAGg acagtttttttaattttctttggtATAAAACCGTCTCTTCTTTCTAGCTC AGTAGGAtctttctactttttttttctctgtCAATCATCTATCTTCAAAA GAGTCTCTCGatcattttgttgttgtttttcaatGTTGGATGGTAGGGTG TTAGGATGGTTAACAAGAACTTGCGCCTATGGTCGTATTTTTACTTTATA GCATTTTTGACGGAATATTCTATGGCTTTATTAATTGTTAGAGAATGAAT CATGGCAGAGTTCACAGGTTTCTCCtggtttcaaaatatcagaatgTTTT GGATCAGGAAAACCTTTTTTCAGcctttttgtttgctttttcaagAATGA AGACCTTCACTTCTATGTTGGTATTAGATTTGGTAACTTTCTGCTCTCTA TGAATGAGTATTAGATGTCTAGCAGAAGGTTAGAGGACTTAGAGGCGAGT CTCTGGAACATCTGGCAAGCAAGAGAAAGTGTTGTTATTGGATGACTGAT CACAGGCCTTTGTCATGGTAAACAACACTCTACAGtcccgtaggaagcat tttcatattgggggggggctaaagtttagtgacaccgcgagggccaacca tggtttggcccgaggggtgaaattttgaacatttgagctctagattgctt aaaaatacactcaaaacatgcacataaaagacaattatgacaaattaaaa aagaaaaactttgcattttgcaaaataaccATTTTTGAAAAAATTATTGG GGGGCATAGCCCCCAGTTGCTAGGCACTGCTCTACTTGTCGGCTGTGACG CCGGGTGACGGCTTTAAATCTAACATAGGGCGCCAGTAGATTTCAAAGTT AACATAAATTGCCGTTGAACGAAGAAGTGATGTACGGTTTCACAGCTCAG CAGGACGTCTGTTACTTGCCTATTTAATAGTTTACTTGACTGCGGCTTGA CTGCTATTGCGTTTTGTTTCGGCACGTATTCTTGCCTGTTTGGGAGGAGC AGATGACCTTGATTGACATGTGTCTTATCAATATTGCTTTCGATATTACT TTAGATATTATGTTCAAAGGTATGTTCTATTCTTGGCCTCGCTCACTCTT AATCACCAATCAAATTTCAATAAATGTGCTTCCTCTTTGAAAGAGAGATA AAGATCTCGTTCATCTGAACTGTGCCAAGAAATGAGATCTTTTTGAAGGG TTAGATAATCTAGATAATCCTGTTACTTTCTTTATCCCCTCCCTTTCTTA TTGTTAGTGACGTGTAATATGCCTTAAATTGATTCCTAAATCAATCGTCG CACTTGGGTTGTCTCCTTCATGATCGTTGGTGATGATGTTATATGGTATA TGATTGTATGATATGCGATGTGCCGTGATTTACTTCATGGGAGAAATAAA CTCTAAAATCATCCCCACTGGATTTTTTGAGTTTTGAACAAAAGAATTTC TATCCCCATTGGGATTTCAATAGAAATTTTCATCCCAACTGAGGCAAGAA GTTCATCGgggtgtgagacaggggtgtacagaAAAGTCTTTGACAGTTAA AATACTAGGAGTCGTTTTCCATAAGTGAACGTAGATTGCTAAGGGAAGAA TTTAcgaaattcattttattttgtctATATTCTCTTTGAAGTTTAAGAAA TGTGTTCAAAAATGAAATGTACCCCCATCTTTCATCTTCGATAACTGATA TGATCATCATCTGcatgtttttcataagaatattcAAAGCCATCGATGTT CCTAACTTTTtggactacacgcttttttttttataagaatggtgtttttt tcatttcatcatggatattctcaactttttggcgaaaatcatccaaaagt attcttacggtattcttaggttaagatcgaaagtggcaatctacaggtta aaatgcatgaaaaatggcattcttaagtTCAGTtgttaaattccatgatg gtgatattcttagcatattcttaattttttggccattttcatcatggaca ttcttataaagtgtattcttataaaaaaaaaagcgtgtatatgcctaaag atgttcttcttattttcaccattttgagagtatttttgtgcgatttccta agaaattggagTTTTAGAGCCTGAAaagtattaaaatgttcttaacttgt tcttaacattttggctgtcgaagccttatgttcttatgtaaaAACGTGTA CGATCAtcatctacacgttttttttattataaggaacacgtttataagga actcgaggctgaaaatggtccaaaaaataaggaattgttaaggaactgct caggctgagaataagaaaacaagttttaaggaatccaatttttgcAAATC CAAACTTATAGCAGCTATGTagataaggaactcgataattTGAGGCTGAA ACTCTCTGCAAAAATAAGGAACttcaggctcagagcaaagttaaggttcc ttataaaaaaaaacgtgtatcatctAACTACTGTTACCTTTTTGATCGAT TTTCTGATGGAAGAATTTTTCTCTCTGTTTCTCATCTTCTCTTTCATTTC TTCATTAATAATGAAAGAGTTATTTTTCATCAGAGTAAAACcctcttttt cacttttttcacacCACGGTGTGAGAAAATACATGGggaaaattcttctt ttcttttttgcttgttATGATTGGAATTTTGTTTGATGTGACCGCTAGGT GTAaacatttttcagttttcaattttttgaaaaatgttatttttgtactT GCTCAACATTTGAGTGTTAAGTAACATTATTTGAAATATCTTCTTTGGTC GATCGCTTCAGTAGATAGATAGAGTTCAAATGTGGATAGTCCAGAAATCT AAAACGTTttgacagtctttcgattgttttttacGGGGTCCACGATCAGC CGTCTTTACTTtctatgaactgaacagaaCATTGGAAGAAGCGGGGATTC GAATCGGGTGCCCCTGGTTTCTGGCGCTGGCACCctgaccactcggccat tgcttATTATTGCAGATTAACCTGAGATAAGATTGTGATTGTATGTTTTC TGTCCTCCACGCTGCAGCTCTAAAGGGATAGGTGAAAACAAACGATATTT AatcgattttctaaaaaagtttaattttccaTCTTGCGTTgaatgataca cgttttttttataaggaaccttaactttgctctaaGCCTGGAGTTCTTAT TTTtgcagagaatttcagcctcaaagttccttatcaagtttcttatttac atagctgctaagtttggattcgcaaaaacttgattccttaaaacttgttt tctttttctcagcctgagcattttccttaacaattccttattttttggac cattttcagcctcgagttccttataaacgtgttccttatataaaaaacaa cgtgtattgtGAACAAGTATAGTTTGGGCTTTGGGTGTATTAAGGGGTGA CTTATGTACGCATTGGTTACGTTTTGAAGGATCGAACCTTTTCCTACTGT ATCGAATACGTAATAAAGTGCAGCAGAGGTCTTAGAATATTAGGGAATTT GACTGCCTTCAGTCATtacacttttttcataagaacaatgaagctcaaaa tcgccaaaagataagaacagtttaagAACAATGATGAGCCTGATATtgct caatttcaagcaatttaggggttaaagtagtaaaaattgggtatagcacc taaaatacctcaattacaccctatatataagaacaatatgaggctcaaag tgccaaaaaaaataagaagccgagcctcagcaaaattttaacggttcttt aaaaaaaggtgtGTTTCctctgtttttttcttttgggtatcaattttttc attttttcttcttcattactTGCTGTGAGAGTCGTAGTTCAACCTGGGAC TGGGACATATTTCTGTTACAAAAAGTCACGTACGAGCtaataattatttt aattatttgtcCCTGACCTAGAAAGACCCCCctatttatgacgtcacaaa attaTATTAAAGTAGAAAGAACGCAGCGTGAGATAGCTTGTTCAATATGT TGTCTGACAGTTTGATTTGGGACGTTTCTATgtgaaagaaagttttaaaa agtaaaatcttgCTGGGATTCGTCTCACAACTCATCATGGGAAaagaagg aaaaagaagaagaaaaatggaaaaggaAGAATGGGGAACAATTTCTTCAG CAGAGTAAACAATGCAAACAATAGATAAAGATGGAATTTTCTCTAGAAAA AGGGGGAACGGTTTTTTCGAGAAAAGTTATAATTTTTATTGAGGTCGCGC AgttgaaaatttctaaagatGTAGGTAGAAACGTTGTGATCAGTCGATGA TAGAACCTTTCGAAACAGTTAAGAAACGTTCGGTAGAGATGTGAAGAAAT TTCCATATCTTTCAAGAGAGAGTTTCTATAACCATGAAATATCCTGTTCA TTATAACGTTTTCGCCTCTGTTCTGTACATTTCTTAAACCTTTCCGATGA TCTGATGAAAATTCTGTTGAATTTTTATGAATGGTTCTCTCTGGCTTAGT CtagaagctggagctcaactactttttgcctttaatgaTTCTGATGGGGG AGACTAGATCACAGCGCTaccattcaaatcagaaagcgaagatagagTAA GGCAGTAAGGCAGACTGACTATCTCTGGCCAGTATCATCGATGTTTGCTT ATTTTAGGCCAAGATGGGGCCAAAATTCATCATGGGTTAAGATTGTTCCC CAGTAGTTGATTTTCAATAAcgtttttttcactttctgtTTCGTTTTAGT GGTAAGAGGAAAATTAGCGCGCATCGATTTTGATTTCTTACAAACGTCAC GCAAACAAGAAGATCGAAACGTCGGCAATTTGTTGGTCTCGGTAAGTCAT TCTTCAttcatttattcaaaatttgatttgattcatATATTGGTTCAAGT AATCAAAAAGAGCGGAAACCCGTCTATCGCTGCACTGTGGAAATCTCAAA AAACACTATAATTCTTTGTTCAACAGATTTCCCTTGTTACTTTgaagatg gggggggggggattttagCCAGAGCTTCCTGCCTAAAACCCAAAAGAGTT CTGCTGTCACTATGCAATACATAAGGTTGAGTTTGACATGATATTCAGTT GTCACTTCTCTAAGTCCTCGACttgctagtctgaatcgcagacctctgcA AAAGTGGTTGGAAGTATTGAAGCAAGAATCCGTAAGTGGATGCTAGCAGC CTACCATCTACTGGTAACTGTCAAAAAAGGATCCATTTGAAATGAACAGT CTCGAGAAAAACAAATTCTGCTTCTTCACTGCCATCTTTTTCTTGTGAAT CAAGTTCTATCAAGTTTTCCTGGTTCCTTTGCTCACTTTGCTCAACGATT TACAAATAAAGTCGTTTGCAAAAAAGTCGTTGTTGTACTGTAGCCATCTT TATTCGTGTGCTCGCGTTTACATCTGAGTGATGTTGATTTATCAATTTCC ACCGATTCAAATGTTTGTGTTATTCTCCATCATCGCTCTCTGTTAACGTT ATGTTCGTTTGTTTGTTTGGTGACGAACCTTTTGACGGAAGTTTGTTCAA CAATCTAACATTTgaatgtaatgataaacaaggAATTGTAAGGCAGAAAG GTTTTCccgagtacacgttttttttgtaagaacatccaaaacttttgaag ccttcggatgttcttaacttttttaattttaagcctaaaaatgttcttga catgtttttattttcaccattttttgagcatttttgctcatttttctaag aaaccggctgttttagagtcgacaaagccatcgaagccttatgttcttat atagtttgttcttacaagaaaaaaaacgtgtatgtcctttaaataatttt tgaatccCTAAACATTTGCTGGAAACCATCAAAAGTTCTTGTCTCCAACA TAAGTTTACTATCCtttaaaaagtgacaaaaatgatTATTAATTATTGTG TTCTTATGGAAAGCAAGAAAAGTCTGGGGGGCCAGTTTTAACGAACTGTT TGTAGTCAGTCGCGTGCGTGTAGAGAGGATTTTCTTTGATTAAGGCTCAG ACTACACTTGTAATCATCCGTTCGCCTTTCTCACTGGTTTTTTTCGCACC TCAGTGGAGCATAACAGACACACTTATCGCATGTTATGATGTTTCACACA TATATGTTCTGCTCGCTATTATGTTTGGTGTAATGTTTGTTTGAGTGAAG CGAAAGTGTTTCTGGTTGTGTGTGGAAAATTGATGTATTTTTGTGTGATC TCGCTATGAGCGCTTGTGCGGTCTGTGGCTATTGAGTGTGGTGGTTTTTC GTCCAGGATCTGGAACTTAACTCTTCTTTGGCTTTGATATCTTATGGTGG AAAAGAGGAGCGCTATcaagaaatcagaaaacaaaGAGTGTTACGGTAAA CTGACTAGGTGGTTTTTTGTTGTGGATTGTATTTGGTATTTTCTCTTTAT GGAAGAATGCGTTATCAAATGTTCATCTTGACTGGTGAAGAAGTAAGTCA AAATCATTAATTTGTAGTAGAGTGCGGTGGCAGGAGCGACCGCTTTTTAT CACCCCCGTCTCAGTTATGAGTTTTTATTAcgaaagatttttgaagcctt cagatgtattattaactttttgagttttaagccttaagcttaaaaatgtt ctttacatgTTCTTAGTATCGCCATTTTGTGTCCATCTTCCTAAGAAACT Gggtgtttttaaaatgttcttgacatgttcttaatattttggccattgaa gtcCTATGttctgatacacgttttttttataagaacgtcaaaaaatttca aagccttcggatgttcttagtcttttggatttgaagcctaaaaatgttct ttttaaaaaggttcttattttcagcattttttgagcattttgatgtaatt tcttaagaacatgcatgtttttaagtctccaaagccttagaatgttctta gaatgttcttaaatttttgggcctcgaaaccttatgttcttatatagttt gttcttataaaaaaaacgtgtacatatagtttgttcttatgcaAAAACGT GTAAAGGGTATCATTTGAAGGAAtctactttttgcctttaataTTTCTGA TTCTATCTTAGTGCCGCCTTTCAGATCAGACAGCGAAGATATACTGTAGA TTTTCTGACCATATGGAAAGGGTCGTGATTTATGTTTCTGATTGTCCGAT AAAAGCAATCAATCTTCATCATTATGCAAAAGGAGGAAAAACTTTTGGAA ATGATTATTGTTTCCTGGGAAGGATGTTAAATCATTCAACAAGGATATTA ATAATATGTAAAATGTCAATGCAATATCACTTTCAGAtgccattttcatt ttcctgcCAAACTTTTCTCGTAATCTTTTTTCACCTGTTTATCTTCTTcc tgaatattttcaaatttcataaattttttacacacgcagtacacgttttt ttataagaacatccaaaacttttgaagccttcggatgtccttaactttct tattttgaccatttttctaagaaattgggtgtttttgagtccacaaagca ttggatgctcttatatagtttgttcttataagaagaaaaacgtgtacatt gcaacgtgttttcaatttttctagaAGAACGAGCACTTTAATATTTTgag gatacacgttttttttttataaggaaccttaactttgctctgagcctgga gttccttatttttacagagaattccagtctcaaagttccttattgagttc cttactacataggaaattttgaactttttgccccttgaaagatcaaaatt tggtcaaattagtcccaataaagtacattattttcaaatccacttattct cagcctgagcagttccttaacaattccttattttttgaaccattttcagc gtcgagttccttataaacgtgttccttataaaaaaaaaaacgtgtagtga aGTGTTACCTCTCTGTAACACCTTCGTGagaaaaaactcattttttcgCT TAGTCATCAACTTgttcagtgaaaaaaaaatctttttgaaaaaattcaag ttgAATGAGAAATTTTATTCAGGAAAACTTTTTCACGGAAGGAGgggcta aattttttattcactgtaatcaaattcttattttgaaGGTGTTTGATTGC TGCAATTATCGGCTAATTTTCTCCCCTCTTCCATCGGCGTATGATTCATA CTGttagtttttgtttctttctgtgctcggaaattgaaacatttaatGAT TCAACACTTCAGGGAATACTGGTAATTAATGATAAAAGGTCATTATCCTA CTCTTAATCCATCGTAACATCTGTGGCCGGCTAAAGCACGATAATCTGCG TTGCTCTGTGTTGAGGTACATTGATGTTTTGCATATGGTATAACAAATTA ATCACGCATTGCCAAGTTTGTTGCACATGTAGTAAATTCGATTGTTTATC ACTTGACTCATCAAGGAGTAAGTTTTGTTTTGGATACTTTCTTTCACAAA CGCCTATTAATCTTCTATTTTTAGCTTAACCCTTTTAGTCCCAGAGACCC GCAGAGCGGGTCCCTCCGGGACTCAAATTTGCCGGGCTATATCTCCGGAA GTAAGAGATTTCCGGAACTCTCGTAGCTCGTACCATTGGAAAAAGCATAA AATAGGCTGGTTTTGCGAGACGCCCTTACCCCTTAACCGATGTCTTGCCG ACACAAGACGTCGGTGcgaaacttttaatttttttttcaaaagaagcaaa gcTCTGGGACTTTTCATATCCATGATACTCAGACTTAGACTGCGGGCGGA AGGCACCCAACAGACCTGATTTGAAGTGTATATAGATACTTTTATTTCGT TTGTAATCAATATGCCGTTCGCTGCTTTTCGTTTGTTACAAAGTAGCCAT ATTTAGACTGTGAGCGGAAGGTATCTACAGGCCTATTTTGAAGGgcgctt ttgaatttttttgtattgATATGATGTCTACTGCTTTTCGCAACTTTGGA ACAAAACGAGCCTGCCAAGGACTTGCATATCGTAACGGATGTCTAGCTAT CTCCACAATTTCGCGGGAGGAGGTTCTCTCTATTATTCACGAGCCTCTAA ATATTTGCACCTTTATTTCCTTTGAAAGTTCGTGCTCTTTTTATACTTGT TGGTGTTTGTTGTTTATTAATCAAAAGAACTTGTTTTTGCAAATCCTTGT GTTCGCCCTTAAGTCTTCCACGTGTTTTTAAATCAATATGTCTCACTTGC TAATGAATTCAGAAAGGGGAGAAGGGGGTCTTTGCTTCCAGATTTTGTTT GGATGGATGGAttgtttgattgattgatagGTGTTTTGTGATTGGCTAGC CAGACACCTGTAAGTAATAAGATAAAGACCAGATAAAAAGAGGGGGGGTT TATCAGATTTTAATTGTTCAATATCTCATTTGTTCCCTACAAATAACAAT TTTGAAGTATTCTGAAGATTTTAAAACCGCGTTCAAACAACAATATCCAT TTGGCAGCTGAAATCTATATTATTTTATTGGTTTtatttgctgttttttt ttgtgttttcttttttgttttttttgcatgaatATTCACGTTGAATTAAT ACCAATAACTctccattcaaatttccctcaTCCCATACTTCTCTACACTC CAAGATAACAGAGTCGAACGATTTAGTTTGAATCATCTAACTGGACAGAA CAAGACAACGTTTGTTTTCTTCTCGTCAATCGACATGGTTAACGCTTCGG TGTGATCTCTAATATTGTATGTTTTTCCTTGTCACTGATCTAAAGTTGAA AGATTGTTGAAATTTAACTTTATGTAAGAGAAGTAAGAGTCGACAAATGT ATTGGACTGTCCTGTTACATTTATGAAAGTACCTGTTCATATTTATCGTA AGGAAGTTTGGTCAAAGCTTACAGGAGACTTTGAAAAGGAGAAATTCGTA TGTGAATGTTTAAAGTAAGTCTAAACACATGATTTTGTCGATTTATTCAT GATACATTATGGCTTTTAGAGACATTATGGCTTTTAGAGACATCCTGATC GGGTACATACACgctcttttataagaatgatgttttccatttcatcatga atattcattttgaaatattcttagagCGTTCCTTGCTATGGATCAGATCC CGACCGAAGGATCCAATTTCAACCTAAGGTTAACATGTAATGCatcttaa aacaaaaataacctAACGTAGGCCGTCATCAGTCATACTTAAGCTGGTTG ATAGTCTATTGTTTAAGCCCATTACTAGTCTTCAGTATTCTAGGTCATAT TTACAGAATCATTGACTTTTGTTGACTTGCTTATCTCCACGTATTGTAAG CATAGATACTTTATGTAAAATGTCTTCCTTTTTACCTAGATTTTGTGACT CGTATTTCCTAAGTGCCTTAGGCTCAGCGAGCTTATAATATATGTCATCA GAGGTGCGACTCTTAACAATAAGTCAGGTCATTCCTCATTTTGTTTGAGT TCCTACTTAACGCTAATGAAGTTACCACGCTATTTTCTATACTTAGGATG TTAAGTCATCATATTCTCCTTGTGAGAGAGAGCCTCTTAGAAGATTTTTG TGGTTTTGGTctgattcaaaaattttcggtTCATTCACTTATGAATGAGT TGCCAAGGAAAATCTTACCTCAATCCTCTTTCAGAGAGATGGAGATTACT AAAGTACATGTATTGTCAGATGGCTTGTAggaaaagtgagaaaaaaattg agaaactgTCTTGGATTAAGCATTTCAGTGCATGTAGGCTATACAGTCCT TATAGTGTTATGATCCTCGAATATCCTAAACTCGAATTATCTCAAAGTAA TGTCCTATACATAAGAGAATCGTCAAACAGAGTTGTATCAGTTTATATAA CAAACAGGCCAAAGATCATTCCGGATAATTGGAGCTAATTTGGaaccaat ttttaaaaatagaccTCAAAATTGAGCATCCTACACCGACCAACCACCAA TAAGATGATCATCAGTTCTGGAAGTTTTGATATTGACATTGCAATGCCGT GTGTTACGCAACACCCTTCTCAGTTTTTAAGCAGATGATGATAGGAGCAA TTTGATTTGATAATCTCAAGCAATTGGTATCATTTTGGATATGATGGCTG AAaggagttttttttttccagatgtcattttttcattgaaaagcaGATAA TCTGTTGAGATCTgttctttttgatgtttttgactCTTAGATGAGATGCA AATTTGCAAATTTCCTTGCTTGTCAAAAGTTTGTTGATGTTTTGTGAGAT GTTGTAGACTTACAGAGTTTTCATGTTTTGACGATGTTTTGTGAGGGGTG TCTCTAGTTCATTTACATGCTAACTTTTAATTATAACATGGTATAGAGTA TGCAATTAAACTTTGATTCTCGTGTCTACATACTGTATCATGCAAGAAAA GATGACATCACCATtgaaagatgagaaaaatttgttgaaacaCAACGCTC TCTGTTTGATGAAAGGGATTTTTTTATGTGTGCTAACTACAAAATTCGAT GTTTGAGCTATAGGGGTGCACACTGCTTGTGCTTATTTTACTATAGCTTT TTATTAGGTAGTTTACAATGTAGTGTATTACCATGGCACAGTTATTAGAC TACGCGAATTCTGTAAGGCTTTTTAACAACATACTGTATACCATTAGGTA GTGTGTAGGTGAAACTGTGCCAGAGAGAATTATTCTTTAGATTTGTTTAT CTTTAGTTATTGATAGATAATTCGGTcatataatatttatttagtGTGTG TGACgagtaagaaaaaaaattatcatcatTTTAATCCTATTTTGTATAAT CTTATGGCTTTTCTTTCAAACATTTGAGCTTGACTTGAATATTATGTAGC AATTTTTCTTGACATGAGAAGTTTTTTAGGCCATGAAGTAGAAGCTGACA TTTTGATTCTTATATAGTGATAATAATCGCGCAATGTATGACAGAACAGA GGTCATCATTCTGTCATTGCAATGggcttttatttttgttgtaaAACAAG TTAAGAGAGAAGAAGGCAGGCTTTTcagttctcttttttttgtatatttt ttaagaCGATTTGGGGGTTTTAACAAATCTTTTTGATACTGTTTTATTGA AGGAACGTTTTTAGTTTCATTGTTGCAACTACTGTACTGACAGAGAAAGA GATAGAGAAAAAGTTATTGATCATTTATTCAAATTATCATCTGGCGCGTT TTCTCTCGCGTTTGTATGTGTGTTGATGTTGACTTAACGTTTGGTAGGAC AATTGGTGTGGGACAGTTTTCTTGAGTACAATATGTTCATACTGACGGGC GAACGACGCTTACCGCGTGTGGAGGAAGAACCCGATGACGTCACAATGCA TTTCAAAAGCAAGATACCTCGTCCCATACCTCTCGAccgcaacaacaaca acaatctcATTGTCGtcgataaaaacaataacagcaATTACATTGATGTT CCCAAAACGAAAAAACAGCAACGTCGGAAAACAAGACGGCAACGGGATCG TGAAGCTGTCACTTATCGTCCACCGCCCGCATCACCGGGTGGTGAACGCT CGCGTATCCCATTACGTGAGACGTCCAAGACGCAAATCAACGAACGTAAC ACGTTGCGTGAAGAACTGATCGTACCACGTGGAGATAACATTTACGAGAG ACTTTACACAGACAGGACGCGTAGTTATTCAACGCTGTACGAAAAACCGT GTAGGAAAAATCGGAATCGAAATGGCGTAGCAAAGGTAGAGGTGCTATGT TTTCGTTTATAAATCTTATTTTGGAGGCTTTGGAGATTTCATGGTAGTAG TAGTGTGGTAAAGTGAAGAAGGAAAAAATGTCTATTTTgtcaaataaata ataaaactcatcTTGAGTTTCCACCGGGTTTTCTGCAGAAGTCGGCTCAA GAAAGAACAGTTTAGATTAGATTAGATAACCCATCCATCATCGATATTTG AGTTAACTAATTCTAGAGTTTCTTTTGATTCCTTATTCGGATTCTCAGca taatttgaattattttgtatCGAATTTTCGCGCGAATTTTCCTAACCTCC TTCTTGTTGGAATTCAAagcatttttttccatttttcgcGCCATTTTCAC AAATTGCATTTTTGTCCAATGAAACTTCatcatttttggtttttgatgAT TGACAATGAATGTCTTTACGACTTTAATGTGGATAATGATAGGATTTGCT TGATTAATTCGTTTGATATGGAgaaagtttttctctttctctctAACTGG ATTATTCTTTTCGTCTTAAGTATTCTGCATGCATGTTTTTGATTCACACC CATTTTTTACCTAGATGAAATGTTTTAGCAAGTCATTCAATTTAAGTTCG TTCTCACCTATTCgacaaaatgaaaatcattcTACAGATCTACGTTGTAA TGGTCGAGCTGCCATCGAGACCTGAGTTAGCTACTTTTGGAACTTCTTCC ATGTAACCTCCCATCAAAATTCCTTATTCGGACTGAAATCATCTTTCATT Atgagaaatattcaaaaaactttatcgcgatggaatttttcaaaatcgaa aGCACGTCACATGCTTCTATCTATCTTGTCACCAAATAGAAATTCCTTCT CAGTGTTTCCTTATCTTCCGCAATATTACAAATTTGGATGCTCTTATCTC TCCTAAACGTTACATTGCATGCATTACTAGAATAATTTACAATTACATGA CCTACATCTCATACCATTAAAATGCTATTACCACCATCTTATATAACAAT ACCGAATTTatttatgtgtgtttttctgcgacggagacggtaaggttcta atttgactagatcctgaccagctgaggacgacggtaaatcagcactttta ccgtcctcgattttacgggtcagaagtgcgggtttttccaaatcgcttca gtcactctaccgtcctcaaaagtgcaaacacataaactcgctaattaTTT GGACTGTAGGGCACAGGGTAGGGGTTTGACTTTGTCAAGGGTTCAATTTT GTCAAGGGTTCATGCCATATATGGTAGACGCATCATAGAAacaatgaaaa actttcttgCTTTCCTGGAAACCCTTATTAATGGTTACAGTTAGGTCATG ATCAACTTTCAAAATCACTGAGAATCACCGATCAAGGTTTGGAATATTAG CAGTGAAACAATTGCAGCATCGTTAAATAATTTCCATTCGGAATTACTTG ACGTCAGCAGGGAATTTCCATAATTTGTCTGTattgttttgaagaaattg cTGAACGGATTTCGCCTATTAATTAATGGGTCAGGGGAGACATGATATAG AACATTAATTACTCTTGTGTTTTAATTAATGACTTTTTGTAGAACCACCT CCACGCTGGATGCTTAGGTATTTGCAGACAACGTTTTGCAATTATTCTTT TCCAATTCAAGATGGCTGACTGCGTCTTTCTGTCTGTCTACGTTACATAA GCCATTCCTACATGTCGTTCGTTTtgtttcatcttcaattttcgatctct tgttgttgttgttgttgattttcTGTAGTTTTGTTGATATTCTGTTTTGT tgaagaagtgctttgtcagctaaaattcttgaaaatgaagattaGGGTAA GTTTCTTCTGCGTTTGACACTCCCGTTAATACAAATAATAGTTGCTTTAT ACGATGTTTTATATGAGAGACAGAGGAATCTTCATTTTGagttaaatttg aaaacgagacTGGTTTAGCGTTTTTAGTTACTTCGtacaaaaaaaactat ttctcaATGGGGGGATCCCTAAAATAGCCGACGTAACAAACTAAGAAGAA ATTGTTCCAATTGGTCTGGGGATGTAGTAGTTTTTCTAatgcacgttttt tatgagaaccaactatataaaaacataaggcttcgatggccaaaatgtta agaacaagttaagaacatcttaaggctttgcggaccccggttgcggactc taaaacacccaatttcttaggaaaatggactaaGATACATAAAAATGGAT Ggaaataagaacacgttaagaagatttttaggcttgaaactcaaaaagtt aagaacttccgaaggcttcaaaaaatttagatgttcttataaaaaaaacg tgtagccgACGTAACAAACTAAGAAGAAATTGTTCCACTGTGTCTGGGGA TGTTGCGGTTCATTTCTAATAGCTGAAAGACTAGGAGGAGTGTTTGAATC AAACATCATCATTCCAAATAGCTTTAAAGTATGTTAATGAAGTGAAAAAG AGGGTTGAAGGCGTGCACGTTCACACAGCTTTTGCGTAAGTTTTCTGATG ACACCTCAATgtttaaaatatctcaaattaaTTGCGTCTGCCTGATCTCC TAGGCCTCGTGGGAAAGCTTTTTCCATATATTCAGTATCAATTAACATGT GATTTTCCACTATTTACCCCAATTTTCGATCCTCGTTTTTCCTAGCATGG ACACATGGGCATGCCTTTTATCGCAGAGCATAAACAGTGATTTGTCCACG TGAAAATGATAAGATGTGGTTTCAAATGATGGCTTTTAGAGACCGCTAAT CAAATATAAAGATTATATTTTTCACACGGTGTTTCAGTAGATGACCATAC AGAATTTTCCTTCTTTCTCATTTAAAGAGTGAGAGGACttggttttttgt tttcaatttcgtTCAAATTTTGTGGTATTATTACCCGagtttattttcaa tgtaaGGTTGTCATTTTAGCTGATCATTTTGCTATCAtgtaagtagtaag tagtaagtctgcgaccgcagtcggaggcgacccgaaggctccttgatagc tatctacccgaaagtAGGGGAggacgccactctttctccATAGATTGCTC TACAtgcccttgatccttctcttaattgctgagcatcaagcagagaggaa ccaagtaccattttgggaatctttggtatgacccagctgggggttgaacc cacaaccttgcgcaccgtagccggatgctctaccactgcactacggtcgc ttttCTGTACATCCATCCATTCCCGGGGAAACATTCCTGACGCGTTTTCG GGACCTGCAAGCAGTTTTTTCTGGGCACATTGCTAAAAACGATTTTTGTG ATTTGTATGACTGCGTGGCTCAACTTTACAGCCTTGAGACTGCCCAACAG TTGACGTTATTTTTTGTACATACCCAGAGTCTCGTTTGGTTACCGTTGTA AAGTGTCAATAGGAATGTTTAGCCACGTATGAGAAAGTTTAACAACCATC CTATGGTATTTGAGcgcactttcattttcttttacaAAGAATGTCTTTGT ATTGCAGTTACCCAATCACGCGTAGGTGGAGGAaacattttcatcaaatt ttcaaaagatttttcagaaatgCAATTTCAATTGCGGTGGGTGCCAAGGC TCCAAGGGAAAGAAACAACATTGTTCGAAAAGGACATTAATTGAGTTCTG CTATTTGCATTTCATAACGAACACAAAAAAGAAGGGTCACATTTCAATAA AACCGGCTTCAATTAATTGTTCGCTCTATTTATATTAATTACAATCAACT ATAAAGAGACTTTTGAATTTGATAAGTGACTCATTTATTGATTGATCTCT ATTACCTAAACACTAATTACCTCTACTGTTGGCTATGTTTGTATAAATCT CTTGGTACTGGTGGTCGCTTAGTATTTTAGTTTGTATGAGCTTGATCAGT TATAGTTGATTGACTGACTAATGGTTTTACAAAAACAGGTGATTTTTTGC TCcacattgttcttaaattgttcttatcttttgGTGATTCTGAGCCTCAT TCATTGTTCGTGTAAAACAAAAAGAGTGTAAGGGAGTGTGTTAGTAGAGG ATcaattatgagagtttcttcttGACGGTGACGGTTCATTTATCGAATAA TGGGGTGtattgaatagtagaacgtcgaataagagagcgtcgactgtatt tgagaaaaacataatttttaagaAAGTGTTTTTAATGCTTTGATTTTTCG CGGAACGAAAAAACCGAATAGTCTCAAAAAGAAGAACTTTCTAACACGCT GTTGAAGTTAGGAGGGGAATGTTTGCCTTGTTAACCGTCTCCATTTAGAT TCGATGAGTCAGtcgtgtttttgttttcaatgtaGTCTTCGTGTTGTCTT AACGTTAAACCAAATATTTGCATACACTTGTtgtcttcatcttcattttc ttcttcatcttcattccTTTGGTGACCTCGTTCGAGTTCTtcgttttctt tgaaatttgttCTCATGAAAACTTGGAGGATTTCGCTATGAAGATGTACA AGGttgaaattttatgattttactggagattttgttttttgtttttttcg gaTCATCATTGCTTCTTTGACGAGACTTCTatgaatttacaaaatttcaa gttaGAGAGCTTGCCGAAACACTCCATAGTTTTGCTTAATTACATTGTAC TTTGACATGAGAAATTTAATTGGGCTTCTGGTTATTCATTTATACCTACG TATGTGTTATAAGTCGAGGGTCACCTGGAAGCTCCTTTTCCCTTGGTTGT CTACCCGAAAGAAGGGGAGGGTGTAACTTCTCTCCGTGGAGTCCTCACTT ACCTTTGACCCTTCTCTGTAATTACTGAGCACCAAGCAGAGAGGTGTCAA GTGTCATTTTATGAATCTGCACTATGACCTGACAtaggatcgaacccaca actttgcgcaccgtagccgagTACTCTACCTTTAAGCTACGGTCACTTAT TCTTTTATTAACATATCTTTCCTTTTCACTTTTTCAGATCTCATCACGCA GCAGCAAGATGCATGACAATCTCTTGATATTGAACGATTACGATTTGAAG CGACATCAACGTGTTAAAGATAAGGTAAGATAATTATAGCTTTTCGTACA ACCTCGTCcctgtgtatcccaggctttatttacgttttctGATGCCAGAG AATATGCAAGTTTATTATCTGGCGCTATCAGAAAGTATACAAAAGCCGAT AATATTCGGTGAACGAGGCAGCCACATTCTTTTGCACGGTCCTTTTGACT TTACTTGATCAATGACTGGGATCATTTTACGGCTTAAAGGGGAAACATTT GAgtctggaaaattttctaaagcaAGTGACAAAGTTTCCCATGGCGAAAA ATTGGTCAACTTTCTTGCAAAGTTCGAGGGAGTTGTGACAAAGACTTTTA CAAAATGGATgaagttttccccgacgaaaactTTTACCCAACTAAGTCTA CCCTCTTTAAAGTAACTCGACGTTCAACATGCCCGCCAATTTCTTTTTCT GGTGCTAGATAACTGATAATCAAACTTTTCTCTTAAAATGCTTAAATGCT CCTTTGATTGAGCGGAAAACATGAAAATCTTTCTTAACTGGCCCATTGAG TTTcgagcccgaagggctagaggtgaaactttaacccttctcaggcaaga gaaattgaagccacttaactggctggtctccactttcgcgcgaattgaac gaaaactttttaacgtttttgtaaggtcattggtcggttgaaaaatgaag caattccattggtcaaaattgaaataacggttggaaaaagtttaactttc tttaactttttttttgttcacgcgaaacttttttatgacgtaatcttttc ttcaggcaaaaaaggttgagaaaaaatctgtcgcccatttcgcgcgaaag tggagaccggcttgGCCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN cataccgtcagtccgcaaacccagtgccccccccccccgggggcttGGCA TCTCATTTCTTTGGCAATGATGATCATGTACATAGTTGTCTAGTTAGTTT TGAGAAAATATTAAGAGGAATGACAGATAGGCAATCAGCTTATGCATCTT AACTTCTTACATACCGGCACGCCATACTTTGAATATTTTACGGTTTTATT TCTGTCGTTAGGTTGTTAATGATGTTGATTTGTGTTTAAATGTAATGAGG TCCATAAATCTGTTTGTACAGTCTGCCAGCAGTCTTCAGGCTCCTTGCGA GTATTTTCTCACAGTTCAAGTTCTTGGAAAGTTTTCAAGAAATGGATGAA AGAAGAATTTGTAATACACGTTTgttctatataagaacacaaggcttcga tggccgaaatgttaagaacaagttaagaacaaatttaggGCTTTACTAAc ttaaaacaccaaatttctaataaagttgaagaaaaatattcacaaaatgg taaaaataagaatattttaaccacattttaggcttaaaaaaactcaaaaa agtaacgaacatccgaaggcttcgaaaattttcaatgctcttataaaaaa attgattagtGACCTTGTTGTTATGTTattaatcgtcagccgtgcaaaat tactcgaatctgattggtttagaggagtgcaattaatcgttaattgcact attaccactttttgcacttttcggcggggggacacttttgtccccttatt cttttctctNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNT ATAAATTATGTTTTCATTAATTAATTGCTTATCTTAATTAATGAACGGCa gtcattttgaaaacgaggccatTAAAACAACTTAAGGATGAGTCAAATGG GTAATGGAACAATTTTGTTTGTGATTATTTCGTTTGATGACATCATTTAC ATGAACGACTCCTTGAAACTTTAAAcgtcttttttttaagaacatccaaa attgtaTTGGAGCCcccggatgttcttaacttcttaagttttaagccttt tcttaaaatgtttcaccattttgtgagtatttttgtgcgatttcctaaga aatttggaGTTTCAGAGTATCCACgaagccttaagatgttcttaactcgt tcttaacattttggccatcgaagccttatgtgtACTTATATAATGTGTTC TTAAacaaaaatacatgtttttctttgcgGCAATGAAGTGGTAtcactgt ttttcttttccataaTGACTCGAACCTCCTTGAAAACCTCTCATGAATCA CTCCAGCTCGTCTCCATTTCTTGGTCGTTTATCTTTCTTGGCATATATTC CAAAAGTGGGACTTCATTATCGAATTTCTTATTGAATACACGTTTACATT ATACTGTACACGAACATAAGCCTTTGatgaccaaaattttaagaataagt taagaacatcctaagactttaaaagattttggtggttcttattaaaaaaa cgtgtaaactgAAATTATGCTGAGAGTGCTGTCTCCTCGTTCGCGTTAAT TAGTGTGAGTCATCATGCAGCATTTTCATCTGATGGTGAAACTCTGGTCA AATACCTCATTAAcgtcaaagaaaaaaatgaaatgtccATCTAAAATACG CCCTATTGTTCCGGTTATATGTTCAAGAATACacattttcgaccgtagcc gccaattagcgcgcgggcatttttttgtctgtttttccaccctaaaaccg tcccagtcttgttaaaaaggattggattgagttaaataataaagtgacac gcgcctgaccgctcgactacggtcgaaaaggtgtattgagtATCTGTTAT TAGAAGCCATATTCATCACATATTTGAAATGATTCGCAGAAAATTTGATC ATCTTGCGATCCGTCAAAGGCATGATTTAACGCAGGGACAGTGGAAGGtt agcaaacgatatcatacacTACAAATTCAAACAGGAAATGGATCCTGAAG TTGACGGTAGTATGATATTGTTTGTGAACCATGGTGTAATTTTTCAATTA CAATATTACCAAGTGTCTAAACAATCTATTGGCTATTTTGAATGGAATTC TTAAAGGGAAATGGTAGTAAGTCTGCGAAAcccagtcggaggcgacccga aggctcctcctTCGaaagctatctacccgaaggtagggggaGGGCGCTCT CAATCTAGTATTATTTTGACGGAAAATTTCACTAGCATGTTTGTATTTTG TCTGGCCGGGCTCGGCTTGGACGGTTTAAAACGCGGAAATCAATTTTTCC TCGTTTCCTTTTACACCATTCATTTAAAGTCTTGCTTATGCatgattttt catgaaatatttttctccttctATACTTCTAAACCTATTTTTTCTTGCCT CTAATCCTCTCTAATCGTGAGAGAAGGTTAAAGATAGAGGGACCTGCAGA CGAGTCGCTTTCTGTGTTCAACGTCATTGTCAAAACACACGAGATCGAAA CCctcaacaagaaaaaaaaacgattcTCTATTACAGATTAATCGAAGCCA TCgaaaagcttttaaaaatgctttcTTCCGATGCGCTTTTTATTAAAAGG GTGTaaacatatttttgtttgacCCTTTAGGATTGGTATACATGTGTGAA AAATCCTGGTTAAATTAATATTACTGTTTGGTTTGTCCCCGCTAAACAAT TAAAAGCGGGGTTACAGACTTTAATTAAAACAAATCAGTTTAAACATTCT ATTATATGGGTCTGTCCTTTTGTCcaagtttgttttctttctgaCTTTGG GTCAATATTTTGACATGATGTCATCGATATTGTATGTCAACATCACACCA AACtgaatcactttttaaattgatGTATTCTTCTTACTCACTTGACAATT GATTGACGCGCTTTTGCAAACACtttcgctctccatcgtttgtTTTGGAT GAATATTTTTTGGTACTTTGCATCCCTTACAGAATCCCGATCTCTAATTC GTCGTTCTACTTTTCGATATACTCCCTTATCCGATGAAAGTTCGATTCCC TGTAACTACAATTAACTCTTTGCAATTCGATCTGCAGAAGAACAAAAATT tcatcgaattacagagagtatttttaatatttttcaacctaagGGGACTT ATATTTTAGTACGAATTGTAgaaggttcgaattagagagagagtcgaCTG TGTTGACATGACTGCTGCAAGTTTTGTATGCATCTAAAGTCTTTTCTAAT GAACTTAGGAATAATTAAATGGTGACTTTCGTCGCAAGATATGCAATGAA ATAACACACATATCAACCTTTAAAACTTGAGGAGACTGGGCACGACTTTA CCAAAAAGGAATGGCGTCAAAATGTCCAAATGCGTTGGATTGACTTTCTC ATACAGTCGACAAAGAGTTTTGAAGGCAATCTTTCCTGATAAAGTCGAAT CCAGTCTCCTCATATTTTAAGGGTTGATATCGgggttgatatttttattg aaagCGGTTTATCCGTTTTTTTTCGAGAGAATGAAAATTAATAACCATTT GCCCAGTAGCTTTTATGCTAAAAAGAATAAGTGGGAATTCTAAAACGTAT GTCGAACTGACACATGGCGTCTGTAGCTTCTATGTGATGAAAGCGTAAAA ATAACAATGGAACGGATCCAGTCTAGAGAAAGAAGGAGTGAGGGTtggtg aaaacgaaagtggaatTTCTAGAGGCTAAGGAAAAGGGAAAGAGGGACAC AAAGGAGAAGTGTTTGTTATGATTAGACATGAATTCCATCAAAAGAATGT GTAAATAAAGTCCTCTAGCACCTTTCTTATATATCTTCAATCGTCTTTAA AATAACTAAGGATTGGAAGAAAAACTCTAAGCAAGTCAGATGTTATTTTA TCAACCGTTGTCTGTCTAGTCGACCAGCATTTTGTGGTGttgtaaaaaaa aggaaatttcagattcaggaaCTTTATGGTTTTATGAAAGTgtggttttg aaatatttttttatgaacatgATGTATCAGTTATATTTTGATGACCAAAG AACAAACGAAGTGGCGGCACCCCGGGCCCGCAACAAACGCTTCTCTTTTG ACCCACGTCTTTTGAAGCAAATGGCGTATTTGAGGGCGCTTGAGCAATCG TACGCGAATCCTGTAAGTTTGCCTTACTATCTTGATATTTGGTACTGTGG TATTCTGTTTCTTTGGGAGAATGTTATGTTGAAATGACTGTTTTTTTGGT TGGGTTTCTTTTTCGTCGTTCATTCTTTGATTTATATAAATCATCCAAAG GTTTCATAATCGTTCAGTTAGCCTCGAGAATTATGTAATTCGTGTAGCTT CgttgttttcaaaacattttgtctatttttgttgtttcgaCATGGATTCT GTCATCACGCGCCGTACCCACTACGTCATTACAATGCAAAATCCATTGAC GTAACACGGCCGTATCATACTGTCAAAATAATATGACCTTTTCAATATCA TGTCATTTTGTCTGATTGATAACAGATCATTCGTTTTAAAGttcttttac ttatttttactTAGTCGACTTAGTCTTGAcggtttttttaaatcacagat ctttttaaagtttttttctcgCTGAAGAAATTGGCTAGCTTTCACTCCCA ATTGGCCATATCGATTTAATGGGAATTTAATACTTTTACTACAAATCTCT GATAAGTTTGATAAGTCTGATAAGATAGCTACTACTAACTTTGGTTTCAT ACAGGAGTATTTTAAAGCATTCTTTTATAGTATTCTTGACTTTATACATC AGTTTCTTAAAAGTGTAAAATCAGTATATTGATAAAacagaaatttgaat ttttgtcatttttactTGACTTCATCAGCATGTAGCTCAACAAAAATGAT ATCCTTTTTTATAGGGAACGCTATAGTTTGAATATATTATGAGGCATACT TTTAATAATTCTGTCTTTTCGTTTTCACAGGAGATGAAGAAAGAAATTGA GAAGGAGAACTTCATCCAAAAACGCAAATTGACGAGTGCCACAGATCCTG AATTGAAACTTCGTGAAAGTCAACAACGACCCGCCCCTGAAAACTCACCA AACAGAAAGGTACGGTGTCTAGTCCTAGAGATATTAATGCAGTTgtcgct ctctaattcgattttcaaggagaaCTGGATTttccatcgaataagggagt gtatCAAAAGttgagcgtcgtttatgagagtttcttattGACGCTGAATT TCAACATTGTCGAATAATGGAGTGTATCGAAGAGTAGAAtttcaaattag agagcgtcaactatatAAAGCTAAATGCTTTCGAGGTCTTTATTTAAATC CTTTTCATCTAAATTAGGCTCTTTCTCATTCTCATTCCACTGCCGTCTAA TTAAAATTTAGATCATTTTCATCTCAATTAGGTTCGTTTGCATTCTTTCC AATTCTAATAGACATTCCACTGTCTAATTAAAATTTATTGTTGGGACGCT TTTCCAGCTTTCAGTCAAAACCTATATCCTTTACGGAAATGAGCTGGATC AAACGGCAATTCTTTCGGTAATTGCAAACCAACTCACCGACTGACTGAGA CGCATTGTCTCAACATTCCTATGATCATTGTTTGAATCCTCTCTGAAAGT CGAAGAGAAAGCCATCAGTATTTTACAAGTAGAAAAATAAACTGTAAACC GAAAGGCTGAATTTGTTCGAACCCTCTGAAAATTGAAGCGAAGACCATCG GTAATTTTACTAGTAGAAAAATAGACGCTAAAACCAGCATGCTGAATTAT ATGTATCAATCAAAATACATTCAAACCGTTGACATTTGTAATCCCAGTTG CACCTGACATGTTTTggtttttgagttttgagaaCTCGTTTATCAAACAC AACTTATGGCATGTCAAACTTCTTTCGACCACACGActacacgttctttt ataagagaAAACTagataagaacataaggcttcgattgccaaaatattaa gaacaagttaagaacatattaaggctTTGGCAATTTCTTAGGATATTGCA CTAAAGTACTTACAATTCTATTtgaaaattacttgaaatttaagaacatt ttcagaacACGCGAAGTCTTCAAGAATTTTGTATATTCTTATTAAACAAC GTAGTTCACAATCATCAATCAAAAACATCGTGCTTTCTGTCTTCAACATT GCGTAATGTCATTCCCTGGGAATACAATTATTGTAAAATGTCGGAAAGTA ATGACTCTCGTCTCGATTGGACCCACTGTTCATAATTATTGGCAATTAGT TTTTGGGGTGAAACCTGAAAGTGGTATTTGATTTATCACGTTCAAGATTT GAAACCTGCTCTGAAAGTTGAATGAATTCTGTCCCGTTATACCTTATCTG CCTTTTTAACGCCGGACTTTATTATGCCCTTTATTTTAGCCCTGCCCTAT TTTAATTCCAATCCCTCACGCTGACCCTTATTACGCCAGCGACGTAAAAA TAAGGTACTCGTTACAGAAATACTTTTGATTGGTTTCGACGAACGCATGG TTTCATTAGTCAAATTGATCACAACCCACGGTCTGACATTCAATTCGTTC TTAtgtaaaaaaatcacgaaatttgtttttttcgaaCAACAATTGATGGC TTGTTTGTTTCGATGGTAAAAAAACATGCATTATAAATTTATTTGGTTTC ATGAGTCAATGTTGTGATTAAGTTTCTTTTGTTCTCTTCAATGTGGTTTC GGTTAATGACCATTAGTTCGTTTCCCGTTGTGGTCGATAAGCTCATTATG AAAAGATTGCCACCAAAAACAATCTGTCAATTATTTTGCAACCGCCGCTA TTTGGAAATCCAGTTGtcaaaaatttgcaatgttttatggtttttctgtc gccaataattttgtttttgcgATTTCCAACCAGTTATAGTTTTAGTTGtc aaaaatttgcaatgttgAAGATTTTTCTGTCGCCTATTAATTTCGTTCTG TGATTTCAACCATGGTATAATTCCATGCAGATTTCACACACATTGTCATC TGTACCCTAATGTAGGATGTGTAATCCTTATCTTTCGGACATTGTCCAGT AAAAACGGTCGATGTGTCACTGTTTCAAGTGTTAAGGAGTACTTATCGTG AAATTCCTTTACTATGTTTTGATAAGTGAAGGATCATCATTCTCGGTGGc tgtgtttttgttttgttaacaGTTTCGCTATGTAGAACATTCTGTCTGGC TCTGTTTCTCATTATCCATTAAAGGCTCGTTTTAAGATTGAGTATAAGGG GTTAAATTTGTTTGAACTGACATGCTGTTTTTGGATTTGTGACTCACTTA AATGGTTTTCAAGTCATTAGTAAGATAAATGGATCAAATTGGACCAAAAG TTGTGTCCCTGTTTTATCTATCTCTCAGCCCCTCTTGAAGCACAATGGTT GTTTGTGTTTGCAGAAAGCTCTCACTCAACCCACGCATcgaaaaatcttt tcattttttgaagtgGTTTTGTGATTCATGAACAAGCAGGTTTGAAGAGC AAGGTCTTTTTTGTTTGAGTCATAGGGACGATACTTAATACTTTTTTCCG AGTATGATCCTGTCTTAAGATCTTTCGTTTAttacatttataaaatattt cagattCTATAGACTTTCCCACCTGGCAAACTTAGTTGGTCAAACTCTGC ATCTCTCgattatcaatatttttcacttAGTTTAGGTCCCGAAGTCTTCA GATTTGCTcgtgaaataaataaattgttaAATTTAAAGGATATTTTGAAT CCTACAAGTTTCTCAATTGAcaggttttgttttcaaactCTTTGAAAAGT GTAATAATCCAATGGCTGATCTTTGGATGAATCTGACTATTAAATGTGTA TGGTTGAGCAGGAAATACTGGCGAATTATCATCTTCCCTTGATATTTAAC GCATTATTGTTGAGAGAGCATTGTCTGTAACTTATTTGCTTTTTATTCCT TTCTCATATACAAACATTGTCTGCTAAGTGGTCTTTAAACCTGAGGAATT TCTTTAgatgcacgtttttttttatgagaacaatcaaaatttctgaagcc ttcggatgttctcaactttaTGAGTTTAAAGTCTAAGTCTAAGTTTtcat attttcaccattttgtgagtattttttttccaattgcTGTTTTAGAGTCT TCAAAGCTTTAACAAGTTAGTGACAAgttcctaacttgttcttaaagttt tggccatcgaagccttatgctcttatatggtttgttcttataaaatgtgc ATAAAAAACATTGTCTGCTAAGTGATCTCATTTGATTGTTAGAACTATCT TTGGATTTACCTTGAAGAATTTCTTTAGATAATTCAAAGTGCCTTTCGAC ACTTTTAGATTATTTCGTCGTCATTTTCCACCCCCGTCTACAGGTACCAA TCATTCGCTTTTCAAACTGTGATGAaagccaaaaaatatcattttcccTA GCATGACTGTGGGGATTAAAAGACTATGCTGAAATAGAATTTCCTTGGTA GGTTTGACGTCACTAGTTTCATCTGTCATATAAACTGTTTCGAAAAGCTT ACAAAATATCAACTCTCAAAACGATTTAACATCTCTATTCCTATCTCAAA AAAACGATAATAACAAGTTGTTGTTGTCTGTGTAATGGAAATCCTGATAT TTCTTTTCCATCCATTTCTAATCGCTGTATCTATGTTAAAGTTGTTAAAA TACGAAGATTCTTTCCTGGTTATTCCATAATTAAATTACAAGTTCTGCAC CTTATGACGTGTTATTCCACACCTGTGGATGTCTTGTAACGTCATCTTGG AATCTGAcgtaattattttattttgatgacATTTTAATTAGTAAACATAT CATCATCTCATTTAACGACCGCAAACATTTTACAGACTTTAACCAGGAAA ACTTAGCATGAGAATGAGGCTGATAAAAGTACAAATTAGACCCCTTCAAA GTCATCACAATCAAATTGTTCAATTCCCAATGCGTCTTGAGTTTTGATGT CCGTTCCCAGGGAGAGAGAGGATCGGTTGAAAGATGACAACTGGTTTTGA TGAATGACTTTCGAATTGTTTAATTATTTAAATGATTAATGATATACCGA TATCATTATCCCGCAAATTAATTCATCTGATTCAAAATCTTTCTCTTGTC TTTTCATATTTACCCTCTGCCACTTTTCTCCGCattcttgaataaaaatt gctaAACAACCTAAAATTCGTCAATTTTATCGTCAATATTATGAAGAAAT TTGTTTCTTGGAAAAGCGGTTTGAGTTAGTATTAAGATTTCTTAATACCC AACTTTTAAgaaatttcaaacatttcatAAGCTATAAAACACAAGGGAAC GAGGAGCAAAATATTTATGGAATGTTATTCAAGCGAGAAAAatgacagaa aaaaaaaacattggttTAATGATGTAGTAATCGATTGGATGACAAGACAA TCACTTACTCTATTATACTGAACAATAGAGAGAACAATTAAAGAACGTTA ATGATGCGTGCATGACAAATGATATACCATAATTATTCCCTTTCGTTTTT GTAGTCTTTCATAAAGATACAAATAGACTGTTAATGTGATGCTCTCTCAG TTAGTTCGTTAAATAAATATACCAGTGTCAAGACGAGTGAGTGGTTATTG TGAAAATtactttgaatatttttgtcaattttttggagTCGTTTTGGAAA ATATTGTAAATGAAAGGAATTGTATGTTGTGATTGAAGAATTGTGAAACA TGATTTTGAACATCCAACCAACAGCGTACCACAAACGCGATACATTTTAC ACCTTGACTGGTGTCCCTTCGGTCGATAAGGCGCTCTCGTCGCCGACCAG CCACGTCGCAGGGTCCTCGTGTACCCAACCTAAACGAAAAGCGGTAAGGA ACGGacttaaaacttttatttatatagCGGAAGGGGGAGGTAACGTTTTT TATGAAACCTTAGTCTTAGTTCGACTGATTTAAGGGTAGATACTGAATTA GTTCAATTGAAATTGGGCTTTGACTGAGTTTAATTTGTGAATATAGTGGa cggagtctccataactcgaacacgcacgaggAACACAAAGTTTTtctcga gttaaggaaatttcgaaatatggagtaaggtttactATAAAGcgttgtta actgaagggaccatcaAACTTCATTTGACTTGAGGAGATATTCGAGATGT GGAGGTTCGAGTTGAAAAGACTCTTTACTGTATTTATTGTATTATATGAG AGCGTTTTCAATGCTGACTTTCGTAACTTAcaagtttctttattttgact TGTTGTGGTGATGAAAAAATGCTTgtctttctataaaaaaaattcacttt aaagaTGCTTATCTTACAATGATCACGTTATTAGATTTTAATCTCCATTT TTTGATACGAGTTTCTGTGGTCTGATTCATACATCTTCTGTGTTGgctct ttaaactttttgtgaCAACATTTTTAGCATTCTTGCGAAAGTTTTAAAGT TCTAAAGGAAATACGTAAGCATAAAATgatgatcaaaaataaaaatccaa aaaatcacGCCTGCTTTTTCTTAGAgttccatttttcaaatatttttggt ttttttaatGACATCCTATGAACTTATGATTATCGAACTTCCTGGACATT TTTTGCTTCTATTTTTGCTTCTAATCCGCCTCATTAGAAAGCTTGTTTCA AAACTTGATGGTTTCCTTTGGAAACCAAAATTAATTTCCTTTCAATACTT GAGTCGATATTTAACGTGGATTGCCCAGCAATTtaagacttttagacagt ctttcgattgttttcacggggtccacggtcAGCCGGcttggctatctatg aactgaacggggCATTGAAAAGAACGGGGATTCGAAAAATAAACCGTCTG GTTTGTAATGCTGACACCTAAGATAGCTTGCCCATCAATCTTTAAGTCTA TGGATTcggattttgaatatttttattttctttatcattCTCAGGTTCCA CGCAACAAACAACGCACACAAACAGAACCATTGATTCGCAACTTCATCTC GGGTCCACAATCAGCATGGTGTATGGTCAAATGCTACGAACGCCAATTCC ACATTGCATCTTTCCAAATGGAAGAAGCTGTCATTTGTGTTGACGGCACA CACACATTCAGTGATAAAAACCGCATCGCCTTTGCCACCCTCCCCGTACG GGCGGACGATCCAAAAGTCGCCAAAGTGAAAAGTTGTATCGGGAAAGGAG TCCAGTTACACCAAGACGAGCGACAAAACTTGTGGGCTACGCGACTTGGT AAAAACCCTATATTTGTGCGTGGTCATACCTTATGTCCAGAACTGGTCAA ACTGAACGGCAAACTTACGCAAGGCGTACCCATGAAAGTGTTAGATACGG CCGCTTTCAAGGATTACATGCGTGAAGAAGTTGAGAAAAATGGCGGCGTC ACTGAAGACCTCAAAGATCGAATCATGTCTAAACTGAAGGTAAGCAATTT tacatttgaatttttaaaatcatatatatttctaaaaaaataacttGTCA CAGAAATATCTGATTTTAGTGGAAGCTCTATCTTGTTTATCgagcacttt ttgtgttgatttGTTCACCAAAGAAATAATGATATTTGAACTTTTGAGGA ATACGCCTTCCCGATATCGATTGTCCAATACAAAAACACAGGAAATTCAA CATTAAAGCCAGGCGTATATGTAAGTACGATTCATTTTATGTCACTTTCT TCTGCCAACCAAAGCTTATAATAAAATGTTCCCTTTCTATTCTTCAGATT TGCATGAGTTTCATCAAAGATACACACTTAGACGAAGAAACGCCGTGTTG GTTCGAAATTTGGCTTGTCAAAGTCAAGGAGCATGTTAGACGTAAGTTCT AGATCCTGCTTTTCAATTTATGTATTTACCGCCGCTAAATGAATTTCAAC AGCCTACGACTAATGGATCTGACGTTTATGGCTATACtctttaagccatt ttaatcCTGATGAAGAAATTTTGATCTTGAAAGATTGATTAAATCCAAAT TTAGTTCATCTCTTGATAttgtttctttatttctttatttcttgattttc caGGTTACCTTGACAACCAACAGAAACGAGAGAAACGAAAATCAGGACAT TTAGACATGCGTATTACACAAACACAAGAATCCGTTAAACGAATTGCAGC CATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATCATTTACGTAGACCAC GAAGTAATACGGCAGGCCCGAATCCTGCCGAAACGACGGGAAAACCGGCC CGTTCATCAAGACCGCCGTCACAAATAATCGGCGAAAAATCCATCGCACG TCATCGAGGGACGACATCAGCAGACACAACGGCGCAATGGCGTGTGGAAC AAAAGATTACGCAAGAAATGTTACAACGTGAACGTAGTATGGACATGATT CGACGTGAGAAAAGCATGGACGTACGGCTGGAGTCGCGACTTTTAATGGA ACGCGAATATCGAAACAGTATGGGAAAACCTTTAGTTGAATCTCAACACG TGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCACCG CAATCACTGGCCCGTAGTACGGGAAGCAGTATGGGATCACGTAAAGACAA TTCGACCACAGCCAACGATTCCCCTCGTATAGTTAACGGTCCACATACGC CCGTTTCACGTATGCCCGCCCACTCTCAACAAAATCCTCATGAAGAATTT CGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAATGAGTTATCGACA AGTATTTGGACTTCAATCATCAGACTATTTATTTAACGTGACGCCGCCTA ATTACACGCGCCATCGACGTTTCTCAGACTCAGATACTGAATCCCTtcac aatttcaatttcatacaCAAAGTAATCACACAACCTTCAACGCCCACTCA CCAATCCACCCAACAATTAACAAACGCCCAACAAACGCCCTCCCAACAAA CAGAAGATCCGAAGAAATCGAAAGTACTTCAACAACCGAAAAGttggatg aaaaaagtacgACGAAAGTCGGAAGATAATCCAAAACGAAAAGTTGTAGC GCAACTTTCTAACAAATAAATAGATAGGATGagatattttgacttttaga tGAACATATTATTTTTAGGAGAGGAATTTAAGTCTTTTTGCTTAATATTT ACATTAAGattcatttttatgacgtctAATTTTCTTAGTACTAGATATTG TATGAAATTAAGTATTCTTAGAGTGCCTTTAAACCATTTAATCTTAACTG CTAttgaaatttagaaaacttggaaatttatttggaaatttttattctca aaaattttggcTTACAAATTATCTTCAATGCAtctcaatattttttcttt ttaattttctgtAATATAGTTATTGGTAAAAAAAcgaagttatttttttc tgtttcatttttgtaaattatgtGAAGAAACAAGCACCGTTATACAaag

Coding sequence (CDS) from alignment at sc0000001:1683867..1745865+

>TCONS_00000078 ID=TCONS_00000078|Name=TCONS_00000078|organism=Clytia hemisphaerica|type=CDS|length=115584bp|location=Sequence derived from alignment at sc0000001:1683867..1745865+ (Clytia hemisphaerica)
ATGGATTTGAACGACTTATGTGACCTTGAAAATCCTGATGATGATGTTAT
TGTTGACGCTATCAAAAAGAGATATGAGTGTGGGTATTTCTATACTTGTA
TTGGAGATATTCTCATCTCAATCAACCCATACAAAGAGTCCATCTTGAAT
TCGCTTGAGGTATCACACAGATATAAAGATGAACCTTCTCTTACGCAAAC
CAACCCACATGTCTTTGGTACCACAAACAATTTATATCATTTCCTCAATG
TCAACAAAGAAAGTCAATGCTTCATCGTCTCTGGTGAATCTGGTTCTGGA
AAAAGTGAAGTCATTCATCAAGCTGTCACACATTTTTTATGTCTAGTTTC
AACGTCTGATAGGAGTTTCAAAGAAAGAATTTTACAGGCAAATGTAATTC
TGGAAGCTTTTGGAAATGCACGGACAAGTTTAAATTCAAATGCAACaaga
ttttgcaaatatttaaaGTTCCATTTCGATAGCAAGTTACATCTATCCGG
AGTATCAATCACAGATTATTTGCTTGAGTTGCCGAGAGTTTCAAATCAAA
GACAGGGAGAAGCAAATTTCAATATCTTTTATTACATGTTTTCTGGGCGA
ACCGAAGATGAGCTATCAAAACAATTACTTGATACCCCTACACAACACAA
ATATTTGAAGTATGGTGAGTTTTTTGGGGATGATTTACTTTCTTGGAGTC
AGGCTTATGAAAGTCTTATTGATGCATTTCAAGTTGTCGGCTTCACACAA
GAGactgTCAAAGAGATATTTGGTATTTTGTCAGCCATTTTGAATATAGG
TGATTTGAAGTTCAAATGTGAAGACGAAACAACAGGTGTTTTTGTGGACA
ATCTAGAAATACTTGATAAAGtTTCTATTCTACTTGGAGTGgacacaagc
gatttggaactTTGTTTAACCAGTAATTTGTTTGTGAAACCAgATGATGG
TGTTTCTGGCTTCAAAAGTCTGAGTGAAGCTGAACAAACCAGAGATTTCA
TGGCCAATTTCATGTATGCAAGATTGTTTAGTTGGATAGTCAGCAACATT
AACACTTTCTTGAACCCTGGCGAACCAAAAAAGAAACAATCTGAGCATGT
GCATGTTggatttcttgatatttttgggTTTGAAGATTTCCAGAAAAACA
CACTAGAACAATTGTGTATTAACACCACAAATGAACAGATTAATTTGCAC
TTTATACAACACGTCTTTGCACGGGAACAGgttgatTACCAAGAAGAAGG
GCTTTCAGAATTACAATTAGTGGAATATTTTGATAACAAGAATATTGTTA
ATCTTCTCCTTGAGACACCTCACGGCATCTTTGCATTATTGGAGGAAGAA
AGCAAATGTTTGCAAGCAGATGATCAGACGCTTGTCTCTTCTTTCAATGC
TCATTGTTCAGAATTGAAGTTCTATATTCCGTCCACCGCAAACGCATCCA
CTTTCAGTATCGTACActacaataaaaaaGTAACTTACGCAGCAGATGAC
TTCATTTTGAGGAATAATGCAAAACTTGATGGCTGTCTGATTGAATGTTT
AAGAGGTTCAAAGGGACAGTTAACGAGTACTCTATTCAACTCGTCCTTAA
CCAAGACAGGAGCACTAATCATCAAgCAAGGACATGGTACAGTGAATTGT
TGCCAAGGGGATCTTCGAGGGGCTTACACCAAACGTATTAATCATAGGTT
AAAGAAAGAGGGGAAATGCAATACGAGCAAAGCTTGCCACAACACGAAGA
GCAAGCAACGCACATTCACCGCtagaaaacataaaaataattcaGTTGCC
GTTCAGTTCAGGAACTCGTTAGTGGATTTGATAGAGACCATCCTGCTATG
TCAGGCTCATTTCGTCAGGTGCATAAAGCCGAACAAAGTAAAAGAAGCAG
ATAACTTTGACGTGGATTTTGTTAGAGCTCAAATCAAATGCAACGGCATC
CTGGATTCCGTTCGTATTCGCAAAGACGGTTTTCCTGTTCGGCTGCCGTT
CAAAATCTTTGTGGAGAGaTATCGTTTTGTGAAATTTGATATGACGTCAC
CATTGGAGAACACTGGAGAAATATGTCAACAGATTCTTCAACATTGCAAC
ATTGATGACGGCTACAAGATTGGTGCCACCAGgGTGTTGCTTCGCCTTGA
GCACGTACAGAAATTGTTATCCTCACTTGATGAACAAACTCGAAGAATCG
TCATCGCGCAGAAAATGGTAAGAGGAAAATTAGCGCGCATCGATTTTGAT
TTCTTACAAACGTCACGCAAACAAGAAGATCGAAACGTCGGCAATTTGTT
GGTCTCGATCTCATCACGCAGCAGCAAGATGCATGACAATCTCTTGATAT
TGAACGATTACGATTTGAAGCGACATCAACGTGTTAAAGATAAGGAGATG
AAGAAAGAAATTGAGAAGGAGAACTTCATCCAAAAACGCAAATTGACGAG
TGCCACAGATCCTGAATTGAAACTTCGTGAAAGTCAACAACGACCCGCCC
CTGAAAACTCACCAAACAGAAAGGTTCCACGCAACAAACAACGCACACAA
ACAGAACCATTGATTCGCAACTTCATCTCGGGTCCACAATCAGCATGGTG
TATGGTCAAATGCTACGAACGCCAATTCCACATTGCATCTTTCCAAATGG
AAGAAGCTGTCATTTGTGTTGACGGCACACACACATTCAGTGATAAAAAC
CGCATCGCCTTTGCCACCCTCCCCGTACGGGCGGACGATCCAAAAGTCGC
CAAAGTGAAAAGTTGTATCGGGAAAGGAGTCCAGTTACACCAAGACGAGC
GACAAAACTTGTGGGCTACGCGACTTGGTAAAAACCCTATATTTGTGCGT
GGTCATACCTTATGTCCAGAACTGGTCAAACTGAACGGCAAACTTACGCA
AGGCGTACCCATGAAAGTGTTAGATACGGCCGCTTTCAAGGATTACATGC
GTGAAGAAGTTGAGAAAAATGGCGGCGTCACTGAAGACCTCAAAGATCGA
ATCATGTCTAAACTGAAGATTTGCATGAGTTTCATCAAAGATACACACTT
AGACGAAGAAACGCCGTGTTGGTTCGAAATTTGGCTTGTCAAAGTCAAGG
AGCATGTTAGACGTTACCTTGACAACCAACAGAAACGAGAGAAACGAAAA
TCAGGACATTTAGACATGCGTATTACACAAACACAAGAATCCGTTAAACG
AATTGCAGCCATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATCATTTAC
GTAGACCACGAAGTAATACGGCAGGCCCGAATCCTGCCGAAACGACGGGA
AAACCGGCCCGTTCATCAAGACCGCCGTCACAAATAATCGGCGAAAAATC
CATCGCACGTCATCGAGGGACGACATCAGCAGACACAACGGCGCAATGGC
GTGTGGAACAAAAGATTACGCAAGAAATGTTACAACGTGAACGTAGTATG
GACATGATTCGACGTGAGAAAAGCATGGACGTACGGCTGGAGTCGCGACT
TTTAATGGAACGCGAATATCGAAACAGTATGGGAAAACCTTTAGTTGAAT
CTCAACACGTGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAA
AGTCCACCGCAATCACTGGCCCGTAGTACGGGAAGCAGTATGGGATCACG
TAAAGACAATTCGACCACAGCCAACGATTCCCCTCGTATAGTTAACGGTC
CACATACGCCCGTTTCACGTATGCCCGCCCACTCTCAACAAAATCCTCAT
GAAGAATTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAATGAG
TTATCGACAAGTATTTGGACTTCAATCATCAGACTATTTATTTAACGTGA
CGCCGCCTAATTACACGCGCCATCGACGTTTCTCAGACTCAGATACTGAA
TCCCTtcacaatttcaatttcatacaCAAAGTAATCACACAACCTTCAAC
GCCCACTCACCAATCCACCCAACAATTAACAAACGCCCAACAAACGCCCT
CCCAACAAACAGAAGATCCGAAGAAATCGAAAGTACTTCAACAACCGAAA
AGttggatgaaaaaagtacgACGAAAGTCGGAAGATAATCCAAAACGAAA
AGTTGTAGCGCAACTTTCTAACAAATAAATGGATTTGAACGACTTATGTG
ACCTTGAAAATCCTGATGATGATGTTATTGTTGACGCTATCAAAAAGAGA
TATGAGTGTGGGTATTTCTATACTTGTATTGGAGATATTCTCATCTCAAT
CAACCCATACAAAGAGTCCATCTTGAATTCGCTTGAGGTATCACACAGAT
ATAAAGATGAACCTTCTCTTACGCAAACCAACCCACATGTCTTTGGTACC
ACAAACAATTTATATCATTTCCTCAATGTCAACAAAGAAAGTCAATGCTT
CATCGTCTCTGGTGAATCTGGTTCTGGAAAAAGTGAAGTCATTCATCAAG
CTGTCACACATTTTTTATGTCTAGTTTCAACGTCTGATAGGAGTTTCAAA
GAAAGAATTTTACAGGCAAATGTAATTCTGGAAGCTTTTGGAAATGCACG
GACAAGTTTAAATTCAAATGCAACaagattttgcaaatatttaaaGTTCC
ATTTCGATAGCAAGTTACATCTATCCGGAGTATCAATCACAGATTATTTG
CTTGAGTTGCCGAGAGTTTCAAATCAAAGACAGGGAGAAGCAAATTTCAA
TATCTTTTATTACATGTTTTCTGGGCGAACCGAAGATGAGCTATCAAAAC
AATTACTTGATACCCCTACACAACACAAATATTTGAAGTATGGTGAGTTT
TTTGGGGATGATTTACTTTCTTGGAGTCAGGCTTATGAAAGTCTTATTGA
TGCATTTCAAGTTGTCGGCTTCACACAAGAGactgTCAAAGAGATATTTG
GTATTTTGTCAGCCATTTTGAATATAGGTGATTTGAAGTTCAAATGTGAA
GACGAAACAACAGGTGTTTTTGTGGACAATCTAGAAATACTTGATAAAGt
TTCTATTCTACTTGGAGTGgacacaagcgatttggaactTTGTTTAACCA
GTAATTTGTTTGTGAAACCAgATGATGGTGTTTCTGGCTTCAAAAGTCTG
AGTGAAGCTGAACAAACCAGAGATTTCATGGCCAATTTCATGTATGCAAG
ATTGTTTAGTTGGATAGTCAGCAACATTAACACTTTCTTGAACCCTGGCG
AACCAAAAAAGAAACAATCTGAGCATGTGCATGTTggatttcttgatatt
tttgggTTTGAAGATTTCCAGAAAAACACACTAGAACAATTGTGTATTAA
CACCACAAATGAACAGATTAATTTGCACTTTATACAACACGTCTTTGCAC
GGGAACAGgttgatTACCAAGAAGAAGGGCTTTCAGAATTACAATTAGTG
GAATATTTTGATAACAAGAATATTGTTAATCTTCTCCTTGAGACACCTCA
CGGCATCTTTGCATTATTGGAGGAAGAAAGCAAATGTTTGCAAGCAGATG
ATCAGACGCTTGTCTCTTCTTTCAATGCTCATTGTTCAGAATTGAAGTTC
TATATTCCGTCCACCGCAAACGCATCCACTTTCAGTATCGTACActacaa
taaaaaaGTAACTTACGCAGCAGATGACTTCATTTTGAGGAATAATGCAA
AACTTGATGGCTGTCTGATTGAATGTTTAAGAGGTTCAAAGGGACAGTTA
ACGAGTACTCTATTCAACTCGTCCTTAACCAAGACAGGAGCACTAATCAT
CAAgCAAGGACATGGTACAGTGAATTGTTGCCAAGGGGATCTTCGAGGGG
CTTACACCAAACGTATTAATCATAGGTTAAAGAAAGAGGGGAAATGCAAT
ACGAGCAAAGCTTGCCACAACACGAAGAGCAAGCAACGCACATTCACCGC
tagaaaacataaaaataattcaGTTGCCGTTCAGTTCAGGAACTCGTTAG
TGGATTTGATAGAGACCATCCTGCTATGTCAGGCTCATTTCGTCAGGTGC
ATAAAGCCGAACAAAGTAAAAGAAGCAGATAACTTTGACGTGGATTTTGT
TAGAGCTCAAATCAAATGCAACGGCATCCTGGATTCCGTTCGTATTCGCA
AAGACGGTTTTCCTGTTCGGCTGCCGTTCAAAATCTTTGTGGAGAGaTAT
CGTTTTGTGAAATTTGATATGACGTCACCATTGGAGAACACTGGAGAAAT
ATGTCAACAGATTCTTCAACATTGCAACATTGATGACGGCTACAAGATTG
GTGCCACCAGgGTGTTGCTTCGCCTTGAGCACGTACAGAAATTGTTATCC
TCACTTGATGAACAAACTCGAAGAATCGTCATCGCGCAGAAAATGGTAAG
AGGAAAATTAGCGCGCATCGATTTTGATTTCTTACAAACGTCACGCAAAC
AAGAAGATCGAAACGTCGGCAATTTGTTGGTCTCGATCTCATCACGCAGC
AGCAAGATGCATGACAATCTCTTGATATTGAACGATTACGATTTGAAGCG
ACATCAACGTGTTAAAGATAAGGAGATGAAGAAAGAAATTGAGAAGGAGA
ACTTCATCCAAAAACGCAAATTGACGAGTGCCACAGATCCTGAATTGAAA
CTTCGTGAAAGTCAACAACGACCCGCCCCTGAAAACTCACCAAACAGAAA
GGTTCCACGCAACAAACAACGCACACAAACAGAACCATTGATTCGCAACT
TCATCTCGGGTCCACAATCAGCATGGTGTATGGTCAAATGCTACGAACGC
CAATTCCACATTGCATCTTTCCAAATGGAAGAAGCTGTCATTTGTGTTGA
CGGCACACACACATTCAGTGATAAAAACCGCATCGCCTTTGCCACCCTCC
CCGTACGGGCGGACGATCCAAAAGTCGCCAAAGTGAAAAGTTGTATCGGG
AAAGGAGTCCAGTTACACCAAGACGAGCGACAAAACTTGTGGGCTACGCG
ACTTGGTAAAAACCCTATATTTGTGCGTGGTCATACCTTATGTCCAGAAC
TGGTCAAACTGAACGGCAAACTTACGCAAGGCGTACCCATGAAAGTGTTA
GATACGGCCGCTTTCAAGGATTACATGCGTGAAGAAGTTGAGAAAAATGG
CGGCGTCACTGAAGACCTCAAAGATCGAATCATGTCTAAACTGAAGATTT
GCATGAGTTTCATCAAAGATACACACTTAGACGAAGAAACGCCGTGTTGG
TTCGAAATTTGGCTTGTCAAAGTCAAGGAGCATGTTAGACGTTACCTTGA
CAACCAACAGAAACGAGAGAAACGAAAATCAGGACATTTAGACATGCGTA
TTACACAAACACAAGAATCCGTTAAACGAATTGCAGCCATGCCTGAAATG
AGGCGCGCTAAAAGCGGTGATCATTTACGTAGACCACGAAGTAATACGGC
AGGCCCGAATCCTGCCGAAACGACGGGAAAACCGGCCCGTTCATCAAGAC
CGCCGTCACAAATAATCGGCGAAAAATCCATCGCACGTCATCGAGGGACG
ACATCAGCAGACACAACGGCGCAATGGCGTGTGGAACAAAAGATTACGCA
AGAAATGTTACAACGTGAACGTAGTATGGACATGATTCGACGTGAGAAAA
GCATGGACGTACGGCTGGAGTCGCGACTTTTAATGGAACGCGAATATCGA
AACAGTATGGGAAAACCTTTAGTTGAATCTCAACACGTGAACAGAGTGAG
GGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCACCGCAATCACTGGCCC
GTAGTACGGGAAGCAGTATGGGATCACGTAAAGACAATTCGACCACAGCC
AACGATTCCCCTCGTATAGTTAACGGTCCACATACGCCCGTTTCACGTAT
GCCCGCCCACTCTCAACAAAATCCTCATGAAGAATTTCGAAGGGGCGGAA
GTGTGGCGGCTGCCCGTGAAGGAATGAGTTATCGACAAGTATTTGGACTT
CAATCATCAGACTATTTATTTAACGTGACGCCGCCTAATTACACGCGCCA
TCGACGTTTCTCAGACTCAGATACTGAATCCCTtcacaatttcaatttca
tacaCAAAGTAATCACACAACCTTCAACGCCCACTCACCAATCCACCCAA
CAATTAACAAACGCCCAACAAACGCCCTCCCAACAAACAGAAGATCCGAA
GAAATCGAAAGTACTTCAACAACCGAAAAGttggatgaaaaaagtacgAC
GAAAGTCGGAAGATAATCCAAAACGAAAAGTTGTAGCGCAACTTTCTAAC
AAATAAATGGATTTGAACGACTTATGTGACCTTGAAAATCCTGATGATGA
TGTTATTGTTGACGCTATCAAAAAGAGATATGAGTGTGGGTATTTCTATA
CTTGTATTGGAGATATTCTCATCTCAATCAACCCATACAAAGAGTCCATC
TTGAATTCGCTTGAGGTATCACACAGATATAAAGATGAACCTTCTCTTAC
GCAAACCAACCCACATGTCTTTGGTACCACAAACAATTTATATCATTTCC
TCAATGTCAACAAAGAAAGTCAATGCTTCATCGTCTCTGGTGAATCTGGT
TCTGGAAAAAGTGAAGTCATTCATCAAGCTGTCACACATTTTTTATGTCT
AGTTTCAACGTCTGATAGGAGTTTCAAAGAAAGAATTTTACAGGCAAATG
TAATTCTGGAAGCTTTTGGAAATGCACGGACAAGTTTAAATTCAAATGCA
ACaagattttgcaaatatttaaaGTTCCATTTCGATAGCAAGTTACATCT
ATCCGGAGTATCAATCACAGATTATTTGCTTGAGTTGCCGAGAGTTTCAA
ATCAAAGACAGGGAGAAGCAAATTTCAATATCTTTTATTACATGTTTTCT
GGGCGAACCGAAGATGAGCTATCAAAACAATTACTTGATACCCCTACACA
ACACAAATATTTGAAGTATGGTGAGTTTTTTGGGGATGATTTACTTTCTT
GGAGTCAGGCTTATGAAAGTCTTATTGATGCATTTCAAGTTGTCGGCTTC
ACACAAGAGactgTCAAAGAGATATTTGGTATTTTGTCAGCCATTTTGAA
TATAGGTGATTTGAAGTTCAAATGTGAAGACGAAACAACAGGTGTTTTTG
TGGACAATCTAGAAATACTTGATAAAGtTTCTATTCTACTTGGAGTGgac
acaagcgatttggaactTTGTTTAACCAGTAATTTGTTTGTGAAACCAgA
TGATGGTGTTTCTGGCTTCAAAAGTCTGAGTGAAGCTGAACAAACCAGAG
ATTTCATGGCCAATTTCATGTATGCAAGATTGTTTAGTTGGATAGTCAGC
AACATTAACACTTTCTTGAACCCTGGCGAACCAAAAAAGAAACAATCTGA
GCATGTGCATGTTggatttcttgatatttttgggTTTGAAGATTTCCAGA
AAAACACACTAGAACAATTGTGTATTAACACCACAAATGAACAGATTAAT
TTGCACTTTATACAACACGTCTTTGCACGGGAACAGgttgatTACCAAGA
AGAAGGGCTTTCAGAATTACAATTAGTGGAATATTTTGATAACAAGAATA
TTGTTAATCTTCTCCTTGAGACACCTCACGGCATCTTTGCATTATTGGAG
GAAGAAAGCAAATGTTTGCAAGCAGATGATCAGACGCTTGTCTCTTCTTT
CAATGCTCATTGTTCAGAATTGAAGTTCTATATTCCGTCCACCGCAAACG
CATCCACTTTCAGTATCGTACActacaataaaaaaGTAACTTACGCAGCA
GATGACTTCATTTTGAGGAATAATGCAAAACTTGATGGCTGTCTGATTGA
ATGTTTAAGAGGTTCAAAGGGACAGTTAACGAGTACTCTATTCAACTCGT
CCTTAACCAAGACAGGAGCACTAATCATCAAgCAAGGACATGGTACAGTG
AATTGTTGCCAAGGGGATCTTCGAGGGGCTTACACCAAACGTATTAATCA
TAGGTTAAAGAAAGAGGGGAAATGCAATACGAGCAAAGCTTGCCACAACA
CGAAGAGCAAGCAACGCACATTCACCGCtagaaaacataaaaataattca
GTTGCCGTTCAGTTCAGGAACTCGTTAGTGGATTTGATAGAGACCATCCT
GCTATGTCAGGCTCATTTCGTCAGGTGCATAAAGCCGAACAAAGTAAAAG
AAGCAGATAACTTTGACGTGGATTTTGTTAGAGCTCAAATCAAATGCAAC
GGCATCCTGGATTCCGTTCGTATTCGCAAAGACGGTTTTCCTGTTCGGCT
GCCGTTCAAAATCTTTGTGGAGAGaTATCGTTTTGTGAAATTTGATATGA
CGTCACCATTGGAGAACACTGGAGAAATATGTCAACAGATTCTTCAACAT
TGCAACATTGATGACGGCTACAAGATTGGTGCCACCAGgGTGTTGCTTCG
CCTTGAGCACGTACAGAAATTGTTATCCTCACTTGATGAACAAACTCGAA
GAATCGTCATCGCGCAGAAAATGGTAAGAGGAAAATTAGCGCGCATCGAT
TTTGATTTCTTACAAACGTCACGCAAACAAGAAGATCGAAACGTCGGCAA
TTTGTTGGTCTCGATCTCATCACGCAGCAGCAAGATGCATGACAATCTCT
TGATATTGAACGATTACGATTTGAAGCGACATCAACGTGTTAAAGATAAG
GAGATGAAGAAAGAAATTGAGAAGGAGAACTTCATCCAAAAACGCAAATT
GACGAGTGCCACAGATCCTGAATTGAAACTTCGTGAAAGTCAACAACGAC
CCGCCCCTGAAAACTCACCAAACAGAAAGGTTCCACGCAACAAACAACGC
ACACAAACAGAACCATTGATTCGCAACTTCATCTCGGGTCCACAATCAGC
ATGGTGTATGGTCAAATGCTACGAACGCCAATTCCACATTGCATCTTTCC
AAATGGAAGAAGCTGTCATTTGTGTTGACGGCACACACACATTCAGTGAT
AAAAACCGCATCGCCTTTGCCACCCTCCCCGTACGGGCGGACGATCCAAA
AGTCGCCAAAGTGAAAAGTTGTATCGGGAAAGGAGTCCAGTTACACCAAG
ACGAGCGACAAAACTTGTGGGCTACGCGACTTGGTAAAAACCCTATATTT
GTGCGTGGTCATACCTTATGTCCAGAACTGGTCAAACTGAACGGCAAACT
TACGCAAGGCGTACCCATGAAAGTGTTAGATACGGCCGCTTTCAAGGATT
ACATGCGTGAAGAAGTTGAGAAAAATGGCGGCGTCACTGAAGACCTCAAA
GATCGAATCATGTCTAAACTGAAGATTTGCATGAGTTTCATCAAAGATAC
ACACTTAGACGAAGAAACGCCGTGTTGGTTCGAAATTTGGCTTGTCAAAG
TCAAGGAGCATGTTAGACGTTACCTTGACAACCAACAGAAACGAGAGAAA
CGAAAATCAGGACATTTAGACATGCGTATTACACAAACACAAGAATCCGT
TAAACGAATTGCAGCCATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATC
ATTTACGTAGACCACGAAGTAATACGGCAGGCCCGAATCCTGCCGAAACG
ACGGGAAAACCGGCCCGTTCATCAAGACCGCCGTCACAAATAATCGGCGA
AAAATCCATCGCACGTCATCGAGGGACGACATCAGCAGACACAACGGCGC
AATGGCGTGTGGAACAAAAGATTACGCAAGAAATGTTACAACGTGAACGT
AGTATGGACATGATTCGACGTGAGAAAAGCATGGACGTACGGCTGGAGTC
GCGACTTTTAATGGAACGCGAATATCGAAACAGTATGGGAAAACCTTTAG
TTGAATCTCAACACGTGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCC
GGTCAAAGTCCACCGCAATCACTGGCCCGTAGTACGGGAAGCAGTATGGG
ATCACGTAAAGACAATTCGACCACAGCCAACGATTCCCCTCGTATAGTTA
ACGGTCCACATACGCCCGTTTCACGTATGCCCGCCCACTCTCAACAAAAT
CCTCATGAAGAATTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGG
AATGAGTTATCGACAAGTATTTGGACTTCAATCATCAGACTATTTATTTA
ACGTGACGCCGCCTAATTACACGCGCCATCGACGTTTCTCAGACTCAGAT
ACTGAATCCCTtcacaatttcaatttcatacaCAAAGTAATCACACAACC
TTCAACGCCCACTCACCAATCCACCCAACAATTAACAAACGCCCAACAAA
CGCCCTCCCAACAAACAGAAGATCCGAAGAAATCGAAAGTACTTCAACAA
CCGAAAAGttggatgaaaaaagtacgACGAAAGTCGGAAGATAATCCAAA
ACGAAAAGTTGTAGCGCAACTTTCTAACAAATAAATGGATTTGAACGACT
TATGTGACCTTGAAAATCCTGATGATGATGTTATTGTTGACGCTATCAAA
AAGAGATATGAGTGTGGGTATTTCTATACTTGTATTGGAGATATTCTCAT
CTCAATCAACCCATACAAAGAGTCCATCTTGAATTCGCTTGAGGTATCAC
ACAGATATAAAGATGAACCTTCTCTTACGCAAACCAACCCACATGTCTTT
GGTACCACAAACAATTTATATCATTTCCTCAATGTCAACAAAGAAAGTCA
ATGCTTCATCGTCTCTGGTGAATCTGGTTCTGGAAAAAGTGAAGTCATTC
ATCAAGCTGTCACACATTTTTTATGTCTAGTTTCAACGTCTGATAGGAGT
TTCAAAGAAAGAATTTTACAGGCAAATGTAATTCTGGAAGCTTTTGGAAA
TGCACGGACAAGTTTAAATTCAAATGCAACaagattttgcaaatatttaa
aGTTCCATTTCGATAGCAAGTTACATCTATCCGGAGTATCAATCACAGAT
TATTTGCTTGAGTTGCCGAGAGTTTCAAATCAAAGACAGGGAGAAGCAAA
TTTCAATATCTTTTATTACATGTTTTCTGGGCGAACCGAAGATGAGCTAT
CAAAACAATTACTTGATACCCCTACACAACACAAATATTTGAAGTATGGT
GAGTTTTTTGGGGATGATTTACTTTCTTGGAGTCAGGCTTATGAAAGTCT
TATTGATGCATTTCAAGTTGTCGGCTTCACACAAGAGactgTCAAAGAGA
TATTTGGTATTTTGTCAGCCATTTTGAATATAGGTGATTTGAAGTTCAAA
TGTGAAGACGAAACAACAGGTGTTTTTGTGGACAATCTAGAAATACTTGA
TAAAGtTTCTATTCTACTTGGAGTGgacacaagcgatttggaactTTGTT
TAACCAGTAATTTGTTTGTGAAACCAgATGATGGTGTTTCTGGCTTCAAA
AGTCTGAGTGAAGCTGAACAAACCAGAGATTTCATGGCCAATTTCATGTA
TGCAAGATTGTTTAGTTGGATAGTCAGCAACATTAACACTTTCTTGAACC
CTGGCGAACCAAAAAAGAAACAATCTGAGCATGTGCATGTTggatttctt
gatatttttgggTTTGAAGATTTCCAGAAAAACACACTAGAACAATTGTG
TATTAACACCACAAATGAACAGATTAATTTGCACTTTATACAACACGTCT
TTGCACGGGAACAGgttgatTACCAAGAAGAAGGGCTTTCAGAATTACAA
TTAGTGGAATATTTTGATAACAAGAATATTGTTAATCTTCTCCTTGAGAC
ACCTCACGGCATCTTTGCATTATTGGAGGAAGAAAGCAAATGTTTGCAAG
CAGATGATCAGACGCTTGTCTCTTCTTTCAATGCTCATTGTTCAGAATTG
AAGTTCTATATTCCGTCCACCGCAAACGCATCCACTTTCAGTATCGTACA
ctacaataaaaaaGTAACTTACGCAGCAGATGACTTCATTTTGAGGAATA
ATGCAAAACTTGATGGCTGTCTGATTGAATGTTTAAGAGGTTCAAAGGGA
CAGTTAACGAGTACTCTATTCAACTCGTCCTTAACCAAGACAGGAGCACT
AATCATCAAgCAAGGACATGGTACAGTGAATTGTTGCCAAGGGGATCTTC
GAGGGGCTTACACCAAACGTATTAATCATAGGTTAAAGAAAGAGGGGAAA
TGCAATACGAGCAAAGCTTGCCACAACACGAAGAGCAAGCAACGCACATT
CACCGCtagaaaacataaaaataattcaGTTGCCGTTCAGTTCAGGAACT
CGTTAGTGGATTTGATAGAGACCATCCTGCTATGTCAGGCTCATTTCGTC
AGGTGCATAAAGCCGAACAAAGTAAAAGAAGCAGATAACTTTGACGTGGA
TTTTGTTAGAGCTCAAATCAAATGCAACGGCATCCTGGATTCCGTTCGTA
TTCGCAAAGACGGTTTTCCTGTTCGGCTGCCGTTCAAAATCTTTGTGGAG
AGaTATCGTTTTGTGAAATTTGATATGACGTCACCATTGGAGAACACTGG
AGAAATATGTCAACAGATTCTTCAACATTGCAACATTGATGACGGCTACA
AGATTGGTGCCACCAGgGTGTTGCTTCGCCTTGAGCACGTACAGAAATTG
TTATCCTCACTTGATGAACAAACTCGAAGAATCGTCATCGCGCAGAAAAT
GGTAAGAGGAAAATTAGCGCGCATCGATTTTGATTTCTTACAAACGTCAC
GCAAACAAGAAGATCGAAACGTCGGCAATTTGTTGGTCTCGATCTCATCA
CGCAGCAGCAAGATGCATGACAATCTCTTGATATTGAACGATTACGATTT
GAAGCGACATCAACGTGTTAAAGATAAGGAGATGAAGAAAGAAATTGAGA
AGGAGAACTTCATCCAAAAACGCAAATTGACGAGTGCCACAGATCCTGAA
TTGAAACTTCGTGAAAGTCAACAACGACCCGCCCCTGAAAACTCACCAAA
CAGAAAGGTTCCACGCAACAAACAACGCACACAAACAGAACCATTGATTC
GCAACTTCATCTCGGGTCCACAATCAGCATGGTGTATGGTCAAATGCTAC
GAACGCCAATTCCACATTGCATCTTTCCAAATGGAAGAAGCTGTCATTTG
TGTTGACGGCACACACACATTCAGTGATAAAAACCGCATCGCCTTTGCCA
CCCTCCCCGTACGGGCGGACGATCCAAAAGTCGCCAAAGTGAAAAGTTGT
ATCGGGAAAGGAGTCCAGTTACACCAAGACGAGCGACAAAACTTGTGGGC
TACGCGACTTGGTAAAAACCCTATATTTGTGCGTGGTCATACCTTATGTC
CAGAACTGGTCAAACTGAACGGCAAACTTACGCAAGGCGTACCCATGAAA
GTGTTAGATACGGCCGCTTTCAAGGATTACATGCGTGAAGAAGTTGAGAA
AAATGGCGGCGTCACTGAAGACCTCAAAGATCGAATCATGTCTAAACTGA
AGATTTGCATGAGTTTCATCAAAGATACACACTTAGACGAAGAAACGCCG
TGTTGGTTCGAAATTTGGCTTGTCAAAGTCAAGGAGCATGTTAGACGTTA
CCTTGACAACCAACAGAAACGAGAGAAACGAAAATCAGGACATTTAGACA
TGCGTATTACACAAACACAAGAATCCGTTAAACGAATTGCAGCCATGCCT
GAAATGAGGCGCGCTAAAAGCGGTGATCATTTACGTAGACCACGAAGTAA
TACGGCAGGCCCGAATCCTGCCGAAACGACGGGAAAACCGGCCCGTTCAT
CAAGACCGCCGTCACAAATAATCGGCGAAAAATCCATCGCACGTCATCGA
GGGACGACATCAGCAGACACAACGGCGCAATGGCGTGTGGAACAAAAGAT
TACGCAAGAAATGTTACAACGTGAACGTAGTATGGACATGATTCGACGTG
AGAAAAGCATGGACGTACGGCTGGAGTCGCGACTTTTAATGGAACGCGAA
TATCGAAACAGTATGGGAAAACCTTTAGTTGAATCTCAACACGTGAACAG
AGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCACCGCAATCAC
TGGCCCGTAGTACGGGAAGCAGTATGGGATCACGTAAAGACAATTCGACC
ACAGCCAACGATTCCCCTCGTATAGTTAACGGTCCACATACGCCCGTTTC
ACGTATGCCCGCCCACTCTCAACAAAATCCTCATGAAGAATTTCGAAGGG
GCGGAAGTGTGGCGGCTGCCCGTGAAGGAATGAGTTATCGACAAGTATTT
GGACTTCAATCATCAGACTATTTATTTAACGTGACGCCGCCTAATTACAC
GCGCCATCGACGTTTCTCAGACTCAGATACTGAATCCCTtcacaatttca
atttcatacaCAAAGTAATCACACAACCTTCAACGCCCACTCACCAATCC
ACCCAACAATTAACAAACGCCCAACAAACGCCCTCCCAACAAACAGAAGA
TCCGAAGAAATCGAAAGTACTTCAACAACCGAAAAGttggatgaaaaaag
tacgACGAAAGTCGGAAGATAATCCAAAACGAAAAGTTGTAGCGCAACTT
TCTAACAAATAAATGGATTTGAACGACTTATGTGACCTTGAAAATCCTGA
TGATGATGTTATTGTTGACGCTATCAAAAAGAGATATGAGTGTGGGTATT
TCTATACTTGTATTGGAGATATTCTCATCTCAATCAACCCATACAAAGAG
TCCATCTTGAATTCGCTTGAGGTATCACACAGATATAAAGATGAACCTTC
TCTTACGCAAACCAACCCACATGTCTTTGGTACCACAAACAATTTATATC
ATTTCCTCAATGTCAACAAAGAAAGTCAATGCTTCATCGTCTCTGGTGAA
TCTGGTTCTGGAAAAAGTGAAGTCATTCATCAAGCTGTCACACATTTTTT
ATGTCTAGTTTCAACGTCTGATAGGAGTTTCAAAGAAAGAATTTTACAGG
CAAATGTAATTCTGGAAGCTTTTGGAAATGCACGGACAAGTTTAAATTCA
AATGCAACaagattttgcaaatatttaaaGTTCCATTTCGATAGCAAGTT
ACATCTATCCGGAGTATCAATCACAGATTATTTGCTTGAGTTGCCGAGAG
TTTCAAATCAAAGACAGGGAGAAGCAAATTTCAATATCTTTTATTACATG
TTTTCTGGGCGAACCGAAGATGAGCTATCAAAACAATTACTTGATACCCC
TACACAACACAAATATTTGAAGTATGGTGAGTTTTTTGGGGATGATTTAC
TTTCTTGGAGTCAGGCTTATGAAAGTCTTATTGATGCATTTCAAGTTGTC
GGCTTCACACAAGAGactgTCAAAGAGATATTTGGTATTTTGTCAGCCAT
TTTGAATATAGGTGATTTGAAGTTCAAATGTGAAGACGAAACAACAGGTG
TTTTTGTGGACAATCTAGAAATACTTGATAAAGtTTCTATTCTACTTGGA
GTGgacacaagcgatttggaactTTGTTTAACCAGTAATTTGTTTGTGAA
ACCAgATGATGGTGTTTCTGGCTTCAAAAGTCTGAGTGAAGCTGAACAAA
CCAGAGATTTCATGGCCAATTTCATGTATGCAAGATTGTTTAGTTGGATA
GTCAGCAACATTAACACTTTCTTGAACCCTGGCGAACCAAAAAAGAAACA
ATCTGAGCATGTGCATGTTggatttcttgatatttttgggTTTGAAGATT
TCCAGAAAAACACACTAGAACAATTGTGTATTAACACCACAAATGAACAG
ATTAATTTGCACTTTATACAACACGTCTTTGCACGGGAACAGgttgatTA
CCAAGAAGAAGGGCTTTCAGAATTACAATTAGTGGAATATTTTGATAACA
AGAATATTGTTAATCTTCTCCTTGAGACACCTCACGGCATCTTTGCATTA
TTGGAGGAAGAAAGCAAATGTTTGCAAGCAGATGATCAGACGCTTGTCTC
TTCTTTCAATGCTCATTGTTCAGAATTGAAGTTCTATATTCCGTCCACCG
CAAACGCATCCACTTTCAGTATCGTACActacaataaaaaaGTAACTTAC
GCAGCAGATGACTTCATTTTGAGGAATAATGCAAAACTTGATGGCTGTCT
GATTGAATGTTTAAGAGGTTCAAAGGGACAGTTAACGAGTACTCTATTCA
ACTCGTCCTTAACCAAGACAGGAGCACTAATCATCAAgCAAGGACATGGT
ACAGTGAATTGTTGCCAAGGGGATCTTCGAGGGGCTTACACCAAACGTAT
TAATCATAGGTTAAAGAAAGAGGGGAAATGCAATACGAGCAAAGCTTGCC
ACAACACGAAGAGCAAGCAACGCACATTCACCGCtagaaaacataaaaat
aattcaGTTGCCGTTCAGTTCAGGAACTCGTTAGTGGATTTGATAGAGAC
CATCCTGCTATGTCAGGCTCATTTCGTCAGGTGCATAAAGCCGAACAAAG
TAAAAGAAGCAGATAACTTTGACGTGGATTTTGTTAGAGCTCAAATCAAA
TGCAACGGCATCCTGGATTCCGTTCGTATTCGCAAAGACGGTTTTCCTGT
TCGGCTGCCGTTCAAAATCTTTGTGGAGAGaTATCGTTTTGTGAAATTTG
ATATGACGTCACCATTGGAGAACACTGGAGAAATATGTCAACAGATTCTT
CAACATTGCAACATTGATGACGGCTACAAGATTGGTGCCACCAGgGTGTT
GCTTCGCCTTGAGCACGTACAGAAATTGTTATCCTCACTTGATGAACAAA
CTCGAAGAATCGTCATCGCGCAGAAAATGGTAAGAGGAAAATTAGCGCGC
ATCGATTTTGATTTCTTACAAACGTCACGCAAACAAGAAGATCGAAACGT
CGGCAATTTGTTGGTCTCGATCTCATCACGCAGCAGCAAGATGCATGACA
ATCTCTTGATATTGAACGATTACGATTTGAAGCGACATCAACGTGTTAAA
GATAAGGAGATGAAGAAAGAAATTGAGAAGGAGAACTTCATCCAAAAACG
CAAATTGACGAGTGCCACAGATCCTGAATTGAAACTTCGTGAAAGTCAAC
AACGACCCGCCCCTGAAAACTCACCAAACAGAAAGGTTCCACGCAACAAA
CAACGCACACAAACAGAACCATTGATTCGCAACTTCATCTCGGGTCCACA
ATCAGCATGGTGTATGGTCAAATGCTACGAACGCCAATTCCACATTGCAT
CTTTCCAAATGGAAGAAGCTGTCATTTGTGTTGACGGCACACACACATTC
AGTGATAAAAACCGCATCGCCTTTGCCACCCTCCCCGTACGGGCGGACGA
TCCAAAAGTCGCCAAAGTGAAAAGTTGTATCGGGAAAGGAGTCCAGTTAC
ACCAAGACGAGCGACAAAACTTGTGGGCTACGCGACTTGGTAAAAACCCT
ATATTTGTGCGTGGTCATACCTTATGTCCAGAACTGGTCAAACTGAACGG
CAAACTTACGCAAGGCGTACCCATGAAAGTGTTAGATACGGCCGCTTTCA
AGGATTACATGCGTGAAGAAGTTGAGAAAAATGGCGGCGTCACTGAAGAC
CTCAAAGATCGAATCATGTCTAAACTGAAGATTTGCATGAGTTTCATCAA
AGATACACACTTAGACGAAGAAACGCCGTGTTGGTTCGAAATTTGGCTTG
TCAAAGTCAAGGAGCATGTTAGACGTTACCTTGACAACCAACAGAAACGA
GAGAAACGAAAATCAGGACATTTAGACATGCGTATTACACAAACACAAGA
ATCCGTTAAACGAATTGCAGCCATGCCTGAAATGAGGCGCGCTAAAAGCG
GTGATCATTTACGTAGACCACGAAGTAATACGGCAGGCCCGAATCCTGCC
GAAACGACGGGAAAACCGGCCCGTTCATCAAGACCGCCGTCACAAATAAT
CGGCGAAAAATCCATCGCACGTCATCGAGGGACGACATCAGCAGACACAA
CGGCGCAATGGCGTGTGGAACAAAAGATTACGCAAGAAATGTTACAACGT
GAACGTAGTATGGACATGATTCGACGTGAGAAAAGCATGGACGTACGGCT
GGAGTCGCGACTTTTAATGGAACGCGAATATCGAAACAGTATGGGAAAAC
CTTTAGTTGAATCTCAACACGTGAACAGAGTGAGGGGTAGCGAGAAAAGT
AGCCCCGGTCAAAGTCCACCGCAATCACTGGCCCGTAGTACGGGAAGCAG
TATGGGATCACGTAAAGACAATTCGACCACAGCCAACGATTCCCCTCGTA
TAGTTAACGGTCCACATACGCCCGTTTCACGTATGCCCGCCCACTCTCAA
CAAAATCCTCATGAAGAATTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCG
TGAAGGAATGAGTTATCGACAAGTATTTGGACTTCAATCATCAGACTATT
TATTTAACGTGACGCCGCCTAATTACACGCGCCATCGACGTTTCTCAGAC
TCAGATACTGAATCCCTtcacaatttcaatttcatacaCAAAGTAATCAC
ACAACCTTCAACGCCCACTCACCAATCCACCCAACAATTAACAAACGCCC
AACAAACGCCCTCCCAACAAACAGAAGATCCGAAGAAATCGAAAGTACTT
CAACAACCGAAAAGttggatgaaaaaagtacgACGAAAGTCGGAAGATAA
TCCAAAACGAAAAGTTGTAGCGCAACTTTCTAACAAATAAATGGATTTGA
ACGACTTATGTGACCTTGAAAATCCTGATGATGATGTTATTGTTGACGCT
ATCAAAAAGAGATATGAGTGTGGGTATTTCTATACTTGTATTGGAGATAT
TCTCATCTCAATCAACCCATACAAAGAGTCCATCTTGAATTCGCTTGAGG
TATCACACAGATATAAAGATGAACCTTCTCTTACGCAAACCAACCCACAT
GTCTTTGGTACCACAAACAATTTATATCATTTCCTCAATGTCAACAAAGA
AAGTCAATGCTTCATCGTCTCTGGTGAATCTGGTTCTGGAAAAAGTGAAG
TCATTCATCAAGCTGTCACACATTTTTTATGTCTAGTTTCAACGTCTGAT
AGGAGTTTCAAAGAAAGAATTTTACAGGCAAATGTAATTCTGGAAGCTTT
TGGAAATGCACGGACAAGTTTAAATTCAAATGCAACaagattttgcaaat
atttaaaGTTCCATTTCGATAGCAAGTTACATCTATCCGGAGTATCAATC
ACAGATTATTTGCTTGAGTTGCCGAGAGTTTCAAATCAAAGACAGGGAGA
AGCAAATTTCAATATCTTTTATTACATGTTTTCTGGGCGAACCGAAGATG
AGCTATCAAAACAATTACTTGATACCCCTACACAACACAAATATTTGAAG
TATGGTGAGTTTTTTGGGGATGATTTACTTTCTTGGAGTCAGGCTTATGA
AAGTCTTATTGATGCATTTCAAGTTGTCGGCTTCACACAAGAGactgTCA
AAGAGATATTTGGTATTTTGTCAGCCATTTTGAATATAGGTGATTTGAAG
TTCAAATGTGAAGACGAAACAACAGGTGTTTTTGTGGACAATCTAGAAAT
ACTTGATAAAGtTTCTATTCTACTTGGAGTGgacacaagcgatttggaac
tTTGTTTAACCAGTAATTTGTTTGTGAAACCAgATGATGGTGTTTCTGGC
TTCAAAAGTCTGAGTGAAGCTGAACAAACCAGAGATTTCATGGCCAATTT
CATGTATGCAAGATTGTTTAGTTGGATAGTCAGCAACATTAACACTTTCT
TGAACCCTGGCGAACCAAAAAAGAAACAATCTGAGCATGTGCATGTTgga
tttcttgatatttttgggTTTGAAGATTTCCAGAAAAACACACTAGAACA
ATTGTGTATTAACACCACAAATGAACAGATTAATTTGCACTTTATACAAC
ACGTCTTTGCACGGGAACAGgttgatTACCAAGAAGAAGGGCTTTCAGAA
TTACAATTAGTGGAATATTTTGATAACAAGAATATTGTTAATCTTCTCCT
TGAGACACCTCACGGCATCTTTGCATTATTGGAGGAAGAAAGCAAATGTT
TGCAAGCAGATGATCAGACGCTTGTCTCTTCTTTCAATGCTCATTGTTCA
GAATTGAAGTTCTATATTCCGTCCACCGCAAACGCATCCACTTTCAGTAT
CGTACActacaataaaaaaGTAACTTACGCAGCAGATGACTTCATTTTGA
GGAATAATGCAAAACTTGATGGCTGTCTGATTGAATGTTTAAGAGGTTCA
AAGGGACAGTTAACGAGTACTCTATTCAACTCGTCCTTAACCAAGACAGG
AGCACTAATCATCAAgCAAGGACATGGTACAGTGAATTGTTGCCAAGGGG
ATCTTCGAGGGGCTTACACCAAACGTATTAATCATAGGTTAAAGAAAGAG
GGGAAATGCAATACGAGCAAAGCTTGCCACAACACGAAGAGCAAGCAACG
CACATTCACCGCtagaaaacataaaaataattcaGTTGCCGTTCAGTTCA
GGAACTCGTTAGTGGATTTGATAGAGACCATCCTGCTATGTCAGGCTCAT
TTCGTCAGGTGCATAAAGCCGAACAAAGTAAAAGAAGCAGATAACTTTGA
CGTGGATTTTGTTAGAGCTCAAATCAAATGCAACGGCATCCTGGATTCCG
TTCGTATTCGCAAAGACGGTTTTCCTGTTCGGCTGCCGTTCAAAATCTTT
GTGGAGAGaTATCGTTTTGTGAAATTTGATATGACGTCACCATTGGAGAA
CACTGGAGAAATATGTCAACAGATTCTTCAACATTGCAACATTGATGACG
GCTACAAGATTGGTGCCACCAGgGTGTTGCTTCGCCTTGAGCACGTACAG
AAATTGTTATCCTCACTTGATGAACAAACTCGAAGAATCGTCATCGCGCA
GAAAATGGTAAGAGGAAAATTAGCGCGCATCGATTTTGATTTCTTACAAA
CGTCACGCAAACAAGAAGATCGAAACGTCGGCAATTTGTTGGTCTCGATC
TCATCACGCAGCAGCAAGATGCATGACAATCTCTTGATATTGAACGATTA
CGATTTGAAGCGACATCAACGTGTTAAAGATAAGGAGATGAAGAAAGAAA
TTGAGAAGGAGAACTTCATCCAAAAACGCAAATTGACGAGTGCCACAGAT
CCTGAATTGAAACTTCGTGAAAGTCAACAACGACCCGCCCCTGAAAACTC
ACCAAACAGAAAGGTTCCACGCAACAAACAACGCACACAAACAGAACCAT
TGATTCGCAACTTCATCTCGGGTCCACAATCAGCATGGTGTATGGTCAAA
TGCTACGAACGCCAATTCCACATTGCATCTTTCCAAATGGAAGAAGCTGT
CATTTGTGTTGACGGCACACACACATTCAGTGATAAAAACCGCATCGCCT
TTGCCACCCTCCCCGTACGGGCGGACGATCCAAAAGTCGCCAAAGTGAAA
AGTTGTATCGGGAAAGGAGTCCAGTTACACCAAGACGAGCGACAAAACTT
GTGGGCTACGCGACTTGGTAAAAACCCTATATTTGTGCGTGGTCATACCT
TATGTCCAGAACTGGTCAAACTGAACGGCAAACTTACGCAAGGCGTACCC
ATGAAAGTGTTAGATACGGCCGCTTTCAAGGATTACATGCGTGAAGAAGT
TGAGAAAAATGGCGGCGTCACTGAAGACCTCAAAGATCGAATCATGTCTA
AACTGAAGATTTGCATGAGTTTCATCAAAGATACACACTTAGACGAAGAA
ACGCCGTGTTGGTTCGAAATTTGGCTTGTCAAAGTCAAGGAGCATGTTAG
ACGTTACCTTGACAACCAACAGAAACGAGAGAAACGAAAATCAGGACATT
TAGACATGCGTATTACACAAACACAAGAATCCGTTAAACGAATTGCAGCC
ATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATCATTTACGTAGACCACG
AAGTAATACGGCAGGCCCGAATCCTGCCGAAACGACGGGAAAACCGGCCC
GTTCATCAAGACCGCCGTCACAAATAATCGGCGAAAAATCCATCGCACGT
CATCGAGGGACGACATCAGCAGACACAACGGCGCAATGGCGTGTGGAACA
AAAGATTACGCAAGAAATGTTACAACGTGAACGTAGTATGGACATGATTC
GACGTGAGAAAAGCATGGACGTACGGCTGGAGTCGCGACTTTTAATGGAA
CGCGAATATCGAAACAGTATGGGAAAACCTTTAGTTGAATCTCAACACGT
GAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCACCGC
AATCACTGGCCCGTAGTACGGGAAGCAGTATGGGATCACGTAAAGACAAT
TCGACCACAGCCAACGATTCCCCTCGTATAGTTAACGGTCCACATACGCC
CGTTTCACGTATGCCCGCCCACTCTCAACAAAATCCTCATGAAGAATTTC
GAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAATGAGTTATCGACAA
GTATTTGGACTTCAATCATCAGACTATTTATTTAACGTGACGCCGCCTAA
TTACACGCGCCATCGACGTTTCTCAGACTCAGATACTGAATCCCTtcaca
atttcaatttcatacaCAAAGTAATCACACAACCTTCAACGCCCACTCAC
CAATCCACCCAACAATTAACAAACGCCCAACAAACGCCCTCCCAACAAAC
AGAAGATCCGAAGAAATCGAAAGTACTTCAACAACCGAAAAGttggatga
aaaaagtacgACGAAAGTCGGAAGATAATCCAAAACGAAAAGTTGTAGCG
CAACTTTCTAACAAATAAATGGATTTGAACGACTTATGTGACCTTGAAAA
TCCTGATGATGATGTTATTGTTGACGCTATCAAAAAGAGATATGAGTGTG
GGTATTTCTATACTTGTATTGGAGATATTCTCATCTCAATCAACCCATAC
AAAGAGTCCATCTTGAATTCGCTTGAGGTATCACACAGATATAAAGATGA
ACCTTCTCTTACGCAAACCAACCCACATGTCTTTGGTACCACAAACAATT
TATATCATTTCCTCAATGTCAACAAAGAAAGTCAATGCTTCATCGTCTCT
GGTGAATCTGGTTCTGGAAAAAGTGAAGTCATTCATCAAGCTGTCACACA
TTTTTTATGTCTAGTTTCAACGTCTGATAGGAGTTTCAAAGAAAGAATTT
TACAGGCAAATGTAATTCTGGAAGCTTTTGGAAATGCACGGACAAGTTTA
AATTCAAATGCAACaagattttgcaaatatttaaaGTTCCATTTCGATAG
CAAGTTACATCTATCCGGAGTATCAATCACAGATTATTTGCTTGAGTTGC
CGAGAGTTTCAAATCAAAGACAGGGAGAAGCAAATTTCAATATCTTTTAT
TACATGTTTTCTGGGCGAACCGAAGATGAGCTATCAAAACAATTACTTGA
TACCCCTACACAACACAAATATTTGAAGTATGGTGAGTTTTTTGGGGATG
ATTTACTTTCTTGGAGTCAGGCTTATGAAAGTCTTATTGATGCATTTCAA
GTTGTCGGCTTCACACAAGAGactgTCAAAGAGATATTTGGTATTTTGTC
AGCCATTTTGAATATAGGTGATTTGAAGTTCAAATGTGAAGACGAAACAA
CAGGTGTTTTTGTGGACAATCTAGAAATACTTGATAAAGtTTCTATTCTA
CTTGGAGTGgacacaagcgatttggaactTTGTTTAACCAGTAATTTGTT
TGTGAAACCAgATGATGGTGTTTCTGGCTTCAAAAGTCTGAGTGAAGCTG
AACAAACCAGAGATTTCATGGCCAATTTCATGTATGCAAGATTGTTTAGT
TGGATAGTCAGCAACATTAACACTTTCTTGAACCCTGGCGAACCAAAAAA
GAAACAATCTGAGCATGTGCATGTTggatttcttgatatttttgggTTTG
AAGATTTCCAGAAAAACACACTAGAACAATTGTGTATTAACACCACAAAT
GAACAGATTAATTTGCACTTTATACAACACGTCTTTGCACGGGAACAGgt
tgatTACCAAGAAGAAGGGCTTTCAGAATTACAATTAGTGGAATATTTTG
ATAACAAGAATATTGTTAATCTTCTCCTTGAGACACCTCACGGCATCTTT
GCATTATTGGAGGAAGAAAGCAAATGTTTGCAAGCAGATGATCAGACGCT
TGTCTCTTCTTTCAATGCTCATTGTTCAGAATTGAAGTTCTATATTCCGT
CCACCGCAAACGCATCCACTTTCAGTATCGTACActacaataaaaaaGTA
ACTTACGCAGCAGATGACTTCATTTTGAGGAATAATGCAAAACTTGATGG
CTGTCTGATTGAATGTTTAAGAGGTTCAAAGGGACAGTTAACGAGTACTC
TATTCAACTCGTCCTTAACCAAGACAGGAGCACTAATCATCAAgCAAGGA
CATGGTACAGTGAATTGTTGCCAAGGGGATCTTCGAGGGGCTTACACCAA
ACGTATTAATCATAGGTTAAAGAAAGAGGGGAAATGCAATACGAGCAAAG
CTTGCCACAACACGAAGAGCAAGCAACGCACATTCACCGCtagaaaacat
aaaaataattcaGTTGCCGTTCAGTTCAGGAACTCGTTAGTGGATTTGAT
AGAGACCATCCTGCTATGTCAGGCTCATTTCGTCAGGTGCATAAAGCCGA
ACAAAGTAAAAGAAGCAGATAACTTTGACGTGGATTTTGTTAGAGCTCAA
ATCAAATGCAACGGCATCCTGGATTCCGTTCGTATTCGCAAAGACGGTTT
TCCTGTTCGGCTGCCGTTCAAAATCTTTGTGGAGAGaTATCGTTTTGTGA
AATTTGATATGACGTCACCATTGGAGAACACTGGAGAAATATGTCAACAG
ATTCTTCAACATTGCAACATTGATGACGGCTACAAGATTGGTGCCACCAG
gGTGTTGCTTCGCCTTGAGCACGTACAGAAATTGTTATCCTCACTTGATG
AACAAACTCGAAGAATCGTCATCGCGCAGAAAATGGTAAGAGGAAAATTA
GCGCGCATCGATTTTGATTTCTTACAAACGTCACGCAAACAAGAAGATCG
AAACGTCGGCAATTTGTTGGTCTCGATCTCATCACGCAGCAGCAAGATGC
ATGACAATCTCTTGATATTGAACGATTACGATTTGAAGCGACATCAACGT
GTTAAAGATAAGGAGATGAAGAAAGAAATTGAGAAGGAGAACTTCATCCA
AAAACGCAAATTGACGAGTGCCACAGATCCTGAATTGAAACTTCGTGAAA
GTCAACAACGACCCGCCCCTGAAAACTCACCAAACAGAAAGGTTCCACGC
AACAAACAACGCACACAAACAGAACCATTGATTCGCAACTTCATCTCGGG
TCCACAATCAGCATGGTGTATGGTCAAATGCTACGAACGCCAATTCCACA
TTGCATCTTTCCAAATGGAAGAAGCTGTCATTTGTGTTGACGGCACACAC
ACATTCAGTGATAAAAACCGCATCGCCTTTGCCACCCTCCCCGTACGGGC
GGACGATCCAAAAGTCGCCAAAGTGAAAAGTTGTATCGGGAAAGGAGTCC
AGTTACACCAAGACGAGCGACAAAACTTGTGGGCTACGCGACTTGGTAAA
AACCCTATATTTGTGCGTGGTCATACCTTATGTCCAGAACTGGTCAAACT
GAACGGCAAACTTACGCAAGGCGTACCCATGAAAGTGTTAGATACGGCCG
CTTTCAAGGATTACATGCGTGAAGAAGTTGAGAAAAATGGCGGCGTCACT
GAAGACCTCAAAGATCGAATCATGTCTAAACTGAAGATTTGCATGAGTTT
CATCAAAGATACACACTTAGACGAAGAAACGCCGTGTTGGTTCGAAATTT
GGCTTGTCAAAGTCAAGGAGCATGTTAGACGTTACCTTGACAACCAACAG
AAACGAGAGAAACGAAAATCAGGACATTTAGACATGCGTATTACACAAAC
ACAAGAATCCGTTAAACGAATTGCAGCCATGCCTGAAATGAGGCGCGCTA
AAAGCGGTGATCATTTACGTAGACCACGAAGTAATACGGCAGGCCCGAAT
CCTGCCGAAACGACGGGAAAACCGGCCCGTTCATCAAGACCGCCGTCACA
AATAATCGGCGAAAAATCCATCGCACGTCATCGAGGGACGACATCAGCAG
ACACAACGGCGCAATGGCGTGTGGAACAAAAGATTACGCAAGAAATGTTA
CAACGTGAACGTAGTATGGACATGATTCGACGTGAGAAAAGCATGGACGT
ACGGCTGGAGTCGCGACTTTTAATGGAACGCGAATATCGAAACAGTATGG
GAAAACCTTTAGTTGAATCTCAACACGTGAACAGAGTGAGGGGTAGCGAG
AAAAGTAGCCCCGGTCAAAGTCCACCGCAATCACTGGCCCGTAGTACGGG
AAGCAGTATGGGATCACGTAAAGACAATTCGACCACAGCCAACGATTCCC
CTCGTATAGTTAACGGTCCACATACGCCCGTTTCACGTATGCCCGCCCAC
TCTCAACAAAATCCTCATGAAGAATTTCGAAGGGGCGGAAGTGTGGCGGC
TGCCCGTGAAGGAATGAGTTATCGACAAGTATTTGGACTTCAATCATCAG
ACTATTTATTTAACGTGACGCCGCCTAATTACACGCGCCATCGACGTTTC
TCAGACTCAGATACTGAATCCCTtcacaatttcaatttcatacaCAAAGT
AATCACACAACCTTCAACGCCCACTCACCAATCCACCCAACAATTAACAA
ACGCCCAACAAACGCCCTCCCAACAAACAGAAGATCCGAAGAAATCGAAA
GTACTTCAACAACCGAAAAGttggatgaaaaaagtacgACGAAAGTCGGA
AGATAATCCAAAACGAAAAGTTGTAGCGCAACTTTCTAACAAATAAATGG
ATTTGAACGACTTATGTGACCTTGAAAATCCTGATGATGATGTTATTGTT
GACGCTATCAAAAAGAGATATGAGTGTGGGTATTTCTATACTTGTATTGG
AGATATTCTCATCTCAATCAACCCATACAAAGAGTCCATCTTGAATTCGC
TTGAGGTATCACACAGATATAAAGATGAACCTTCTCTTACGCAAACCAAC
CCACATGTCTTTGGTACCACAAACAATTTATATCATTTCCTCAATGTCAA
CAAAGAAAGTCAATGCTTCATCGTCTCTGGTGAATCTGGTTCTGGAAAAA
GTGAAGTCATTCATCAAGCTGTCACACATTTTTTATGTCTAGTTTCAACG
TCTGATAGGAGTTTCAAAGAAAGAATTTTACAGGCAAATGTAATTCTGGA
AGCTTTTGGAAATGCACGGACAAGTTTAAATTCAAATGCAACaagatttt
gcaaatatttaaaGTTCCATTTCGATAGCAAGTTACATCTATCCGGAGTA
TCAATCACAGATTATTTGCTTGAGTTGCCGAGAGTTTCAAATCAAAGACA
GGGAGAAGCAAATTTCAATATCTTTTATTACATGTTTTCTGGGCGAACCG
AAGATGAGCTATCAAAACAATTACTTGATACCCCTACACAACACAAATAT
TTGAAGTATGGTGAGTTTTTTGGGGATGATTTACTTTCTTGGAGTCAGGC
TTATGAAAGTCTTATTGATGCATTTCAAGTTGTCGGCTTCACACAAGAGa
ctgTCAAAGAGATATTTGGTATTTTGTCAGCCATTTTGAATATAGGTGAT
TTGAAGTTCAAATGTGAAGACGAAACAACAGGTGTTTTTGTGGACAATCT
AGAAATACTTGATAAAGtTTCTATTCTACTTGGAGTGgacacaagcgatt
tggaactTTGTTTAACCAGTAATTTGTTTGTGAAACCAgATGATGGTGTT
TCTGGCTTCAAAAGTCTGAGTGAAGCTGAACAAACCAGAGATTTCATGGC
CAATTTCATGTATGCAAGATTGTTTAGTTGGATAGTCAGCAACATTAACA
CTTTCTTGAACCCTGGCGAACCAAAAAAGAAACAATCTGAGCATGTGCAT
GTTggatttcttgatatttttgggTTTGAAGATTTCCAGAAAAACACACT
AGAACAATTGTGTATTAACACCACAAATGAACAGATTAATTTGCACTTTA
TACAACACGTCTTTGCACGGGAACAGgttgatTACCAAGAAGAAGGGCTT
TCAGAATTACAATTAGTGGAATATTTTGATAACAAGAATATTGTTAATCT
TCTCCTTGAGACACCTCACGGCATCTTTGCATTATTGGAGGAAGAAAGCA
AATGTTTGCAAGCAGATGATCAGACGCTTGTCTCTTCTTTCAATGCTCAT
TGTTCAGAATTGAAGTTCTATATTCCGTCCACCGCAAACGCATCCACTTT
CAGTATCGTACActacaataaaaaaGTAACTTACGCAGCAGATGACTTCA
TTTTGAGGAATAATGCAAAACTTGATGGCTGTCTGATTGAATGTTTAAGA
GGTTCAAAGGGACAGTTAACGAGTACTCTATTCAACTCGTCCTTAACCAA
GACAGGAGCACTAATCATCAAgCAAGGACATGGTACAGTGAATTGTTGCC
AAGGGGATCTTCGAGGGGCTTACACCAAACGTATTAATCATAGGTTAAAG
AAAGAGGGGAAATGCAATACGAGCAAAGCTTGCCACAACACGAAGAGCAA
GCAACGCACATTCACCGCtagaaaacataaaaataattcaGTTGCCGTTC
AGTTCAGGAACTCGTTAGTGGATTTGATAGAGACCATCCTGCTATGTCAG
GCTCATTTCGTCAGGTGCATAAAGCCGAACAAAGTAAAAGAAGCAGATAA
CTTTGACGTGGATTTTGTTAGAGCTCAAATCAAATGCAACGGCATCCTGG
ATTCCGTTCGTATTCGCAAAGACGGTTTTCCTGTTCGGCTGCCGTTCAAA
ATCTTTGTGGAGAGaTATCGTTTTGTGAAATTTGATATGACGTCACCATT
GGAGAACACTGGAGAAATATGTCAACAGATTCTTCAACATTGCAACATTG
ATGACGGCTACAAGATTGGTGCCACCAGgGTGTTGCTTCGCCTTGAGCAC
GTACAGAAATTGTTATCCTCACTTGATGAACAAACTCGAAGAATCGTCAT
CGCGCAGAAAATGGTAAGAGGAAAATTAGCGCGCATCGATTTTGATTTCT
TACAAACGTCACGCAAACAAGAAGATCGAAACGTCGGCAATTTGTTGGTC
TCGATCTCATCACGCAGCAGCAAGATGCATGACAATCTCTTGATATTGAA
CGATTACGATTTGAAGCGACATCAACGTGTTAAAGATAAGGAGATGAAGA
AAGAAATTGAGAAGGAGAACTTCATCCAAAAACGCAAATTGACGAGTGCC
ACAGATCCTGAATTGAAACTTCGTGAAAGTCAACAACGACCCGCCCCTGA
AAACTCACCAAACAGAAAGGTTCCACGCAACAAACAACGCACACAAACAG
AACCATTGATTCGCAACTTCATCTCGGGTCCACAATCAGCATGGTGTATG
GTCAAATGCTACGAACGCCAATTCCACATTGCATCTTTCCAAATGGAAGA
AGCTGTCATTTGTGTTGACGGCACACACACATTCAGTGATAAAAACCGCA
TCGCCTTTGCCACCCTCCCCGTACGGGCGGACGATCCAAAAGTCGCCAAA
GTGAAAAGTTGTATCGGGAAAGGAGTCCAGTTACACCAAGACGAGCGACA
AAACTTGTGGGCTACGCGACTTGGTAAAAACCCTATATTTGTGCGTGGTC
ATACCTTATGTCCAGAACTGGTCAAACTGAACGGCAAACTTACGCAAGGC
GTACCCATGAAAGTGTTAGATACGGCCGCTTTCAAGGATTACATGCGTGA
AGAAGTTGAGAAAAATGGCGGCGTCACTGAAGACCTCAAAGATCGAATCA
TGTCTAAACTGAAGATTTGCATGAGTTTCATCAAAGATACACACTTAGAC
GAAGAAACGCCGTGTTGGTTCGAAATTTGGCTTGTCAAAGTCAAGGAGCA
TGTTAGACGTTACCTTGACAACCAACAGAAACGAGAGAAACGAAAATCAG
GACATTTAGACATGCGTATTACACAAACACAAGAATCCGTTAAACGAATT
GCAGCCATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATCATTTACGTAG
ACCACGAAGTAATACGGCAGGCCCGAATCCTGCCGAAACGACGGGAAAAC
CGGCCCGTTCATCAAGACCGCCGTCACAAATAATCGGCGAAAAATCCATC
GCACGTCATCGAGGGACGACATCAGCAGACACAACGGCGCAATGGCGTGT
GGAACAAAAGATTACGCAAGAAATGTTACAACGTGAACGTAGTATGGACA
TGATTCGACGTGAGAAAAGCATGGACGTACGGCTGGAGTCGCGACTTTTA
ATGGAACGCGAATATCGAAACAGTATGGGAAAACCTTTAGTTGAATCTCA
ACACGTGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTC
CACCGCAATCACTGGCCCGTAGTACGGGAAGCAGTATGGGATCACGTAAA
GACAATTCGACCACAGCCAACGATTCCCCTCGTATAGTTAACGGTCCACA
TACGCCCGTTTCACGTATGCCCGCCCACTCTCAACAAAATCCTCATGAAG
AATTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAATGAGTTAT
CGACAAGTATTTGGACTTCAATCATCAGACTATTTATTTAACGTGACGCC
GCCTAATTACACGCGCCATCGACGTTTCTCAGACTCAGATACTGAATCCC
TtcacaatttcaatttcatacaCAAAGTAATCACACAACCTTCAACGCCC
ACTCACCAATCCACCCAACAATTAACAAACGCCCAACAAACGCCCTCCCA
ACAAACAGAAGATCCGAAGAAATCGAAAGTACTTCAACAACCGAAAAGtt
ggatgaaaaaagtacgACGAAAGTCGGAAGATAATCCAAAACGAAAAGTT
GTAGCGCAACTTTCTAACAAATAAATGGATTTGAACGACTTATGTGACCT
TGAAAATCCTGATGATGATGTTATTGTTGACGCTATCAAAAAGAGATATG
AGTGTGGGTATTTCTATACTTGTATTGGAGATATTCTCATCTCAATCAAC
CCATACAAAGAGTCCATCTTGAATTCGCTTGAGGTATCACACAGATATAA
AGATGAACCTTCTCTTACGCAAACCAACCCACATGTCTTTGGTACCACAA
ACAATTTATATCATTTCCTCAATGTCAACAAAGAAAGTCAATGCTTCATC
GTCTCTGGTGAATCTGGTTCTGGAAAAAGTGAAGTCATTCATCAAGCTGT
CACACATTTTTTATGTCTAGTTTCAACGTCTGATAGGAGTTTCAAAGAAA
GAATTTTACAGGCAAATGTAATTCTGGAAGCTTTTGGAAATGCACGGACA
AGTTTAAATTCAAATGCAACaagattttgcaaatatttaaaGTTCCATTT
CGATAGCAAGTTACATCTATCCGGAGTATCAATCACAGATTATTTGCTTG
AGTTGCCGAGAGTTTCAAATCAAAGACAGGGAGAAGCAAATTTCAATATC
TTTTATTACATGTTTTCTGGGCGAACCGAAGATGAGCTATCAAAACAATT
ACTTGATACCCCTACACAACACAAATATTTGAAGTATGGTGAGTTTTTTG
GGGATGATTTACTTTCTTGGAGTCAGGCTTATGAAAGTCTTATTGATGCA
TTTCAAGTTGTCGGCTTCACACAAGAGactgTCAAAGAGATATTTGGTAT
TTTGTCAGCCATTTTGAATATAGGTGATTTGAAGTTCAAATGTGAAGACG
AAACAACAGGTGTTTTTGTGGACAATCTAGAAATACTTGATAAAGtTTCT
ATTCTACTTGGAGTGgacacaagcgatttggaactTTGTTTAACCAGTAA
TTTGTTTGTGAAACCAgATGATGGTGTTTCTGGCTTCAAAAGTCTGAGTG
AAGCTGAACAAACCAGAGATTTCATGGCCAATTTCATGTATGCAAGATTG
TTTAGTTGGATAGTCAGCAACATTAACACTTTCTTGAACCCTGGCGAACC
AAAAAAGAAACAATCTGAGCATGTGCATGTTggatttcttgatatttttg
ggTTTGAAGATTTCCAGAAAAACACACTAGAACAATTGTGTATTAACACC
ACAAATGAACAGATTAATTTGCACTTTATACAACACGTCTTTGCACGGGA
ACAGgttgatTACCAAGAAGAAGGGCTTTCAGAATTACAATTAGTGGAAT
ATTTTGATAACAAGAATATTGTTAATCTTCTCCTTGAGACACCTCACGGC
ATCTTTGCATTATTGGAGGAAGAAAGCAAATGTTTGCAAGCAGATGATCA
GACGCTTGTCTCTTCTTTCAATGCTCATTGTTCAGAATTGAAGTTCTATA
TTCCGTCCACCGCAAACGCATCCACTTTCAGTATCGTACActacaataaa
aaaGTAACTTACGCAGCAGATGACTTCATTTTGAGGAATAATGCAAAACT
TGATGGCTGTCTGATTGAATGTTTAAGAGGTTCAAAGGGACAGTTAACGA
GTACTCTATTCAACTCGTCCTTAACCAAGACAGGAGCACTAATCATCAAg
CAAGGACATGGTACAGTGAATTGTTGCCAAGGGGATCTTCGAGGGGCTTA
CACCAAACGTATTAATCATAGGTTAAAGAAAGAGGGGAAATGCAATACGA
GCAAAGCTTGCCACAACACGAAGAGCAAGCAACGCACATTCACCGCtaga
aaacataaaaataattcaGTTGCCGTTCAGTTCAGGAACTCGTTAGTGGA
TTTGATAGAGACCATCCTGCTATGTCAGGCTCATTTCGTCAGGTGCATAA
AGCCGAACAAAGTAAAAGAAGCAGATAACTTTGACGTGGATTTTGTTAGA
GCTCAAATCAAATGCAACGGCATCCTGGATTCCGTTCGTATTCGCAAAGA
CGGTTTTCCTGTTCGGCTGCCGTTCAAAATCTTTGTGGAGAGaTATCGTT
TTGTGAAATTTGATATGACGTCACCATTGGAGAACACTGGAGAAATATGT
CAACAGATTCTTCAACATTGCAACATTGATGACGGCTACAAGATTGGTGC
CACCAGgGTGTTGCTTCGCCTTGAGCACGTACAGAAATTGTTATCCTCAC
TTGATGAACAAACTCGAAGAATCGTCATCGCGCAGAAAATGGTAAGAGGA
AAATTAGCGCGCATCGATTTTGATTTCTTACAAACGTCACGCAAACAAGA
AGATCGAAACGTCGGCAATTTGTTGGTCTCGATCTCATCACGCAGCAGCA
AGATGCATGACAATCTCTTGATATTGAACGATTACGATTTGAAGCGACAT
CAACGTGTTAAAGATAAGGAGATGAAGAAAGAAATTGAGAAGGAGAACTT
CATCCAAAAACGCAAATTGACGAGTGCCACAGATCCTGAATTGAAACTTC
GTGAAAGTCAACAACGACCCGCCCCTGAAAACTCACCAAACAGAAAGGTT
CCACGCAACAAACAACGCACACAAACAGAACCATTGATTCGCAACTTCAT
CTCGGGTCCACAATCAGCATGGTGTATGGTCAAATGCTACGAACGCCAAT
TCCACATTGCATCTTTCCAAATGGAAGAAGCTGTCATTTGTGTTGACGGC
ACACACACATTCAGTGATAAAAACCGCATCGCCTTTGCCACCCTCCCCGT
ACGGGCGGACGATCCAAAAGTCGCCAAAGTGAAAAGTTGTATCGGGAAAG
GAGTCCAGTTACACCAAGACGAGCGACAAAACTTGTGGGCTACGCGACTT
GGTAAAAACCCTATATTTGTGCGTGGTCATACCTTATGTCCAGAACTGGT
CAAACTGAACGGCAAACTTACGCAAGGCGTACCCATGAAAGTGTTAGATA
CGGCCGCTTTCAAGGATTACATGCGTGAAGAAGTTGAGAAAAATGGCGGC
GTCACTGAAGACCTCAAAGATCGAATCATGTCTAAACTGAAGATTTGCAT
GAGTTTCATCAAAGATACACACTTAGACGAAGAAACGCCGTGTTGGTTCG
AAATTTGGCTTGTCAAAGTCAAGGAGCATGTTAGACGTTACCTTGACAAC
CAACAGAAACGAGAGAAACGAAAATCAGGACATTTAGACATGCGTATTAC
ACAAACACAAGAATCCGTTAAACGAATTGCAGCCATGCCTGAAATGAGGC
GCGCTAAAAGCGGTGATCATTTACGTAGACCACGAAGTAATACGGCAGGC
CCGAATCCTGCCGAAACGACGGGAAAACCGGCCCGTTCATCAAGACCGCC
GTCACAAATAATCGGCGAAAAATCCATCGCACGTCATCGAGGGACGACAT
CAGCAGACACAACGGCGCAATGGCGTGTGGAACAAAAGATTACGCAAGAA
ATGTTACAACGTGAACGTAGTATGGACATGATTCGACGTGAGAAAAGCAT
GGACGTACGGCTGGAGTCGCGACTTTTAATGGAACGCGAATATCGAAACA
GTATGGGAAAACCTTTAGTTGAATCTCAACACGTGAACAGAGTGAGGGGT
AGCGAGAAAAGTAGCCCCGGTCAAAGTCCACCGCAATCACTGGCCCGTAG
TACGGGAAGCAGTATGGGATCACGTAAAGACAATTCGACCACAGCCAACG
ATTCCCCTCGTATAGTTAACGGTCCACATACGCCCGTTTCACGTATGCCC
GCCCACTCTCAACAAAATCCTCATGAAGAATTTCGAAGGGGCGGAAGTGT
GGCGGCTGCCCGTGAAGGAATGAGTTATCGACAAGTATTTGGACTTCAAT
CATCAGACTATTTATTTAACGTGACGCCGCCTAATTACACGCGCCATCGA
CGTTTCTCAGACTCAGATACTGAATCCCTtcacaatttcaatttcataca
CAAAGTAATCACACAACCTTCAACGCCCACTCACCAATCCACCCAACAAT
TAACAAACGCCCAACAAACGCCCTCCCAACAAACAGAAGATCCGAAGAAA
TCGAAAGTACTTCAACAACCGAAAAGttggatgaaaaaagtacgACGAAA
GTCGGAAGATAATCCAAAACGAAAAGTTGTAGCGCAACTTTCTAACAAAT
AAATGGATTTGAACGACTTATGTGACCTTGAAAATCCTGATGATGATGTT
ATTGTTGACGCTATCAAAAAGAGATATGAGTGTGGGTATTTCTATACTTG
TATTGGAGATATTCTCATCTCAATCAACCCATACAAAGAGTCCATCTTGA
ATTCGCTTGAGGTATCACACAGATATAAAGATGAACCTTCTCTTACGCAA
ACCAACCCACATGTCTTTGGTACCACAAACAATTTATATCATTTCCTCAA
TGTCAACAAAGAAAGTCAATGCTTCATCGTCTCTGGTGAATCTGGTTCTG
GAAAAAGTGAAGTCATTCATCAAGCTGTCACACATTTTTTATGTCTAGTT
TCAACGTCTGATAGGAGTTTCAAAGAAAGAATTTTACAGGCAAATGTAAT
TCTGGAAGCTTTTGGAAATGCACGGACAAGTTTAAATTCAAATGCAACaa
gattttgcaaatatttaaaGTTCCATTTCGATAGCAAGTTACATCTATCC
GGAGTATCAATCACAGATTATTTGCTTGAGTTGCCGAGAGTTTCAAATCA
AAGACAGGGAGAAGCAAATTTCAATATCTTTTATTACATGTTTTCTGGGC
GAACCGAAGATGAGCTATCAAAACAATTACTTGATACCCCTACACAACAC
AAATATTTGAAGTATGGTGAGTTTTTTGGGGATGATTTACTTTCTTGGAG
TCAGGCTTATGAAAGTCTTATTGATGCATTTCAAGTTGTCGGCTTCACAC
AAGAGactgTCAAAGAGATATTTGGTATTTTGTCAGCCATTTTGAATATA
GGTGATTTGAAGTTCAAATGTGAAGACGAAACAACAGGTGTTTTTGTGGA
CAATCTAGAAATACTTGATAAAGtTTCTATTCTACTTGGAGTGgacacaa
gcgatttggaactTTGTTTAACCAGTAATTTGTTTGTGAAACCAgATGAT
GGTGTTTCTGGCTTCAAAAGTCTGAGTGAAGCTGAACAAACCAGAGATTT
CATGGCCAATTTCATGTATGCAAGATTGTTTAGTTGGATAGTCAGCAACA
TTAACACTTTCTTGAACCCTGGCGAACCAAAAAAGAAACAATCTGAGCAT
GTGCATGTTggatttcttgatatttttgggTTTGAAGATTTCCAGAAAAA
CACACTAGAACAATTGTGTATTAACACCACAAATGAACAGATTAATTTGC
ACTTTATACAACACGTCTTTGCACGGGAACAGgttgatTACCAAGAAGAA
GGGCTTTCAGAATTACAATTAGTGGAATATTTTGATAACAAGAATATTGT
TAATCTTCTCCTTGAGACACCTCACGGCATCTTTGCATTATTGGAGGAAG
AAAGCAAATGTTTGCAAGCAGATGATCAGACGCTTGTCTCTTCTTTCAAT
GCTCATTGTTCAGAATTGAAGTTCTATATTCCGTCCACCGCAAACGCATC
CACTTTCAGTATCGTACActacaataaaaaaGTAACTTACGCAGCAGATG
ACTTCATTTTGAGGAATAATGCAAAACTTGATGGCTGTCTGATTGAATGT
TTAAGAGGTTCAAAGGGACAGTTAACGAGTACTCTATTCAACTCGTCCTT
AACCAAGACAGGAGCACTAATCATCAAgCAAGGACATGGTACAGTGAATT
GTTGCCAAGGGGATCTTCGAGGGGCTTACACCAAACGTATTAATCATAGG
TTAAAGAAAGAGGGGAAATGCAATACGAGCAAAGCTTGCCACAACACGAA
GAGCAAGCAACGCACATTCACCGCtagaaaacataaaaataattcaGTTG
CCGTTCAGTTCAGGAACTCGTTAGTGGATTTGATAGAGACCATCCTGCTA
TGTCAGGCTCATTTCGTCAGGTGCATAAAGCCGAACAAAGTAAAAGAAGC
AGATAACTTTGACGTGGATTTTGTTAGAGCTCAAATCAAATGCAACGGCA
TCCTGGATTCCGTTCGTATTCGCAAAGACGGTTTTCCTGTTCGGCTGCCG
TTCAAAATCTTTGTGGAGAGaTATCGTTTTGTGAAATTTGATATGACGTC
ACCATTGGAGAACACTGGAGAAATATGTCAACAGATTCTTCAACATTGCA
ACATTGATGACGGCTACAAGATTGGTGCCACCAGgGTGTTGCTTCGCCTT
GAGCACGTACAGAAATTGTTATCCTCACTTGATGAACAAACTCGAAGAAT
CGTCATCGCGCAGAAAATGGTAAGAGGAAAATTAGCGCGCATCGATTTTG
ATTTCTTACAAACGTCACGCAAACAAGAAGATCGAAACGTCGGCAATTTG
TTGGTCTCGATCTCATCACGCAGCAGCAAGATGCATGACAATCTCTTGAT
ATTGAACGATTACGATTTGAAGCGACATCAACGTGTTAAAGATAAGGAGA
TGAAGAAAGAAATTGAGAAGGAGAACTTCATCCAAAAACGCAAATTGACG
AGTGCCACAGATCCTGAATTGAAACTTCGTGAAAGTCAACAACGACCCGC
CCCTGAAAACTCACCAAACAGAAAGGTTCCACGCAACAAACAACGCACAC
AAACAGAACCATTGATTCGCAACTTCATCTCGGGTCCACAATCAGCATGG
TGTATGGTCAAATGCTACGAACGCCAATTCCACATTGCATCTTTCCAAAT
GGAAGAAGCTGTCATTTGTGTTGACGGCACACACACATTCAGTGATAAAA
ACCGCATCGCCTTTGCCACCCTCCCCGTACGGGCGGACGATCCAAAAGTC
GCCAAAGTGAAAAGTTGTATCGGGAAAGGAGTCCAGTTACACCAAGACGA
GCGACAAAACTTGTGGGCTACGCGACTTGGTAAAAACCCTATATTTGTGC
GTGGTCATACCTTATGTCCAGAACTGGTCAAACTGAACGGCAAACTTACG
CAAGGCGTACCCATGAAAGTGTTAGATACGGCCGCTTTCAAGGATTACAT
GCGTGAAGAAGTTGAGAAAAATGGCGGCGTCACTGAAGACCTCAAAGATC
GAATCATGTCTAAACTGAAGATTTGCATGAGTTTCATCAAAGATACACAC
TTAGACGAAGAAACGCCGTGTTGGTTCGAAATTTGGCTTGTCAAAGTCAA
GGAGCATGTTAGACGTTACCTTGACAACCAACAGAAACGAGAGAAACGAA
AATCAGGACATTTAGACATGCGTATTACACAAACACAAGAATCCGTTAAA
CGAATTGCAGCCATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATCATTT
ACGTAGACCACGAAGTAATACGGCAGGCCCGAATCCTGCCGAAACGACGG
GAAAACCGGCCCGTTCATCAAGACCGCCGTCACAAATAATCGGCGAAAAA
TCCATCGCACGTCATCGAGGGACGACATCAGCAGACACAACGGCGCAATG
GCGTGTGGAACAAAAGATTACGCAAGAAATGTTACAACGTGAACGTAGTA
TGGACATGATTCGACGTGAGAAAAGCATGGACGTACGGCTGGAGTCGCGA
CTTTTAATGGAACGCGAATATCGAAACAGTATGGGAAAACCTTTAGTTGA
ATCTCAACACGTGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTC
AAAGTCCACCGCAATCACTGGCCCGTAGTACGGGAAGCAGTATGGGATCA
CGTAAAGACAATTCGACCACAGCCAACGATTCCCCTCGTATAGTTAACGG
TCCACATACGCCCGTTTCACGTATGCCCGCCCACTCTCAACAAAATCCTC
ATGAAGAATTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAATG
AGTTATCGACAAGTATTTGGACTTCAATCATCAGACTATTTATTTAACGT
GACGCCGCCTAATTACACGCGCCATCGACGTTTCTCAGACTCAGATACTG
AATCCCTtcacaatttcaatttcatacaCAAAGTAATCACACAACCTTCA
ACGCCCACTCACCAATCCACCCAACAATTAACAAACGCCCAACAAACGCC
CTCCCAACAAACAGAAGATCCGAAGAAATCGAAAGTACTTCAACAACCGA
AAAGttggatgaaaaaagtacgACGAAAGTCGGAAGATAATCCAAAACGA
AAAGTTGTAGCGCAACTTTCTAACAAATAAATGGATTTGAACGACTTATG
TGACCTTGAAAATCCTGATGATGATGTTATTGTTGACGCTATCAAAAAGA
GATATGAGTGTGGGTATTTCTATACTTGTATTGGAGATATTCTCATCTCA
ATCAACCCATACAAAGAGTCCATCTTGAATTCGCTTGAGGTATCACACAG
ATATAAAGATGAACCTTCTCTTACGCAAACCAACCCACATGTCTTTGGTA
CCACAAACAATTTATATCATTTCCTCAATGTCAACAAAGAAAGTCAATGC
TTCATCGTCTCTGGTGAATCTGGTTCTGGAAAAAGTGAAGTCATTCATCA
AGCTGTCACACATTTTTTATGTCTAGTTTCAACGTCTGATAGGAGTTTCA
AAGAAAGAATTTTACAGGCAAATGTAATTCTGGAAGCTTTTGGAAATGCA
CGGACAAGTTTAAATTCAAATGCAACaagattttgcaaatatttaaaGTT
CCATTTCGATAGCAAGTTACATCTATCCGGAGTATCAATCACAGATTATT
TGCTTGAGTTGCCGAGAGTTTCAAATCAAAGACAGGGAGAAGCAAATTTC
AATATCTTTTATTACATGTTTTCTGGGCGAACCGAAGATGAGCTATCAAA
ACAATTACTTGATACCCCTACACAACACAAATATTTGAAGTATGGTGAGT
TTTTTGGGGATGATTTACTTTCTTGGAGTCAGGCTTATGAAAGTCTTATT
GATGCATTTCAAGTTGTCGGCTTCACACAAGAGactgTCAAAGAGATATT
TGGTATTTTGTCAGCCATTTTGAATATAGGTGATTTGAAGTTCAAATGTG
AAGACGAAACAACAGGTGTTTTTGTGGACAATCTAGAAATACTTGATAAA
GtTTCTATTCTACTTGGAGTGgacacaagcgatttggaactTTGTTTAAC
CAGTAATTTGTTTGTGAAACCAgATGATGGTGTTTCTGGCTTCAAAAGTC
TGAGTGAAGCTGAACAAACCAGAGATTTCATGGCCAATTTCATGTATGCA
AGATTGTTTAGTTGGATAGTCAGCAACATTAACACTTTCTTGAACCCTGG
CGAACCAAAAAAGAAACAATCTGAGCATGTGCATGTTggatttcttgata
tttttgggTTTGAAGATTTCCAGAAAAACACACTAGAACAATTGTGTATT
AACACCACAAATGAACAGATTAATTTGCACTTTATACAACACGTCTTTGC
ACGGGAACAGgttgatTACCAAGAAGAAGGGCTTTCAGAATTACAATTAG
TGGAATATTTTGATAACAAGAATATTGTTAATCTTCTCCTTGAGACACCT
CACGGCATCTTTGCATTATTGGAGGAAGAAAGCAAATGTTTGCAAGCAGA
TGATCAGACGCTTGTCTCTTCTTTCAATGCTCATTGTTCAGAATTGAAGT
TCTATATTCCGTCCACCGCAAACGCATCCACTTTCAGTATCGTACActac
aataaaaaaGTAACTTACGCAGCAGATGACTTCATTTTGAGGAATAATGC
AAAACTTGATGGCTGTCTGATTGAATGTTTAAGAGGTTCAAAGGGACAGT
TAACGAGTACTCTATTCAACTCGTCCTTAACCAAGACAGGAGCACTAATC
ATCAAgCAAGGACATGGTACAGTGAATTGTTGCCAAGGGGATCTTCGAGG
GGCTTACACCAAACGTATTAATCATAGGTTAAAGAAAGAGGGGAAATGCA
ATACGAGCAAAGCTTGCCACAACACGAAGAGCAAGCAACGCACATTCACC
GCtagaaaacataaaaataattcaGTTGCCGTTCAGTTCAGGAACTCGTT
AGTGGATTTGATAGAGACCATCCTGCTATGTCAGGCTCATTTCGTCAGGT
GCATAAAGCCGAACAAAGTAAAAGAAGCAGATAACTTTGACGTGGATTTT
GTTAGAGCTCAAATCAAATGCAACGGCATCCTGGATTCCGTTCGTATTCG
CAAAGACGGTTTTCCTGTTCGGCTGCCGTTCAAAATCTTTGTGGAGAGaT
ATCGTTTTGTGAAATTTGATATGACGTCACCATTGGAGAACACTGGAGAA
ATATGTCAACAGATTCTTCAACATTGCAACATTGATGACGGCTACAAGAT
TGGTGCCACCAGgGTGTTGCTTCGCCTTGAGCACGTACAGAAATTGTTAT
CCTCACTTGATGAACAAACTCGAAGAATCGTCATCGCGCAGAAAATGGTA
AGAGGAAAATTAGCGCGCATCGATTTTGATTTCTTACAAACGTCACGCAA
ACAAGAAGATCGAAACGTCGGCAATTTGTTGGTCTCGATCTCATCACGCA
GCAGCAAGATGCATGACAATCTCTTGATATTGAACGATTACGATTTGAAG
CGACATCAACGTGTTAAAGATAAGGAGATGAAGAAAGAAATTGAGAAGGA
GAACTTCATCCAAAAACGCAAATTGACGAGTGCCACAGATCCTGAATTGA
AACTTCGTGAAAGTCAACAACGACCCGCCCCTGAAAACTCACCAAACAGA
AAGGTTCCACGCAACAAACAACGCACACAAACAGAACCATTGATTCGCAA
CTTCATCTCGGGTCCACAATCAGCATGGTGTATGGTCAAATGCTACGAAC
GCCAATTCCACATTGCATCTTTCCAAATGGAAGAAGCTGTCATTTGTGTT
GACGGCACACACACATTCAGTGATAAAAACCGCATCGCCTTTGCCACCCT
CCCCGTACGGGCGGACGATCCAAAAGTCGCCAAAGTGAAAAGTTGTATCG
GGAAAGGAGTCCAGTTACACCAAGACGAGCGACAAAACTTGTGGGCTACG
CGACTTGGTAAAAACCCTATATTTGTGCGTGGTCATACCTTATGTCCAGA
ACTGGTCAAACTGAACGGCAAACTTACGCAAGGCGTACCCATGAAAGTGT
TAGATACGGCCGCTTTCAAGGATTACATGCGTGAAGAAGTTGAGAAAAAT
GGCGGCGTCACTGAAGACCTCAAAGATCGAATCATGTCTAAACTGAAGAT
TTGCATGAGTTTCATCAAAGATACACACTTAGACGAAGAAACGCCGTGTT
GGTTCGAAATTTGGCTTGTCAAAGTCAAGGAGCATGTTAGACGTTACCTT
GACAACCAACAGAAACGAGAGAAACGAAAATCAGGACATTTAGACATGCG
TATTACACAAACACAAGAATCCGTTAAACGAATTGCAGCCATGCCTGAAA
TGAGGCGCGCTAAAAGCGGTGATCATTTACGTAGACCACGAAGTAATACG
GCAGGCCCGAATCCTGCCGAAACGACGGGAAAACCGGCCCGTTCATCAAG
ACCGCCGTCACAAATAATCGGCGAAAAATCCATCGCACGTCATCGAGGGA
CGACATCAGCAGACACAACGGCGCAATGGCGTGTGGAACAAAAGATTACG
CAAGAAATGTTACAACGTGAACGTAGTATGGACATGATTCGACGTGAGAA
AAGCATGGACGTACGGCTGGAGTCGCGACTTTTAATGGAACGCGAATATC
GAAACAGTATGGGAAAACCTTTAGTTGAATCTCAACACGTGAACAGAGTG
AGGGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCACCGCAATCACTGGC
CCGTAGTACGGGAAGCAGTATGGGATCACGTAAAGACAATTCGACCACAG
CCAACGATTCCCCTCGTATAGTTAACGGTCCACATACGCCCGTTTCACGT
ATGCCCGCCCACTCTCAACAAAATCCTCATGAAGAATTTCGAAGGGGCGG
AAGTGTGGCGGCTGCCCGTGAAGGAATGAGTTATCGACAAGTATTTGGAC
TTCAATCATCAGACTATTTATTTAACGTGACGCCGCCTAATTACACGCGC
CATCGACGTTTCTCAGACTCAGATACTGAATCCCTtcacaatttcaattt
catacaCAAAGTAATCACACAACCTTCAACGCCCACTCACCAATCCACCC
AACAATTAACAAACGCCCAACAAACGCCCTCCCAACAAACAGAAGATCCG
AAGAAATCGAAAGTACTTCAACAACCGAAAAGttggatgaaaaaagtacg
ACGAAAGTCGGAAGATAATCCAAAACGAAAAGTTGTAGCGCAACTTTCTA
ACAAATAAATGGATTTGAACGACTTATGTGACCTTGAAAATCCTGATGAT
GATGTTATTGTTGACGCTATCAAAAAGAGATATGAGTGTGGGTATTTCTA
TACTTGTATTGGAGATATTCTCATCTCAATCAACCCATACAAAGAGTCCA
TCTTGAATTCGCTTGAGGTATCACACAGATATAAAGATGAACCTTCTCTT
ACGCAAACCAACCCACATGTCTTTGGTACCACAAACAATTTATATCATTT
CCTCAATGTCAACAAAGAAAGTCAATGCTTCATCGTCTCTGGTGAATCTG
GTTCTGGAAAAAGTGAAGTCATTCATCAAGCTGTCACACATTTTTTATGT
CTAGTTTCAACGTCTGATAGGAGTTTCAAAGAAAGAATTTTACAGGCAAA
TGTAATTCTGGAAGCTTTTGGAAATGCACGGACAAGTTTAAATTCAAATG
CAACaagattttgcaaatatttaaaGTTCCATTTCGATAGCAAGTTACAT
CTATCCGGAGTATCAATCACAGATTATTTGCTTGAGTTGCCGAGAGTTTC
AAATCAAAGACAGGGAGAAGCAAATTTCAATATCTTTTATTACATGTTTT
CTGGGCGAACCGAAGATGAGCTATCAAAACAATTACTTGATACCCCTACA
CAACACAAATATTTGAAGTATGGTGAGTTTTTTGGGGATGATTTACTTTC
TTGGAGTCAGGCTTATGAAAGTCTTATTGATGCATTTCAAGTTGTCGGCT
TCACACAAGAGactgTCAAAGAGATATTTGGTATTTTGTCAGCCATTTTG
AATATAGGTGATTTGAAGTTCAAATGTGAAGACGAAACAACAGGTGTTTT
TGTGGACAATCTAGAAATACTTGATAAAGtTTCTATTCTACTTGGAGTGg
acacaagcgatttggaactTTGTTTAACCAGTAATTTGTTTGTGAAACCA
gATGATGGTGTTTCTGGCTTCAAAAGTCTGAGTGAAGCTGAACAAACCAG
AGATTTCATGGCCAATTTCATGTATGCAAGATTGTTTAGTTGGATAGTCA
GCAACATTAACACTTTCTTGAACCCTGGCGAACCAAAAAAGAAACAATCT
GAGCATGTGCATGTTggatttcttgatatttttgggTTTGAAGATTTCCA
GAAAAACACACTAGAACAATTGTGTATTAACACCACAAATGAACAGATTA
ATTTGCACTTTATACAACACGTCTTTGCACGGGAACAGgttgatTACCAA
GAAGAAGGGCTTTCAGAATTACAATTAGTGGAATATTTTGATAACAAGAA
TATTGTTAATCTTCTCCTTGAGACACCTCACGGCATCTTTGCATTATTGG
AGGAAGAAAGCAAATGTTTGCAAGCAGATGATCAGACGCTTGTCTCTTCT
TTCAATGCTCATTGTTCAGAATTGAAGTTCTATATTCCGTCCACCGCAAA
CGCATCCACTTTCAGTATCGTACActacaataaaaaaGTAACTTACGCAG
CAGATGACTTCATTTTGAGGAATAATGCAAAACTTGATGGCTGTCTGATT
GAATGTTTAAGAGGTTCAAAGGGACAGTTAACGAGTACTCTATTCAACTC
GTCCTTAACCAAGACAGGAGCACTAATCATCAAgCAAGGACATGGTACAG
TGAATTGTTGCCAAGGGGATCTTCGAGGGGCTTACACCAAACGTATTAAT
CATAGGTTAAAGAAAGAGGGGAAATGCAATACGAGCAAAGCTTGCCACAA
CACGAAGAGCAAGCAACGCACATTCACCGCtagaaaacataaaaataatt
caGTTGCCGTTCAGTTCAGGAACTCGTTAGTGGATTTGATAGAGACCATC
CTGCTATGTCAGGCTCATTTCGTCAGGTGCATAAAGCCGAACAAAGTAAA
AGAAGCAGATAACTTTGACGTGGATTTTGTTAGAGCTCAAATCAAATGCA
ACGGCATCCTGGATTCCGTTCGTATTCGCAAAGACGGTTTTCCTGTTCGG
CTGCCGTTCAAAATCTTTGTGGAGAGaTATCGTTTTGTGAAATTTGATAT
GACGTCACCATTGGAGAACACTGGAGAAATATGTCAACAGATTCTTCAAC
ATTGCAACATTGATGACGGCTACAAGATTGGTGCCACCAGgGTGTTGCTT
CGCCTTGAGCACGTACAGAAATTGTTATCCTCACTTGATGAACAAACTCG
AAGAATCGTCATCGCGCAGAAAATGGTAAGAGGAAAATTAGCGCGCATCG
ATTTTGATTTCTTACAAACGTCACGCAAACAAGAAGATCGAAACGTCGGC
AATTTGTTGGTCTCGATCTCATCACGCAGCAGCAAGATGCATGACAATCT
CTTGATATTGAACGATTACGATTTGAAGCGACATCAACGTGTTAAAGATA
AGGAGATGAAGAAAGAAATTGAGAAGGAGAACTTCATCCAAAAACGCAAA
TTGACGAGTGCCACAGATCCTGAATTGAAACTTCGTGAAAGTCAACAACG
ACCCGCCCCTGAAAACTCACCAAACAGAAAGGTTCCACGCAACAAACAAC
GCACACAAACAGAACCATTGATTCGCAACTTCATCTCGGGTCCACAATCA
GCATGGTGTATGGTCAAATGCTACGAACGCCAATTCCACATTGCATCTTT
CCAAATGGAAGAAGCTGTCATTTGTGTTGACGGCACACACACATTCAGTG
ATAAAAACCGCATCGCCTTTGCCACCCTCCCCGTACGGGCGGACGATCCA
AAAGTCGCCAAAGTGAAAAGTTGTATCGGGAAAGGAGTCCAGTTACACCA
AGACGAGCGACAAAACTTGTGGGCTACGCGACTTGGTAAAAACCCTATAT
TTGTGCGTGGTCATACCTTATGTCCAGAACTGGTCAAACTGAACGGCAAA
CTTACGCAAGGCGTACCCATGAAAGTGTTAGATACGGCCGCTTTCAAGGA
TTACATGCGTGAAGAAGTTGAGAAAAATGGCGGCGTCACTGAAGACCTCA
AAGATCGAATCATGTCTAAACTGAAGATTTGCATGAGTTTCATCAAAGAT
ACACACTTAGACGAAGAAACGCCGTGTTGGTTCGAAATTTGGCTTGTCAA
AGTCAAGGAGCATGTTAGACGTTACCTTGACAACCAACAGAAACGAGAGA
AACGAAAATCAGGACATTTAGACATGCGTATTACACAAACACAAGAATCC
GTTAAACGAATTGCAGCCATGCCTGAAATGAGGCGCGCTAAAAGCGGTGA
TCATTTACGTAGACCACGAAGTAATACGGCAGGCCCGAATCCTGCCGAAA
CGACGGGAAAACCGGCCCGTTCATCAAGACCGCCGTCACAAATAATCGGC
GAAAAATCCATCGCACGTCATCGAGGGACGACATCAGCAGACACAACGGC
GCAATGGCGTGTGGAACAAAAGATTACGCAAGAAATGTTACAACGTGAAC
GTAGTATGGACATGATTCGACGTGAGAAAAGCATGGACGTACGGCTGGAG
TCGCGACTTTTAATGGAACGCGAATATCGAAACAGTATGGGAAAACCTTT
AGTTGAATCTCAACACGTGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCC
CCGGTCAAAGTCCACCGCAATCACTGGCCCGTAGTACGGGAAGCAGTATG
GGATCACGTAAAGACAATTCGACCACAGCCAACGATTCCCCTCGTATAGT
TAACGGTCCACATACGCCCGTTTCACGTATGCCCGCCCACTCTCAACAAA
ATCCTCATGAAGAATTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAA
GGAATGAGTTATCGACAAGTATTTGGACTTCAATCATCAGACTATTTATT
TAACGTGACGCCGCCTAATTACACGCGCCATCGACGTTTCTCAGACTCAG
ATACTGAATCCCTtcacaatttcaatttcatacaCAAAGTAATCACACAA
CCTTCAACGCCCACTCACCAATCCACCCAACAATTAACAAACGCCCAACA
AACGCCCTCCCAACAAACAGAAGATCCGAAGAAATCGAAAGTACTTCAAC
AACCGAAAAGttggatgaaaaaagtacgACGAAAGTCGGAAGATAATCCA
AAACGAAAAGTTGTAGCGCAACTTTCTAACAAATAAATGGATTTGAACGA
CTTATGTGACCTTGAAAATCCTGATGATGATGTTATTGTTGACGCTATCA
AAAAGAGATATGAGTGTGGGTATTTCTATACTTGTATTGGAGATATTCTC
ATCTCAATCAACCCATACAAAGAGTCCATCTTGAATTCGCTTGAGGTATC
ACACAGATATAAAGATGAACCTTCTCTTACGCAAACCAACCCACATGTCT
TTGGTACCACAAACAATTTATATCATTTCCTCAATGTCAACAAAGAAAGT
CAATGCTTCATCGTCTCTGGTGAATCTGGTTCTGGAAAAAGTGAAGTCAT
TCATCAAGCTGTCACACATTTTTTATGTCTAGTTTCAACGTCTGATAGGA
GTTTCAAAGAAAGAATTTTACAGGCAAATGTAATTCTGGAAGCTTTTGGA
AATGCACGGACAAGTTTAAATTCAAATGCAACaagattttgcaaatattt
aaaGTTCCATTTCGATAGCAAGTTACATCTATCCGGAGTATCAATCACAG
ATTATTTGCTTGAGTTGCCGAGAGTTTCAAATCAAAGACAGGGAGAAGCA
AATTTCAATATCTTTTATTACATGTTTTCTGGGCGAACCGAAGATGAGCT
ATCAAAACAATTACTTGATACCCCTACACAACACAAATATTTGAAGTATG
GTGAGTTTTTTGGGGATGATTTACTTTCTTGGAGTCAGGCTTATGAAAGT
CTTATTGATGCATTTCAAGTTGTCGGCTTCACACAAGAGactgTCAAAGA
GATATTTGGTATTTTGTCAGCCATTTTGAATATAGGTGATTTGAAGTTCA
AATGTGAAGACGAAACAACAGGTGTTTTTGTGGACAATCTAGAAATACTT
GATAAAGtTTCTATTCTACTTGGAGTGgacacaagcgatttggaactTTG
TTTAACCAGTAATTTGTTTGTGAAACCAgATGATGGTGTTTCTGGCTTCA
AAAGTCTGAGTGAAGCTGAACAAACCAGAGATTTCATGGCCAATTTCATG
TATGCAAGATTGTTTAGTTGGATAGTCAGCAACATTAACACTTTCTTGAA
CCCTGGCGAACCAAAAAAGAAACAATCTGAGCATGTGCATGTTggatttc
ttgatatttttgggTTTGAAGATTTCCAGAAAAACACACTAGAACAATTG
TGTATTAACACCACAAATGAACAGATTAATTTGCACTTTATACAACACGT
CTTTGCACGGGAACAGgttgatTACCAAGAAGAAGGGCTTTCAGAATTAC
AATTAGTGGAATATTTTGATAACAAGAATATTGTTAATCTTCTCCTTGAG
ACACCTCACGGCATCTTTGCATTATTGGAGGAAGAAAGCAAATGTTTGCA
AGCAGATGATCAGACGCTTGTCTCTTCTTTCAATGCTCATTGTTCAGAAT
TGAAGTTCTATATTCCGTCCACCGCAAACGCATCCACTTTCAGTATCGTA
CActacaataaaaaaGTAACTTACGCAGCAGATGACTTCATTTTGAGGAA
TAATGCAAAACTTGATGGCTGTCTGATTGAATGTTTAAGAGGTTCAAAGG
GACAGTTAACGAGTACTCTATTCAACTCGTCCTTAACCAAGACAGGAGCA
CTAATCATCAAgCAAGGACATGGTACAGTGAATTGTTGCCAAGGGGATCT
TCGAGGGGCTTACACCAAACGTATTAATCATAGGTTAAAGAAAGAGGGGA
AATGCAATACGAGCAAAGCTTGCCACAACACGAAGAGCAAGCAACGCACA
TTCACCGCtagaaaacataaaaataattcaGTTGCCGTTCAGTTCAGGAA
CTCGTTAGTGGATTTGATAGAGACCATCCTGCTATGTCAGGCTCATTTCG
TCAGGTGCATAAAGCCGAACAAAGTAAAAGAAGCAGATAACTTTGACGTG
GATTTTGTTAGAGCTCAAATCAAATGCAACGGCATCCTGGATTCCGTTCG
TATTCGCAAAGACGGTTTTCCTGTTCGGCTGCCGTTCAAAATCTTTGTGG
AGAGaTATCGTTTTGTGAAATTTGATATGACGTCACCATTGGAGAACACT
GGAGAAATATGTCAACAGATTCTTCAACATTGCAACATTGATGACGGCTA
CAAGATTGGTGCCACCAGgGTGTTGCTTCGCCTTGAGCACGTACAGAAAT
TGTTATCCTCACTTGATGAACAAACTCGAAGAATCGTCATCGCGCAGAAA
ATGGTAAGAGGAAAATTAGCGCGCATCGATTTTGATTTCTTACAAACGTC
ACGCAAACAAGAAGATCGAAACGTCGGCAATTTGTTGGTCTCGATCTCAT
CACGCAGCAGCAAGATGCATGACAATCTCTTGATATTGAACGATTACGAT
TTGAAGCGACATCAACGTGTTAAAGATAAGGAGATGAAGAAAGAAATTGA
GAAGGAGAACTTCATCCAAAAACGCAAATTGACGAGTGCCACAGATCCTG
AATTGAAACTTCGTGAAAGTCAACAACGACCCGCCCCTGAAAACTCACCA
AACAGAAAGGTTCCACGCAACAAACAACGCACACAAACAGAACCATTGAT
TCGCAACTTCATCTCGGGTCCACAATCAGCATGGTGTATGGTCAAATGCT
ACGAACGCCAATTCCACATTGCATCTTTCCAAATGGAAGAAGCTGTCATT
TGTGTTGACGGCACACACACATTCAGTGATAAAAACCGCATCGCCTTTGC
CACCCTCCCCGTACGGGCGGACGATCCAAAAGTCGCCAAAGTGAAAAGTT
GTATCGGGAAAGGAGTCCAGTTACACCAAGACGAGCGACAAAACTTGTGG
GCTACGCGACTTGGTAAAAACCCTATATTTGTGCGTGGTCATACCTTATG
TCCAGAACTGGTCAAACTGAACGGCAAACTTACGCAAGGCGTACCCATGA
AAGTGTTAGATACGGCCGCTTTCAAGGATTACATGCGTGAAGAAGTTGAG
AAAAATGGCGGCGTCACTGAAGACCTCAAAGATCGAATCATGTCTAAACT
GAAGATTTGCATGAGTTTCATCAAAGATACACACTTAGACGAAGAAACGC
CGTGTTGGTTCGAAATTTGGCTTGTCAAAGTCAAGGAGCATGTTAGACGT
TACCTTGACAACCAACAGAAACGAGAGAAACGAAAATCAGGACATTTAGA
CATGCGTATTACACAAACACAAGAATCCGTTAAACGAATTGCAGCCATGC
CTGAAATGAGGCGCGCTAAAAGCGGTGATCATTTACGTAGACCACGAAGT
AATACGGCAGGCCCGAATCCTGCCGAAACGACGGGAAAACCGGCCCGTTC
ATCAAGACCGCCGTCACAAATAATCGGCGAAAAATCCATCGCACGTCATC
GAGGGACGACATCAGCAGACACAACGGCGCAATGGCGTGTGGAACAAAAG
ATTACGCAAGAAATGTTACAACGTGAACGTAGTATGGACATGATTCGACG
TGAGAAAAGCATGGACGTACGGCTGGAGTCGCGACTTTTAATGGAACGCG
AATATCGAAACAGTATGGGAAAACCTTTAGTTGAATCTCAACACGTGAAC
AGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCACCGCAATC
ACTGGCCCGTAGTACGGGAAGCAGTATGGGATCACGTAAAGACAATTCGA
CCACAGCCAACGATTCCCCTCGTATAGTTAACGGTCCACATACGCCCGTT
TCACGTATGCCCGCCCACTCTCAACAAAATCCTCATGAAGAATTTCGAAG
GGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAATGAGTTATCGACAAGTAT
TTGGACTTCAATCATCAGACTATTTATTTAACGTGACGCCGCCTAATTAC
ACGCGCCATCGACGTTTCTCAGACTCAGATACTGAATCCCTtcacaattt
caatttcatacaCAAAGTAATCACACAACCTTCAACGCCCACTCACCAAT
CCACCCAACAATTAACAAACGCCCAACAAACGCCCTCCCAACAAACAGAA
GATCCGAAGAAATCGAAAGTACTTCAACAACCGAAAAGttggatgaaaaa
agtacgACGAAAGTCGGAAGATAATCCAAAACGAAAAGTTGTAGCGCAAC
TTTCTAACAAATAAATGGATTTGAACGACTTATGTGACCTTGAAAATCCT
GATGATGATGTTATTGTTGACGCTATCAAAAAGAGATATGAGTGTGGGTA
TTTCTATACTTGTATTGGAGATATTCTCATCTCAATCAACCCATACAAAG
AGTCCATCTTGAATTCGCTTGAGGTATCACACAGATATAAAGATGAACCT
TCTCTTACGCAAACCAACCCACATGTCTTTGGTACCACAAACAATTTATA
TCATTTCCTCAATGTCAACAAAGAAAGTCAATGCTTCATCGTCTCTGGTG
AATCTGGTTCTGGAAAAAGTGAAGTCATTCATCAAGCTGTCACACATTTT
TTATGTCTAGTTTCAACGTCTGATAGGAGTTTCAAAGAAAGAATTTTACA
GGCAAATGTAATTCTGGAAGCTTTTGGAAATGCACGGACAAGTTTAAATT
CAAATGCAACaagattttgcaaatatttaaaGTTCCATTTCGATAGCAAG
TTACATCTATCCGGAGTATCAATCACAGATTATTTGCTTGAGTTGCCGAG
AGTTTCAAATCAAAGACAGGGAGAAGCAAATTTCAATATCTTTTATTACA
TGTTTTCTGGGCGAACCGAAGATGAGCTATCAAAACAATTACTTGATACC
CCTACACAACACAAATATTTGAAGTATGGTGAGTTTTTTGGGGATGATTT
ACTTTCTTGGAGTCAGGCTTATGAAAGTCTTATTGATGCATTTCAAGTTG
TCGGCTTCACACAAGAGactgTCAAAGAGATATTTGGTATTTTGTCAGCC
ATTTTGAATATAGGTGATTTGAAGTTCAAATGTGAAGACGAAACAACAGG
TGTTTTTGTGGACAATCTAGAAATACTTGATAAAGtTTCTATTCTACTTG
GAGTGgacacaagcgatttggaactTTGTTTAACCAGTAATTTGTTTGTG
AAACCAgATGATGGTGTTTCTGGCTTCAAAAGTCTGAGTGAAGCTGAACA
AACCAGAGATTTCATGGCCAATTTCATGTATGCAAGATTGTTTAGTTGGA
TAGTCAGCAACATTAACACTTTCTTGAACCCTGGCGAACCAAAAAAGAAA
CAATCTGAGCATGTGCATGTTggatttcttgatatttttgggTTTGAAGA
TTTCCAGAAAAACACACTAGAACAATTGTGTATTAACACCACAAATGAAC
AGATTAATTTGCACTTTATACAACACGTCTTTGCACGGGAACAGgttgat
TACCAAGAAGAAGGGCTTTCAGAATTACAATTAGTGGAATATTTTGATAA
CAAGAATATTGTTAATCTTCTCCTTGAGACACCTCACGGCATCTTTGCAT
TATTGGAGGAAGAAAGCAAATGTTTGCAAGCAGATGATCAGACGCTTGTC
TCTTCTTTCAATGCTCATTGTTCAGAATTGAAGTTCTATATTCCGTCCAC
CGCAAACGCATCCACTTTCAGTATCGTACActacaataaaaaaGTAACTT
ACGCAGCAGATGACTTCATTTTGAGGAATAATGCAAAACTTGATGGCTGT
CTGATTGAATGTTTAAGAGGTTCAAAGGGACAGTTAACGAGTACTCTATT
CAACTCGTCCTTAACCAAGACAGGAGCACTAATCATCAAgCAAGGACATG
GTACAGTGAATTGTTGCCAAGGGGATCTTCGAGGGGCTTACACCAAACGT
ATTAATCATAGGTTAAAGAAAGAGGGGAAATGCAATACGAGCAAAGCTTG
CCACAACACGAAGAGCAAGCAACGCACATTCACCGCtagaaaacataaaa
ataattcaGTTGCCGTTCAGTTCAGGAACTCGTTAGTGGATTTGATAGAG
ACCATCCTGCTATGTCAGGCTCATTTCGTCAGGTGCATAAAGCCGAACAA
AGTAAAAGAAGCAGATAACTTTGACGTGGATTTTGTTAGAGCTCAAATCA
AATGCAACGGCATCCTGGATTCCGTTCGTATTCGCAAAGACGGTTTTCCT
GTTCGGCTGCCGTTCAAAATCTTTGTGGAGAGaTATCGTTTTGTGAAATT
TGATATGACGTCACCATTGGAGAACACTGGAGAAATATGTCAACAGATTC
TTCAACATTGCAACATTGATGACGGCTACAAGATTGGTGCCACCAGgGTG
TTGCTTCGCCTTGAGCACGTACAGAAATTGTTATCCTCACTTGATGAACA
AACTCGAAGAATCGTCATCGCGCAGAAAATGGTAAGAGGAAAATTAGCGC
GCATCGATTTTGATTTCTTACAAACGTCACGCAAACAAGAAGATCGAAAC
GTCGGCAATTTGTTGGTCTCGATCTCATCACGCAGCAGCAAGATGCATGA
CAATCTCTTGATATTGAACGATTACGATTTGAAGCGACATCAACGTGTTA
AAGATAAGGAGATGAAGAAAGAAATTGAGAAGGAGAACTTCATCCAAAAA
CGCAAATTGACGAGTGCCACAGATCCTGAATTGAAACTTCGTGAAAGTCA
ACAACGACCCGCCCCTGAAAACTCACCAAACAGAAAGGTTCCACGCAACA
AACAACGCACACAAACAGAACCATTGATTCGCAACTTCATCTCGGGTCCA
CAATCAGCATGGTGTATGGTCAAATGCTACGAACGCCAATTCCACATTGC
ATCTTTCCAAATGGAAGAAGCTGTCATTTGTGTTGACGGCACACACACAT
TCAGTGATAAAAACCGCATCGCCTTTGCCACCCTCCCCGTACGGGCGGAC
GATCCAAAAGTCGCCAAAGTGAAAAGTTGTATCGGGAAAGGAGTCCAGTT
ACACCAAGACGAGCGACAAAACTTGTGGGCTACGCGACTTGGTAAAAACC
CTATATTTGTGCGTGGTCATACCTTATGTCCAGAACTGGTCAAACTGAAC
GGCAAACTTACGCAAGGCGTACCCATGAAAGTGTTAGATACGGCCGCTTT
CAAGGATTACATGCGTGAAGAAGTTGAGAAAAATGGCGGCGTCACTGAAG
ACCTCAAAGATCGAATCATGTCTAAACTGAAGATTTGCATGAGTTTCATC
AAAGATACACACTTAGACGAAGAAACGCCGTGTTGGTTCGAAATTTGGCT
TGTCAAAGTCAAGGAGCATGTTAGACGTTACCTTGACAACCAACAGAAAC
GAGAGAAACGAAAATCAGGACATTTAGACATGCGTATTACACAAACACAA
GAATCCGTTAAACGAATTGCAGCCATGCCTGAAATGAGGCGCGCTAAAAG
CGGTGATCATTTACGTAGACCACGAAGTAATACGGCAGGCCCGAATCCTG
CCGAAACGACGGGAAAACCGGCCCGTTCATCAAGACCGCCGTCACAAATA
ATCGGCGAAAAATCCATCGCACGTCATCGAGGGACGACATCAGCAGACAC
AACGGCGCAATGGCGTGTGGAACAAAAGATTACGCAAGAAATGTTACAAC
GTGAACGTAGTATGGACATGATTCGACGTGAGAAAAGCATGGACGTACGG
CTGGAGTCGCGACTTTTAATGGAACGCGAATATCGAAACAGTATGGGAAA
ACCTTTAGTTGAATCTCAACACGTGAACAGAGTGAGGGGTAGCGAGAAAA
GTAGCCCCGGTCAAAGTCCACCGCAATCACTGGCCCGTAGTACGGGAAGC
AGTATGGGATCACGTAAAGACAATTCGACCACAGCCAACGATTCCCCTCG
TATAGTTAACGGTCCACATACGCCCGTTTCACGTATGCCCGCCCACTCTC
AACAAAATCCTCATGAAGAATTTCGAAGGGGCGGAAGTGTGGCGGCTGCC
CGTGAAGGAATGAGTTATCGACAAGTATTTGGACTTCAATCATCAGACTA
TTTATTTAACGTGACGCCGCCTAATTACACGCGCCATCGACGTTTCTCAG
ACTCAGATACTGAATCCCTtcacaatttcaatttcatacaCAAAGTAATC
ACACAACCTTCAACGCCCACTCACCAATCCACCCAACAATTAACAAACGC
CCAACAAACGCCCTCCCAACAAACAGAAGATCCGAAGAAATCGAAAGTAC
TTCAACAACCGAAAAGttggatgaaaaaagtacgACGAAAGTCGGAAGAT
AATCCAAAACGAAAAGTTGTAGCGCAACTTTCTAACAAATAAATGGATTT
GAACGACTTATGTGACCTTGAAAATCCTGATGATGATGTTATTGTTGACG
CTATCAAAAAGAGATATGAGTGTGGGTATTTCTATACTTGTATTGGAGAT
ATTCTCATCTCAATCAACCCATACAAAGAGTCCATCTTGAATTCGCTTGA
GGTATCACACAGATATAAAGATGAACCTTCTCTTACGCAAACCAACCCAC
ATGTCTTTGGTACCACAAACAATTTATATCATTTCCTCAATGTCAACAAA
GAAAGTCAATGCTTCATCGTCTCTGGTGAATCTGGTTCTGGAAAAAGTGA
AGTCATTCATCAAGCTGTCACACATTTTTTATGTCTAGTTTCAACGTCTG
ATAGGAGTTTCAAAGAAAGAATTTTACAGGCAAATGTAATTCTGGAAGCT
TTTGGAAATGCACGGACAAGTTTAAATTCAAATGCAACaagattttgcaa
atatttaaaGTTCCATTTCGATAGCAAGTTACATCTATCCGGAGTATCAA
TCACAGATTATTTGCTTGAGTTGCCGAGAGTTTCAAATCAAAGACAGGGA
GAAGCAAATTTCAATATCTTTTATTACATGTTTTCTGGGCGAACCGAAGA
TGAGCTATCAAAACAATTACTTGATACCCCTACACAACACAAATATTTGA
AGTATGGTGAGTTTTTTGGGGATGATTTACTTTCTTGGAGTCAGGCTTAT
GAAAGTCTTATTGATGCATTTCAAGTTGTCGGCTTCACACAAGAGactgT
CAAAGAGATATTTGGTATTTTGTCAGCCATTTTGAATATAGGTGATTTGA
AGTTCAAATGTGAAGACGAAACAACAGGTGTTTTTGTGGACAATCTAGAA
ATACTTGATAAAGtTTCTATTCTACTTGGAGTGgacacaagcgatttgga
actTTGTTTAACCAGTAATTTGTTTGTGAAACCAgATGATGGTGTTTCTG
GCTTCAAAAGTCTGAGTGAAGCTGAACAAACCAGAGATTTCATGGCCAAT
TTCATGTATGCAAGATTGTTTAGTTGGATAGTCAGCAACATTAACACTTT
CTTGAACCCTGGCGAACCAAAAAAGAAACAATCTGAGCATGTGCATGTTg
gatttcttgatatttttgggTTTGAAGATTTCCAGAAAAACACACTAGAA
CAATTGTGTATTAACACCACAAATGAACAGATTAATTTGCACTTTATACA
ACACGTCTTTGCACGGGAACAGgttgatTACCAAGAAGAAGGGCTTTCAG
AATTACAATTAGTGGAATATTTTGATAACAAGAATATTGTTAATCTTCTC
CTTGAGACACCTCACGGCATCTTTGCATTATTGGAGGAAGAAAGCAAATG
TTTGCAAGCAGATGATCAGACGCTTGTCTCTTCTTTCAATGCTCATTGTT
CAGAATTGAAGTTCTATATTCCGTCCACCGCAAACGCATCCACTTTCAGT
ATCGTACActacaataaaaaaGTAACTTACGCAGCAGATGACTTCATTTT
GAGGAATAATGCAAAACTTGATGGCTGTCTGATTGAATGTTTAAGAGGTT
CAAAGGGACAGTTAACGAGTACTCTATTCAACTCGTCCTTAACCAAGACA
GGAGCACTAATCATCAAgCAAGGACATGGTACAGTGAATTGTTGCCAAGG
GGATCTTCGAGGGGCTTACACCAAACGTATTAATCATAGGTTAAAGAAAG
AGGGGAAATGCAATACGAGCAAAGCTTGCCACAACACGAAGAGCAAGCAA
CGCACATTCACCGCtagaaaacataaaaataattcaGTTGCCGTTCAGTT
CAGGAACTCGTTAGTGGATTTGATAGAGACCATCCTGCTATGTCAGGCTC
ATTTCGTCAGGTGCATAAAGCCGAACAAAGTAAAAGAAGCAGATAACTTT
GACGTGGATTTTGTTAGAGCTCAAATCAAATGCAACGGCATCCTGGATTC
CGTTCGTATTCGCAAAGACGGTTTTCCTGTTCGGCTGCCGTTCAAAATCT
TTGTGGAGAGaTATCGTTTTGTGAAATTTGATATGACGTCACCATTGGAG
AACACTGGAGAAATATGTCAACAGATTCTTCAACATTGCAACATTGATGA
CGGCTACAAGATTGGTGCCACCAGgGTGTTGCTTCGCCTTGAGCACGTAC
AGAAATTGTTATCCTCACTTGATGAACAAACTCGAAGAATCGTCATCGCG
CAGAAAATGGTAAGAGGAAAATTAGCGCGCATCGATTTTGATTTCTTACA
AACGTCACGCAAACAAGAAGATCGAAACGTCGGCAATTTGTTGGTCTCGA
TCTCATCACGCAGCAGCAAGATGCATGACAATCTCTTGATATTGAACGAT
TACGATTTGAAGCGACATCAACGTGTTAAAGATAAGGAGATGAAGAAAGA
AATTGAGAAGGAGAACTTCATCCAAAAACGCAAATTGACGAGTGCCACAG
ATCCTGAATTGAAACTTCGTGAAAGTCAACAACGACCCGCCCCTGAAAAC
TCACCAAACAGAAAGGTTCCACGCAACAAACAACGCACACAAACAGAACC
ATTGATTCGCAACTTCATCTCGGGTCCACAATCAGCATGGTGTATGGTCA
AATGCTACGAACGCCAATTCCACATTGCATCTTTCCAAATGGAAGAAGCT
GTCATTTGTGTTGACGGCACACACACATTCAGTGATAAAAACCGCATCGC
CTTTGCCACCCTCCCCGTACGGGCGGACGATCCAAAAGTCGCCAAAGTGA
AAAGTTGTATCGGGAAAGGAGTCCAGTTACACCAAGACGAGCGACAAAAC
TTGTGGGCTACGCGACTTGGTAAAAACCCTATATTTGTGCGTGGTCATAC
CTTATGTCCAGAACTGGTCAAACTGAACGGCAAACTTACGCAAGGCGTAC
CCATGAAAGTGTTAGATACGGCCGCTTTCAAGGATTACATGCGTGAAGAA
GTTGAGAAAAATGGCGGCGTCACTGAAGACCTCAAAGATCGAATCATGTC
TAAACTGAAGATTTGCATGAGTTTCATCAAAGATACACACTTAGACGAAG
AAACGCCGTGTTGGTTCGAAATTTGGCTTGTCAAAGTCAAGGAGCATGTT
AGACGTTACCTTGACAACCAACAGAAACGAGAGAAACGAAAATCAGGACA
TTTAGACATGCGTATTACACAAACACAAGAATCCGTTAAACGAATTGCAG
CCATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATCATTTACGTAGACCA
CGAAGTAATACGGCAGGCCCGAATCCTGCCGAAACGACGGGAAAACCGGC
CCGTTCATCAAGACCGCCGTCACAAATAATCGGCGAAAAATCCATCGCAC
GTCATCGAGGGACGACATCAGCAGACACAACGGCGCAATGGCGTGTGGAA
CAAAAGATTACGCAAGAAATGTTACAACGTGAACGTAGTATGGACATGAT
TCGACGTGAGAAAAGCATGGACGTACGGCTGGAGTCGCGACTTTTAATGG
AACGCGAATATCGAAACAGTATGGGAAAACCTTTAGTTGAATCTCAACAC
GTGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCACC
GCAATCACTGGCCCGTAGTACGGGAAGCAGTATGGGATCACGTAAAGACA
ATTCGACCACAGCCAACGATTCCCCTCGTATAGTTAACGGTCCACATACG
CCCGTTTCACGTATGCCCGCCCACTCTCAACAAAATCCTCATGAAGAATT
TCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAATGAGTTATCGAC
AAGTATTTGGACTTCAATCATCAGACTATTTATTTAACGTGACGCCGCCT
AATTACACGCGCCATCGACGTTTCTCAGACTCAGATACTGAATCCCTtca
caatttcaatttcatacaCAAAGTAATCACACAACCTTCAACGCCCACTC
ACCAATCCACCCAACAATTAACAAACGCCCAACAAACGCCCTCCCAACAA
ACAGAAGATCCGAAGAAATCGAAAGTACTTCAACAACCGAAAAGttggat
gaaaaaagtacgACGAAAGTCGGAAGATAATCCAAAACGAAAAGTTGTAG
CGCAACTTTCTAACAAATAAATGGATTTGAACGACTTATGTGACCTTGAA
AATCCTGATGATGATGTTATTGTTGACGCTATCAAAAAGAGATATGAGTG
TGGGTATTTCTATACTTGTATTGGAGATATTCTCATCTCAATCAACCCAT
ACAAAGAGTCCATCTTGAATTCGCTTGAGGTATCACACAGATATAAAGAT
GAACCTTCTCTTACGCAAACCAACCCACATGTCTTTGGTACCACAAACAA
TTTATATCATTTCCTCAATGTCAACAAAGAAAGTCAATGCTTCATCGTCT
CTGGTGAATCTGGTTCTGGAAAAAGTGAAGTCATTCATCAAGCTGTCACA
CATTTTTTATGTCTAGTTTCAACGTCTGATAGGAGTTTCAAAGAAAGAAT
TTTACAGGCAAATGTAATTCTGGAAGCTTTTGGAAATGCACGGACAAGTT
TAAATTCAAATGCAACaagattttgcaaatatttaaaGTTCCATTTCGAT
AGCAAGTTACATCTATCCGGAGTATCAATCACAGATTATTTGCTTGAGTT
GCCGAGAGTTTCAAATCAAAGACAGGGAGAAGCAAATTTCAATATCTTTT
ATTACATGTTTTCTGGGCGAACCGAAGATGAGCTATCAAAACAATTACTT
GATACCCCTACACAACACAAATATTTGAAGTATGGTGAGTTTTTTGGGGA
TGATTTACTTTCTTGGAGTCAGGCTTATGAAAGTCTTATTGATGCATTTC
AAGTTGTCGGCTTCACACAAGAGactgTCAAAGAGATATTTGGTATTTTG
TCAGCCATTTTGAATATAGGTGATTTGAAGTTCAAATGTGAAGACGAAAC
AACAGGTGTTTTTGTGGACAATCTAGAAATACTTGATAAAGtTTCTATTC
TACTTGGAGTGgacacaagcgatttggaactTTGTTTAACCAGTAATTTG
TTTGTGAAACCAgATGATGGTGTTTCTGGCTTCAAAAGTCTGAGTGAAGC
TGAACAAACCAGAGATTTCATGGCCAATTTCATGTATGCAAGATTGTTTA
GTTGGATAGTCAGCAACATTAACACTTTCTTGAACCCTGGCGAACCAAAA
AAGAAACAATCTGAGCATGTGCATGTTggatttcttgatatttttgggTT
TGAAGATTTCCAGAAAAACACACTAGAACAATTGTGTATTAACACCACAA
ATGAACAGATTAATTTGCACTTTATACAACACGTCTTTGCACGGGAACAG
gttgatTACCAAGAAGAAGGGCTTTCAGAATTACAATTAGTGGAATATTT
TGATAACAAGAATATTGTTAATCTTCTCCTTGAGACACCTCACGGCATCT
TTGCATTATTGGAGGAAGAAAGCAAATGTTTGCAAGCAGATGATCAGACG
CTTGTCTCTTCTTTCAATGCTCATTGTTCAGAATTGAAGTTCTATATTCC
GTCCACCGCAAACGCATCCACTTTCAGTATCGTACActacaataaaaaaG
TAACTTACGCAGCAGATGACTTCATTTTGAGGAATAATGCAAAACTTGAT
GGCTGTCTGATTGAATGTTTAAGAGGTTCAAAGGGACAGTTAACGAGTAC
TCTATTCAACTCGTCCTTAACCAAGACAGGAGCACTAATCATCAAgCAAG
GACATGGTACAGTGAATTGTTGCCAAGGGGATCTTCGAGGGGCTTACACC
AAACGTATTAATCATAGGTTAAAGAAAGAGGGGAAATGCAATACGAGCAA
AGCTTGCCACAACACGAAGAGCAAGCAACGCACATTCACCGCtagaaaac
ataaaaataattcaGTTGCCGTTCAGTTCAGGAACTCGTTAGTGGATTTG
ATAGAGACCATCCTGCTATGTCAGGCTCATTTCGTCAGGTGCATAAAGCC
GAACAAAGTAAAAGAAGCAGATAACTTTGACGTGGATTTTGTTAGAGCTC
AAATCAAATGCAACGGCATCCTGGATTCCGTTCGTATTCGCAAAGACGGT
TTTCCTGTTCGGCTGCCGTTCAAAATCTTTGTGGAGAGaTATCGTTTTGT
GAAATTTGATATGACGTCACCATTGGAGAACACTGGAGAAATATGTCAAC
AGATTCTTCAACATTGCAACATTGATGACGGCTACAAGATTGGTGCCACC
AGgGTGTTGCTTCGCCTTGAGCACGTACAGAAATTGTTATCCTCACTTGA
TGAACAAACTCGAAGAATCGTCATCGCGCAGAAAATGGTAAGAGGAAAAT
TAGCGCGCATCGATTTTGATTTCTTACAAACGTCACGCAAACAAGAAGAT
CGAAACGTCGGCAATTTGTTGGTCTCGATCTCATCACGCAGCAGCAAGAT
GCATGACAATCTCTTGATATTGAACGATTACGATTTGAAGCGACATCAAC
GTGTTAAAGATAAGGAGATGAAGAAAGAAATTGAGAAGGAGAACTTCATC
CAAAAACGCAAATTGACGAGTGCCACAGATCCTGAATTGAAACTTCGTGA
AAGTCAACAACGACCCGCCCCTGAAAACTCACCAAACAGAAAGGTTCCAC
GCAACAAACAACGCACACAAACAGAACCATTGATTCGCAACTTCATCTCG
GGTCCACAATCAGCATGGTGTATGGTCAAATGCTACGAACGCCAATTCCA
CATTGCATCTTTCCAAATGGAAGAAGCTGTCATTTGTGTTGACGGCACAC
ACACATTCAGTGATAAAAACCGCATCGCCTTTGCCACCCTCCCCGTACGG
GCGGACGATCCAAAAGTCGCCAAAGTGAAAAGTTGTATCGGGAAAGGAGT
CCAGTTACACCAAGACGAGCGACAAAACTTGTGGGCTACGCGACTTGGTA
AAAACCCTATATTTGTGCGTGGTCATACCTTATGTCCAGAACTGGTCAAA
CTGAACGGCAAACTTACGCAAGGCGTACCCATGAAAGTGTTAGATACGGC
CGCTTTCAAGGATTACATGCGTGAAGAAGTTGAGAAAAATGGCGGCGTCA
CTGAAGACCTCAAAGATCGAATCATGTCTAAACTGAAGATTTGCATGAGT
TTCATCAAAGATACACACTTAGACGAAGAAACGCCGTGTTGGTTCGAAAT
TTGGCTTGTCAAAGTCAAGGAGCATGTTAGACGTTACCTTGACAACCAAC
AGAAACGAGAGAAACGAAAATCAGGACATTTAGACATGCGTATTACACAA
ACACAAGAATCCGTTAAACGAATTGCAGCCATGCCTGAAATGAGGCGCGC
TAAAAGCGGTGATCATTTACGTAGACCACGAAGTAATACGGCAGGCCCGA
ATCCTGCCGAAACGACGGGAAAACCGGCCCGTTCATCAAGACCGCCGTCA
CAAATAATCGGCGAAAAATCCATCGCACGTCATCGAGGGACGACATCAGC
AGACACAACGGCGCAATGGCGTGTGGAACAAAAGATTACGCAAGAAATGT
TACAACGTGAACGTAGTATGGACATGATTCGACGTGAGAAAAGCATGGAC
GTACGGCTGGAGTCGCGACTTTTAATGGAACGCGAATATCGAAACAGTAT
GGGAAAACCTTTAGTTGAATCTCAACACGTGAACAGAGTGAGGGGTAGCG
AGAAAAGTAGCCCCGGTCAAAGTCCACCGCAATCACTGGCCCGTAGTACG
GGAAGCAGTATGGGATCACGTAAAGACAATTCGACCACAGCCAACGATTC
CCCTCGTATAGTTAACGGTCCACATACGCCCGTTTCACGTATGCCCGCCC
ACTCTCAACAAAATCCTCATGAAGAATTTCGAAGGGGCGGAAGTGTGGCG
GCTGCCCGTGAAGGAATGAGTTATCGACAAGTATTTGGACTTCAATCATC
AGACTATTTATTTAACGTGACGCCGCCTAATTACACGCGCCATCGACGTT
TCTCAGACTCAGATACTGAATCCCTtcacaatttcaatttcatacaCAAA
GTAATCACACAACCTTCAACGCCCACTCACCAATCCACCCAACAATTAAC
AAACGCCCAACAAACGCCCTCCCAACAAACAGAAGATCCGAAGAAATCGA
AAGTACTTCAACAACCGAAAAGttggatgaaaaaagtacgACGAAAGTCG
GAAGATAATCCAAAACGAAAAGTTGTAGCGCAACTTTCTAACAAATAAAT
GGATTTGAACGACTTATGTGACCTTGAAAATCCTGATGATGATGTTATTG
TTGACGCTATCAAAAAGAGATATGAGTGTGGGTATTTCTATACTTGTATT
GGAGATATTCTCATCTCAATCAACCCATACAAAGAGTCCATCTTGAATTC
GCTTGAGGTATCACACAGATATAAAGATGAACCTTCTCTTACGCAAACCA
ACCCACATGTCTTTGGTACCACAAACAATTTATATCATTTCCTCAATGTC
AACAAAGAAAGTCAATGCTTCATCGTCTCTGGTGAATCTGGTTCTGGAAA
AAGTGAAGTCATTCATCAAGCTGTCACACATTTTTTATGTCTAGTTTCAA
CGTCTGATAGGAGTTTCAAAGAAAGAATTTTACAGGCAAATGTAATTCTG
GAAGCTTTTGGAAATGCACGGACAAGTTTAAATTCAAATGCAACaagatt
ttgcaaatatttaaaGTTCCATTTCGATAGCAAGTTACATCTATCCGGAG
TATCAATCACAGATTATTTGCTTGAGTTGCCGAGAGTTTCAAATCAAAGA
CAGGGAGAAGCAAATTTCAATATCTTTTATTACATGTTTTCTGGGCGAAC
CGAAGATGAGCTATCAAAACAATTACTTGATACCCCTACACAACACAAAT
ATTTGAAGTATGGTGAGTTTTTTGGGGATGATTTACTTTCTTGGAGTCAG
GCTTATGAAAGTCTTATTGATGCATTTCAAGTTGTCGGCTTCACACAAGA
GactgTCAAAGAGATATTTGGTATTTTGTCAGCCATTTTGAATATAGGTG
ATTTGAAGTTCAAATGTGAAGACGAAACAACAGGTGTTTTTGTGGACAAT
CTAGAAATACTTGATAAAGtTTCTATTCTACTTGGAGTGgacacaagcga
tttggaactTTGTTTAACCAGTAATTTGTTTGTGAAACCAgATGATGGTG
TTTCTGGCTTCAAAAGTCTGAGTGAAGCTGAACAAACCAGAGATTTCATG
GCCAATTTCATGTATGCAAGATTGTTTAGTTGGATAGTCAGCAACATTAA
CACTTTCTTGAACCCTGGCGAACCAAAAAAGAAACAATCTGAGCATGTGC
ATGTTggatttcttgatatttttgggTTTGAAGATTTCCAGAAAAACACA
CTAGAACAATTGTGTATTAACACCACAAATGAACAGATTAATTTGCACTT
TATACAACACGTCTTTGCACGGGAACAGgttgatTACCAAGAAGAAGGGC
TTTCAGAATTACAATTAGTGGAATATTTTGATAACAAGAATATTGTTAAT
CTTCTCCTTGAGACACCTCACGGCATCTTTGCATTATTGGAGGAAGAAAG
CAAATGTTTGCAAGCAGATGATCAGACGCTTGTCTCTTCTTTCAATGCTC
ATTGTTCAGAATTGAAGTTCTATATTCCGTCCACCGCAAACGCATCCACT
TTCAGTATCGTACActacaataaaaaaGTAACTTACGCAGCAGATGACTT
CATTTTGAGGAATAATGCAAAACTTGATGGCTGTCTGATTGAATGTTTAA
GAGGTTCAAAGGGACAGTTAACGAGTACTCTATTCAACTCGTCCTTAACC
AAGACAGGAGCACTAATCATCAAgCAAGGACATGGTACAGTGAATTGTTG
CCAAGGGGATCTTCGAGGGGCTTACACCAAACGTATTAATCATAGGTTAA
AGAAAGAGGGGAAATGCAATACGAGCAAAGCTTGCCACAACACGAAGAGC
AAGCAACGCACATTCACCGCtagaaaacataaaaataattcaGTTGCCGT
TCAGTTCAGGAACTCGTTAGTGGATTTGATAGAGACCATCCTGCTATGTC
AGGCTCATTTCGTCAGGTGCATAAAGCCGAACAAAGTAAAAGAAGCAGAT
AACTTTGACGTGGATTTTGTTAGAGCTCAAATCAAATGCAACGGCATCCT
GGATTCCGTTCGTATTCGCAAAGACGGTTTTCCTGTTCGGCTGCCGTTCA
AAATCTTTGTGGAGAGaTATCGTTTTGTGAAATTTGATATGACGTCACCA
TTGGAGAACACTGGAGAAATATGTCAACAGATTCTTCAACATTGCAACAT
TGATGACGGCTACAAGATTGGTGCCACCAGgGTGTTGCTTCGCCTTGAGC
ACGTACAGAAATTGTTATCCTCACTTGATGAACAAACTCGAAGAATCGTC
ATCGCGCAGAAAATGGTAAGAGGAAAATTAGCGCGCATCGATTTTGATTT
CTTACAAACGTCACGCAAACAAGAAGATCGAAACGTCGGCAATTTGTTGG
TCTCGATCTCATCACGCAGCAGCAAGATGCATGACAATCTCTTGATATTG
AACGATTACGATTTGAAGCGACATCAACGTGTTAAAGATAAGGAGATGAA
GAAAGAAATTGAGAAGGAGAACTTCATCCAAAAACGCAAATTGACGAGTG
CCACAGATCCTGAATTGAAACTTCGTGAAAGTCAACAACGACCCGCCCCT
GAAAACTCACCAAACAGAAAGGTTCCACGCAACAAACAACGCACACAAAC
AGAACCATTGATTCGCAACTTCATCTCGGGTCCACAATCAGCATGGTGTA
TGGTCAAATGCTACGAACGCCAATTCCACATTGCATCTTTCCAAATGGAA
GAAGCTGTCATTTGTGTTGACGGCACACACACATTCAGTGATAAAAACCG
CATCGCCTTTGCCACCCTCCCCGTACGGGCGGACGATCCAAAAGTCGCCA
AAGTGAAAAGTTGTATCGGGAAAGGAGTCCAGTTACACCAAGACGAGCGA
CAAAACTTGTGGGCTACGCGACTTGGTAAAAACCCTATATTTGTGCGTGG
TCATACCTTATGTCCAGAACTGGTCAAACTGAACGGCAAACTTACGCAAG
GCGTACCCATGAAAGTGTTAGATACGGCCGCTTTCAAGGATTACATGCGT
GAAGAAGTTGAGAAAAATGGCGGCGTCACTGAAGACCTCAAAGATCGAAT
CATGTCTAAACTGAAGATTTGCATGAGTTTCATCAAAGATACACACTTAG
ACGAAGAAACGCCGTGTTGGTTCGAAATTTGGCTTGTCAAAGTCAAGGAG
CATGTTAGACGTTACCTTGACAACCAACAGAAACGAGAGAAACGAAAATC
AGGACATTTAGACATGCGTATTACACAAACACAAGAATCCGTTAAACGAA
TTGCAGCCATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATCATTTACGT
AGACCACGAAGTAATACGGCAGGCCCGAATCCTGCCGAAACGACGGGAAA
ACCGGCCCGTTCATCAAGACCGCCGTCACAAATAATCGGCGAAAAATCCA
TCGCACGTCATCGAGGGACGACATCAGCAGACACAACGGCGCAATGGCGT
GTGGAACAAAAGATTACGCAAGAAATGTTACAACGTGAACGTAGTATGGA
CATGATTCGACGTGAGAAAAGCATGGACGTACGGCTGGAGTCGCGACTTT
TAATGGAACGCGAATATCGAAACAGTATGGGAAAACCTTTAGTTGAATCT
CAACACGTGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAAAG
TCCACCGCAATCACTGGCCCGTAGTACGGGAAGCAGTATGGGATCACGTA
AAGACAATTCGACCACAGCCAACGATTCCCCTCGTATAGTTAACGGTCCA
CATACGCCCGTTTCACGTATGCCCGCCCACTCTCAACAAAATCCTCATGA
AGAATTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAATGAGTT
ATCGACAAGTATTTGGACTTCAATCATCAGACTATTTATTTAACGTGACG
CCGCCTAATTACACGCGCCATCGACGTTTCTCAGACTCAGATACTGAATC
CCTtcacaatttcaatttcatacaCAAAGTAATCACACAACCTTCAACGC
CCACTCACCAATCCACCCAACAATTAACAAACGCCCAACAAACGCCCTCC
CAACAAACAGAAGATCCGAAGAAATCGAAAGTACTTCAACAACCGAAAAG
ttggatgaaaaaagtacgACGAAAGTCGGAAGATAATCCAAAACGAAAAG
TTGTAGCGCAACTTTCTAACAAATAAATGGATTTGAACGACTTATGTGAC
CTTGAAAATCCTGATGATGATGTTATTGTTGACGCTATCAAAAAGAGATA
TGAGTGTGGGTATTTCTATACTTGTATTGGAGATATTCTCATCTCAATCA
ACCCATACAAAGAGTCCATCTTGAATTCGCTTGAGGTATCACACAGATAT
AAAGATGAACCTTCTCTTACGCAAACCAACCCACATGTCTTTGGTACCAC
AAACAATTTATATCATTTCCTCAATGTCAACAAAGAAAGTCAATGCTTCA
TCGTCTCTGGTGAATCTGGTTCTGGAAAAAGTGAAGTCATTCATCAAGCT
GTCACACATTTTTTATGTCTAGTTTCAACGTCTGATAGGAGTTTCAAAGA
AAGAATTTTACAGGCAAATGTAATTCTGGAAGCTTTTGGAAATGCACGGA
CAAGTTTAAATTCAAATGCAACaagattttgcaaatatttaaaGTTCCAT
TTCGATAGCAAGTTACATCTATCCGGAGTATCAATCACAGATTATTTGCT
TGAGTTGCCGAGAGTTTCAAATCAAAGACAGGGAGAAGCAAATTTCAATA
TCTTTTATTACATGTTTTCTGGGCGAACCGAAGATGAGCTATCAAAACAA
TTACTTGATACCCCTACACAACACAAATATTTGAAGTATGGTGAGTTTTT
TGGGGATGATTTACTTTCTTGGAGTCAGGCTTATGAAAGTCTTATTGATG
CATTTCAAGTTGTCGGCTTCACACAAGAGactgTCAAAGAGATATTTGGT
ATTTTGTCAGCCATTTTGAATATAGGTGATTTGAAGTTCAAATGTGAAGA
CGAAACAACAGGTGTTTTTGTGGACAATCTAGAAATACTTGATAAAGtTT
CTATTCTACTTGGAGTGgacacaagcgatttggaactTTGTTTAACCAGT
AATTTGTTTGTGAAACCAgATGATGGTGTTTCTGGCTTCAAAAGTCTGAG
TGAAGCTGAACAAACCAGAGATTTCATGGCCAATTTCATGTATGCAAGAT
TGTTTAGTTGGATAGTCAGCAACATTAACACTTTCTTGAACCCTGGCGAA
CCAAAAAAGAAACAATCTGAGCATGTGCATGTTggatttcttgatatttt
tgggTTTGAAGATTTCCAGAAAAACACACTAGAACAATTGTGTATTAACA
CCACAAATGAACAGATTAATTTGCACTTTATACAACACGTCTTTGCACGG
GAACAGgttgatTACCAAGAAGAAGGGCTTTCAGAATTACAATTAGTGGA
ATATTTTGATAACAAGAATATTGTTAATCTTCTCCTTGAGACACCTCACG
GCATCTTTGCATTATTGGAGGAAGAAAGCAAATGTTTGCAAGCAGATGAT
CAGACGCTTGTCTCTTCTTTCAATGCTCATTGTTCAGAATTGAAGTTCTA
TATTCCGTCCACCGCAAACGCATCCACTTTCAGTATCGTACActacaata
aaaaaGTAACTTACGCAGCAGATGACTTCATTTTGAGGAATAATGCAAAA
CTTGATGGCTGTCTGATTGAATGTTTAAGAGGTTCAAAGGGACAGTTAAC
GAGTACTCTATTCAACTCGTCCTTAACCAAGACAGGAGCACTAATCATCA
AgCAAGGACATGGTACAGTGAATTGTTGCCAAGGGGATCTTCGAGGGGCT
TACACCAAACGTATTAATCATAGGTTAAAGAAAGAGGGGAAATGCAATAC
GAGCAAAGCTTGCCACAACACGAAGAGCAAGCAACGCACATTCACCGCta
gaaaacataaaaataattcaGTTGCCGTTCAGTTCAGGAACTCGTTAGTG
GATTTGATAGAGACCATCCTGCTATGTCAGGCTCATTTCGTCAGGTGCAT
AAAGCCGAACAAAGTAAAAGAAGCAGATAACTTTGACGTGGATTTTGTTA
GAGCTCAAATCAAATGCAACGGCATCCTGGATTCCGTTCGTATTCGCAAA
GACGGTTTTCCTGTTCGGCTGCCGTTCAAAATCTTTGTGGAGAGaTATCG
TTTTGTGAAATTTGATATGACGTCACCATTGGAGAACACTGGAGAAATAT
GTCAACAGATTCTTCAACATTGCAACATTGATGACGGCTACAAGATTGGT
GCCACCAGgGTGTTGCTTCGCCTTGAGCACGTACAGAAATTGTTATCCTC
ACTTGATGAACAAACTCGAAGAATCGTCATCGCGCAGAAAATGGTAAGAG
GAAAATTAGCGCGCATCGATTTTGATTTCTTACAAACGTCACGCAAACAA
GAAGATCGAAACGTCGGCAATTTGTTGGTCTCGATCTCATCACGCAGCAG
CAAGATGCATGACAATCTCTTGATATTGAACGATTACGATTTGAAGCGAC
ATCAACGTGTTAAAGATAAGGAGATGAAGAAAGAAATTGAGAAGGAGAAC
TTCATCCAAAAACGCAAATTGACGAGTGCCACAGATCCTGAATTGAAACT
TCGTGAAAGTCAACAACGACCCGCCCCTGAAAACTCACCAAACAGAAAGG
TTCCACGCAACAAACAACGCACACAAACAGAACCATTGATTCGCAACTTC
ATCTCGGGTCCACAATCAGCATGGTGTATGGTCAAATGCTACGAACGCCA
ATTCCACATTGCATCTTTCCAAATGGAAGAAGCTGTCATTTGTGTTGACG
GCACACACACATTCAGTGATAAAAACCGCATCGCCTTTGCCACCCTCCCC
GTACGGGCGGACGATCCAAAAGTCGCCAAAGTGAAAAGTTGTATCGGGAA
AGGAGTCCAGTTACACCAAGACGAGCGACAAAACTTGTGGGCTACGCGAC
TTGGTAAAAACCCTATATTTGTGCGTGGTCATACCTTATGTCCAGAACTG
GTCAAACTGAACGGCAAACTTACGCAAGGCGTACCCATGAAAGTGTTAGA
TACGGCCGCTTTCAAGGATTACATGCGTGAAGAAGTTGAGAAAAATGGCG
GCGTCACTGAAGACCTCAAAGATCGAATCATGTCTAAACTGAAGATTTGC
ATGAGTTTCATCAAAGATACACACTTAGACGAAGAAACGCCGTGTTGGTT
CGAAATTTGGCTTGTCAAAGTCAAGGAGCATGTTAGACGTTACCTTGACA
ACCAACAGAAACGAGAGAAACGAAAATCAGGACATTTAGACATGCGTATT
ACACAAACACAAGAATCCGTTAAACGAATTGCAGCCATGCCTGAAATGAG
GCGCGCTAAAAGCGGTGATCATTTACGTAGACCACGAAGTAATACGGCAG
GCCCGAATCCTGCCGAAACGACGGGAAAACCGGCCCGTTCATCAAGACCG
CCGTCACAAATAATCGGCGAAAAATCCATCGCACGTCATCGAGGGACGAC
ATCAGCAGACACAACGGCGCAATGGCGTGTGGAACAAAAGATTACGCAAG
AAATGTTACAACGTGAACGTAGTATGGACATGATTCGACGTGAGAAAAGC
ATGGACGTACGGCTGGAGTCGCGACTTTTAATGGAACGCGAATATCGAAA
CAGTATGGGAAAACCTTTAGTTGAATCTCAACACGTGAACAGAGTGAGGG
GTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCACCGCAATCACTGGCCCGT
AGTACGGGAAGCAGTATGGGATCACGTAAAGACAATTCGACCACAGCCAA
CGATTCCCCTCGTATAGTTAACGGTCCACATACGCCCGTTTCACGTATGC
CCGCCCACTCTCAACAAAATCCTCATGAAGAATTTCGAAGGGGCGGAAGT
GTGGCGGCTGCCCGTGAAGGAATGAGTTATCGACAAGTATTTGGACTTCA
ATCATCAGACTATTTATTTAACGTGACGCCGCCTAATTACACGCGCCATC
GACGTTTCTCAGACTCAGATACTGAATCCCTtcacaatttcaatttcata
caCAAAGTAATCACACAACCTTCAACGCCCACTCACCAATCCACCCAACA
ATTAACAAACGCCCAACAAACGCCCTCCCAACAAACAGAAGATCCGAAGA
AATCGAAAGTACTTCAACAACCGAAAAGttggatgaaaaaagtacgACGA
AAGTCGGAAGATAATCCAAAACGAAAAGTTGTAGCGCAACTTTCTAACAA
ATAAATGGATTTGAACGACTTATGTGACCTTGAAAATCCTGATGATGATG
TTATTGTTGACGCTATCAAAAAGAGATATGAGTGTGGGTATTTCTATACT
TGTATTGGAGATATTCTCATCTCAATCAACCCATACAAAGAGTCCATCTT
GAATTCGCTTGAGGTATCACACAGATATAAAGATGAACCTTCTCTTACGC
AAACCAACCCACATGTCTTTGGTACCACAAACAATTTATATCATTTCCTC
AATGTCAACAAAGAAAGTCAATGCTTCATCGTCTCTGGTGAATCTGGTTC
TGGAAAAAGTGAAGTCATTCATCAAGCTGTCACACATTTTTTATGTCTAG
TTTCAACGTCTGATAGGAGTTTCAAAGAAAGAATTTTACAGGCAAATGTA
ATTCTGGAAGCTTTTGGAAATGCACGGACAAGTTTAAATTCAAATGCAAC
aagattttgcaaatatttaaaGTTCCATTTCGATAGCAAGTTACATCTAT
CCGGAGTATCAATCACAGATTATTTGCTTGAGTTGCCGAGAGTTTCAAAT
CAAAGACAGGGAGAAGCAAATTTCAATATCTTTTATTACATGTTTTCTGG
GCGAACCGAAGATGAGCTATCAAAACAATTACTTGATACCCCTACACAAC
ACAAATATTTGAAGTATGGTGAGTTTTTTGGGGATGATTTACTTTCTTGG
AGTCAGGCTTATGAAAGTCTTATTGATGCATTTCAAGTTGTCGGCTTCAC
ACAAGAGactgTCAAAGAGATATTTGGTATTTTGTCAGCCATTTTGAATA
TAGGTGATTTGAAGTTCAAATGTGAAGACGAAACAACAGGTGTTTTTGTG
GACAATCTAGAAATACTTGATAAAGtTTCTATTCTACTTGGAGTGgacac
aagcgatttggaactTTGTTTAACCAGTAATTTGTTTGTGAAACCAgATG
ATGGTGTTTCTGGCTTCAAAAGTCTGAGTGAAGCTGAACAAACCAGAGAT
TTCATGGCCAATTTCATGTATGCAAGATTGTTTAGTTGGATAGTCAGCAA
CATTAACACTTTCTTGAACCCTGGCGAACCAAAAAAGAAACAATCTGAGC
ATGTGCATGTTggatttcttgatatttttgggTTTGAAGATTTCCAGAAA
AACACACTAGAACAATTGTGTATTAACACCACAAATGAACAGATTAATTT
GCACTTTATACAACACGTCTTTGCACGGGAACAGgttgatTACCAAGAAG
AAGGGCTTTCAGAATTACAATTAGTGGAATATTTTGATAACAAGAATATT
GTTAATCTTCTCCTTGAGACACCTCACGGCATCTTTGCATTATTGGAGGA
AGAAAGCAAATGTTTGCAAGCAGATGATCAGACGCTTGTCTCTTCTTTCA
ATGCTCATTGTTCAGAATTGAAGTTCTATATTCCGTCCACCGCAAACGCA
TCCACTTTCAGTATCGTACActacaataaaaaaGTAACTTACGCAGCAGA
TGACTTCATTTTGAGGAATAATGCAAAACTTGATGGCTGTCTGATTGAAT
GTTTAAGAGGTTCAAAGGGACAGTTAACGAGTACTCTATTCAACTCGTCC
TTAACCAAGACAGGAGCACTAATCATCAAgCAAGGACATGGTACAGTGAA
TTGTTGCCAAGGGGATCTTCGAGGGGCTTACACCAAACGTATTAATCATA
GGTTAAAGAAAGAGGGGAAATGCAATACGAGCAAAGCTTGCCACAACACG
AAGAGCAAGCAACGCACATTCACCGCtagaaaacataaaaataattcaGT
TGCCGTTCAGTTCAGGAACTCGTTAGTGGATTTGATAGAGACCATCCTGC
TATGTCAGGCTCATTTCGTCAGGTGCATAAAGCCGAACAAAGTAAAAGAA
GCAGATAACTTTGACGTGGATTTTGTTAGAGCTCAAATCAAATGCAACGG
CATCCTGGATTCCGTTCGTATTCGCAAAGACGGTTTTCCTGTTCGGCTGC
CGTTCAAAATCTTTGTGGAGAGaTATCGTTTTGTGAAATTTGATATGACG
TCACCATTGGAGAACACTGGAGAAATATGTCAACAGATTCTTCAACATTG
CAACATTGATGACGGCTACAAGATTGGTGCCACCAGgGTGTTGCTTCGCC
TTGAGCACGTACAGAAATTGTTATCCTCACTTGATGAACAAACTCGAAGA
ATCGTCATCGCGCAGAAAATGGTAAGAGGAAAATTAGCGCGCATCGATTT
TGATTTCTTACAAACGTCACGCAAACAAGAAGATCGAAACGTCGGCAATT
TGTTGGTCTCGATCTCATCACGCAGCAGCAAGATGCATGACAATCTCTTG
ATATTGAACGATTACGATTTGAAGCGACATCAACGTGTTAAAGATAAGGA
GATGAAGAAAGAAATTGAGAAGGAGAACTTCATCCAAAAACGCAAATTGA
CGAGTGCCACAGATCCTGAATTGAAACTTCGTGAAAGTCAACAACGACCC
GCCCCTGAAAACTCACCAAACAGAAAGGTTCCACGCAACAAACAACGCAC
ACAAACAGAACCATTGATTCGCAACTTCATCTCGGGTCCACAATCAGCAT
GGTGTATGGTCAAATGCTACGAACGCCAATTCCACATTGCATCTTTCCAA
ATGGAAGAAGCTGTCATTTGTGTTGACGGCACACACACATTCAGTGATAA
AAACCGCATCGCCTTTGCCACCCTCCCCGTACGGGCGGACGATCCAAAAG
TCGCCAAAGTGAAAAGTTGTATCGGGAAAGGAGTCCAGTTACACCAAGAC
GAGCGACAAAACTTGTGGGCTACGCGACTTGGTAAAAACCCTATATTTGT
GCGTGGTCATACCTTATGTCCAGAACTGGTCAAACTGAACGGCAAACTTA
CGCAAGGCGTACCCATGAAAGTGTTAGATACGGCCGCTTTCAAGGATTAC
ATGCGTGAAGAAGTTGAGAAAAATGGCGGCGTCACTGAAGACCTCAAAGA
TCGAATCATGTCTAAACTGAAGATTTGCATGAGTTTCATCAAAGATACAC
ACTTAGACGAAGAAACGCCGTGTTGGTTCGAAATTTGGCTTGTCAAAGTC
AAGGAGCATGTTAGACGTTACCTTGACAACCAACAGAAACGAGAGAAACG
AAAATCAGGACATTTAGACATGCGTATTACACAAACACAAGAATCCGTTA
AACGAATTGCAGCCATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATCAT
TTACGTAGACCACGAAGTAATACGGCAGGCCCGAATCCTGCCGAAACGAC
GGGAAAACCGGCCCGTTCATCAAGACCGCCGTCACAAATAATCGGCGAAA
AATCCATCGCACGTCATCGAGGGACGACATCAGCAGACACAACGGCGCAA
TGGCGTGTGGAACAAAAGATTACGCAAGAAATGTTACAACGTGAACGTAG
TATGGACATGATTCGACGTGAGAAAAGCATGGACGTACGGCTGGAGTCGC
GACTTTTAATGGAACGCGAATATCGAAACAGTATGGGAAAACCTTTAGTT
GAATCTCAACACGTGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGG
TCAAAGTCCACCGCAATCACTGGCCCGTAGTACGGGAAGCAGTATGGGAT
CACGTAAAGACAATTCGACCACAGCCAACGATTCCCCTCGTATAGTTAAC
GGTCCACATACGCCCGTTTCACGTATGCCCGCCCACTCTCAACAAAATCC
TCATGAAGAATTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAA
TGAGTTATCGACAAGTATTTGGACTTCAATCATCAGACTATTTATTTAAC
GTGACGCCGCCTAATTACACGCGCCATCGACGTTTCTCAGACTCAGATAC
TGAATCCCTtcacaatttcaatttcatacaCAAAGTAATCACACAACCTT
CAACGCCCACTCACCAATCCACCCAACAATTAACAAACGCCCAACAAACG
CCCTCCCAACAAACAGAAGATCCGAAGAAATCGAAAGTACTTCAACAACC
GAAAAGttggatgaaaaaagtacgACGAAAGTCGGAAGATAATCCAAAAC
GAAAAGTTGTAGCGCAACTTTCTAACAAATAAATGGATTTGAACGACTTA
TGTGACCTTGAAAATCCTGATGATGATGTTATTGTTGACGCTATCAAAAA
GAGATATGAGTGTGGGTATTTCTATACTTGTATTGGAGATATTCTCATCT
CAATCAACCCATACAAAGAGTCCATCTTGAATTCGCTTGAGGTATCACAC
AGATATAAAGATGAACCTTCTCTTACGCAAACCAACCCACATGTCTTTGG
TACCACAAACAATTTATATCATTTCCTCAATGTCAACAAAGAAAGTCAAT
GCTTCATCGTCTCTGGTGAATCTGGTTCTGGAAAAAGTGAAGTCATTCAT
CAAGCTGTCACACATTTTTTATGTCTAGTTTCAACGTCTGATAGGAGTTT
CAAAGAAAGAATTTTACAGGCAAATGTAATTCTGGAAGCTTTTGGAAATG
CACGGACAAGTTTAAATTCAAATGCAACaagattttgcaaatatttaaaG
TTCCATTTCGATAGCAAGTTACATCTATCCGGAGTATCAATCACAGATTA
TTTGCTTGAGTTGCCGAGAGTTTCAAATCAAAGACAGGGAGAAGCAAATT
TCAATATCTTTTATTACATGTTTTCTGGGCGAACCGAAGATGAGCTATCA
AAACAATTACTTGATACCCCTACACAACACAAATATTTGAAGTATGGTGA
GTTTTTTGGGGATGATTTACTTTCTTGGAGTCAGGCTTATGAAAGTCTTA
TTGATGCATTTCAAGTTGTCGGCTTCACACAAGAGactgTCAAAGAGATA
TTTGGTATTTTGTCAGCCATTTTGAATATAGGTGATTTGAAGTTCAAATG
TGAAGACGAAACAACAGGTGTTTTTGTGGACAATCTAGAAATACTTGATA
AAGtTTCTATTCTACTTGGAGTGgacacaagcgatttggaactTTGTTTA
ACCAGTAATTTGTTTGTGAAACCAgATGATGGTGTTTCTGGCTTCAAAAG
TCTGAGTGAAGCTGAACAAACCAGAGATTTCATGGCCAATTTCATGTATG
CAAGATTGTTTAGTTGGATAGTCAGCAACATTAACACTTTCTTGAACCCT
GGCGAACCAAAAAAGAAACAATCTGAGCATGTGCATGTTggatttcttga
tatttttgggTTTGAAGATTTCCAGAAAAACACACTAGAACAATTGTGTA
TTAACACCACAAATGAACAGATTAATTTGCACTTTATACAACACGTCTTT
GCACGGGAACAGgttgatTACCAAGAAGAAGGGCTTTCAGAATTACAATT
AGTGGAATATTTTGATAACAAGAATATTGTTAATCTTCTCCTTGAGACAC
CTCACGGCATCTTTGCATTATTGGAGGAAGAAAGCAAATGTTTGCAAGCA
GATGATCAGACGCTTGTCTCTTCTTTCAATGCTCATTGTTCAGAATTGAA
GTTCTATATTCCGTCCACCGCAAACGCATCCACTTTCAGTATCGTACAct
acaataaaaaaGTAACTTACGCAGCAGATGACTTCATTTTGAGGAATAAT
GCAAAACTTGATGGCTGTCTGATTGAATGTTTAAGAGGTTCAAAGGGACA
GTTAACGAGTACTCTATTCAACTCGTCCTTAACCAAGACAGGAGCACTAA
TCATCAAgCAAGGACATGGTACAGTGAATTGTTGCCAAGGGGATCTTCGA
GGGGCTTACACCAAACGTATTAATCATAGGTTAAAGAAAGAGGGGAAATG
CAATACGAGCAAAGCTTGCCACAACACGAAGAGCAAGCAACGCACATTCA
CCGCtagaaaacataaaaataattcaGTTGCCGTTCAGTTCAGGAACTCG
TTAGTGGATTTGATAGAGACCATCCTGCTATGTCAGGCTCATTTCGTCAG
GTGCATAAAGCCGAACAAAGTAAAAGAAGCAGATAACTTTGACGTGGATT
TTGTTAGAGCTCAAATCAAATGCAACGGCATCCTGGATTCCGTTCGTATT
CGCAAAGACGGTTTTCCTGTTCGGCTGCCGTTCAAAATCTTTGTGGAGAG
aTATCGTTTTGTGAAATTTGATATGACGTCACCATTGGAGAACACTGGAG
AAATATGTCAACAGATTCTTCAACATTGCAACATTGATGACGGCTACAAG
ATTGGTGCCACCAGgGTGTTGCTTCGCCTTGAGCACGTACAGAAATTGTT
ATCCTCACTTGATGAACAAACTCGAAGAATCGTCATCGCGCAGAAAATGG
TAAGAGGAAAATTAGCGCGCATCGATTTTGATTTCTTACAAACGTCACGC
AAACAAGAAGATCGAAACGTCGGCAATTTGTTGGTCTCGATCTCATCACG
CAGCAGCAAGATGCATGACAATCTCTTGATATTGAACGATTACGATTTGA
AGCGACATCAACGTGTTAAAGATAAGGAGATGAAGAAAGAAATTGAGAAG
GAGAACTTCATCCAAAAACGCAAATTGACGAGTGCCACAGATCCTGAATT
GAAACTTCGTGAAAGTCAACAACGACCCGCCCCTGAAAACTCACCAAACA
GAAAGGTTCCACGCAACAAACAACGCACACAAACAGAACCATTGATTCGC
AACTTCATCTCGGGTCCACAATCAGCATGGTGTATGGTCAAATGCTACGA
ACGCCAATTCCACATTGCATCTTTCCAAATGGAAGAAGCTGTCATTTGTG
TTGACGGCACACACACATTCAGTGATAAAAACCGCATCGCCTTTGCCACC
CTCCCCGTACGGGCGGACGATCCAAAAGTCGCCAAAGTGAAAAGTTGTAT
CGGGAAAGGAGTCCAGTTACACCAAGACGAGCGACAAAACTTGTGGGCTA
CGCGACTTGGTAAAAACCCTATATTTGTGCGTGGTCATACCTTATGTCCA
GAACTGGTCAAACTGAACGGCAAACTTACGCAAGGCGTACCCATGAAAGT
GTTAGATACGGCCGCTTTCAAGGATTACATGCGTGAAGAAGTTGAGAAAA
ATGGCGGCGTCACTGAAGACCTCAAAGATCGAATCATGTCTAAACTGAAG
ATTTGCATGAGTTTCATCAAAGATACACACTTAGACGAAGAAACGCCGTG
TTGGTTCGAAATTTGGCTTGTCAAAGTCAAGGAGCATGTTAGACGTTACC
TTGACAACCAACAGAAACGAGAGAAACGAAAATCAGGACATTTAGACATG
CGTATTACACAAACACAAGAATCCGTTAAACGAATTGCAGCCATGCCTGA
AATGAGGCGCGCTAAAAGCGGTGATCATTTACGTAGACCACGAAGTAATA
CGGCAGGCCCGAATCCTGCCGAAACGACGGGAAAACCGGCCCGTTCATCA
AGACCGCCGTCACAAATAATCGGCGAAAAATCCATCGCACGTCATCGAGG
GACGACATCAGCAGACACAACGGCGCAATGGCGTGTGGAACAAAAGATTA
CGCAAGAAATGTTACAACGTGAACGTAGTATGGACATGATTCGACGTGAG
AAAAGCATGGACGTACGGCTGGAGTCGCGACTTTTAATGGAACGCGAATA
TCGAAACAGTATGGGAAAACCTTTAGTTGAATCTCAACACGTGAACAGAG
TGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCACCGCAATCACTG
GCCCGTAGTACGGGAAGCAGTATGGGATCACGTAAAGACAATTCGACCAC
AGCCAACGATTCCCCTCGTATAGTTAACGGTCCACATACGCCCGTTTCAC
GTATGCCCGCCCACTCTCAACAAAATCCTCATGAAGAATTTCGAAGGGGC
GGAAGTGTGGCGGCTGCCCGTGAAGGAATGAGTTATCGACAAGTATTTGG
ACTTCAATCATCAGACTATTTATTTAACGTGACGCCGCCTAATTACACGC
GCCATCGACGTTTCTCAGACTCAGATACTGAATCCCTtcacaatttcaat
ttcatacaCAAAGTAATCACACAACCTTCAACGCCCACTCACCAATCCAC
CCAACAATTAACAAACGCCCAACAAACGCCCTCCCAACAAACAGAAGATC
CGAAGAAATCGAAAGTACTTCAACAACCGAAAAGttggatgaaaaaagta
cgACGAAAGTCGGAAGATAATCCAAAACGAAAAGTTGTAGCGCAACTTTC
TAACAAATAAATGGATTTGAACGACTTATGTGACCTTGAAAATCCTGATG
ATGATGTTATTGTTGACGCTATCAAAAAGAGATATGAGTGTGGGTATTTC
TATACTTGTATTGGAGATATTCTCATCTCAATCAACCCATACAAAGAGTC
CATCTTGAATTCGCTTGAGGTATCACACAGATATAAAGATGAACCTTCTC
TTACGCAAACCAACCCACATGTCTTTGGTACCACAAACAATTTATATCAT
TTCCTCAATGTCAACAAAGAAAGTCAATGCTTCATCGTCTCTGGTGAATC
TGGTTCTGGAAAAAGTGAAGTCATTCATCAAGCTGTCACACATTTTTTAT
GTCTAGTTTCAACGTCTGATAGGAGTTTCAAAGAAAGAATTTTACAGGCA
AATGTAATTCTGGAAGCTTTTGGAAATGCACGGACAAGTTTAAATTCAAA
TGCAACaagattttgcaaatatttaaaGTTCCATTTCGATAGCAAGTTAC
ATCTATCCGGAGTATCAATCACAGATTATTTGCTTGAGTTGCCGAGAGTT
TCAAATCAAAGACAGGGAGAAGCAAATTTCAATATCTTTTATTACATGTT
TTCTGGGCGAACCGAAGATGAGCTATCAAAACAATTACTTGATACCCCTA
CACAACACAAATATTTGAAGTATGGTGAGTTTTTTGGGGATGATTTACTT
TCTTGGAGTCAGGCTTATGAAAGTCTTATTGATGCATTTCAAGTTGTCGG
CTTCACACAAGAGactgTCAAAGAGATATTTGGTATTTTGTCAGCCATTT
TGAATATAGGTGATTTGAAGTTCAAATGTGAAGACGAAACAACAGGTGTT
TTTGTGGACAATCTAGAAATACTTGATAAAGtTTCTATTCTACTTGGAGT
GgacacaagcgatttggaactTTGTTTAACCAGTAATTTGTTTGTGAAAC
CAgATGATGGTGTTTCTGGCTTCAAAAGTCTGAGTGAAGCTGAACAAACC
AGAGATTTCATGGCCAATTTCATGTATGCAAGATTGTTTAGTTGGATAGT
CAGCAACATTAACACTTTCTTGAACCCTGGCGAACCAAAAAAGAAACAAT
CTGAGCATGTGCATGTTggatttcttgatatttttgggTTTGAAGATTTC
CAGAAAAACACACTAGAACAATTGTGTATTAACACCACAAATGAACAGAT
TAATTTGCACTTTATACAACACGTCTTTGCACGGGAACAGgttgatTACC
AAGAAGAAGGGCTTTCAGAATTACAATTAGTGGAATATTTTGATAACAAG
AATATTGTTAATCTTCTCCTTGAGACACCTCACGGCATCTTTGCATTATT
GGAGGAAGAAAGCAAATGTTTGCAAGCAGATGATCAGACGCTTGTCTCTT
CTTTCAATGCTCATTGTTCAGAATTGAAGTTCTATATTCCGTCCACCGCA
AACGCATCCACTTTCAGTATCGTACActacaataaaaaaGTAACTTACGC
AGCAGATGACTTCATTTTGAGGAATAATGCAAAACTTGATGGCTGTCTGA
TTGAATGTTTAAGAGGTTCAAAGGGACAGTTAACGAGTACTCTATTCAAC
TCGTCCTTAACCAAGACAGGAGCACTAATCATCAAgCAAGGACATGGTAC
AGTGAATTGTTGCCAAGGGGATCTTCGAGGGGCTTACACCAAACGTATTA
ATCATAGGTTAAAGAAAGAGGGGAAATGCAATACGAGCAAAGCTTGCCAC
AACACGAAGAGCAAGCAACGCACATTCACCGCtagaaaacataaaaataa
ttcaGTTGCCGTTCAGTTCAGGAACTCGTTAGTGGATTTGATAGAGACCA
TCCTGCTATGTCAGGCTCATTTCGTCAGGTGCATAAAGCCGAACAAAGTA
AAAGAAGCAGATAACTTTGACGTGGATTTTGTTAGAGCTCAAATCAAATG
CAACGGCATCCTGGATTCCGTTCGTATTCGCAAAGACGGTTTTCCTGTTC
GGCTGCCGTTCAAAATCTTTGTGGAGAGaTATCGTTTTGTGAAATTTGAT
ATGACGTCACCATTGGAGAACACTGGAGAAATATGTCAACAGATTCTTCA
ACATTGCAACATTGATGACGGCTACAAGATTGGTGCCACCAGgGTGTTGC
TTCGCCTTGAGCACGTACAGAAATTGTTATCCTCACTTGATGAACAAACT
CGAAGAATCGTCATCGCGCAGAAAATGGTAAGAGGAAAATTAGCGCGCAT
CGATTTTGATTTCTTACAAACGTCACGCAAACAAGAAGATCGAAACGTCG
GCAATTTGTTGGTCTCGATCTCATCACGCAGCAGCAAGATGCATGACAAT
CTCTTGATATTGAACGATTACGATTTGAAGCGACATCAACGTGTTAAAGA
TAAGGAGATGAAGAAAGAAATTGAGAAGGAGAACTTCATCCAAAAACGCA
AATTGACGAGTGCCACAGATCCTGAATTGAAACTTCGTGAAAGTCAACAA
CGACCCGCCCCTGAAAACTCACCAAACAGAAAGGTTCCACGCAACAAACA
ACGCACACAAACAGAACCATTGATTCGCAACTTCATCTCGGGTCCACAAT
CAGCATGGTGTATGGTCAAATGCTACGAACGCCAATTCCACATTGCATCT
TTCCAAATGGAAGAAGCTGTCATTTGTGTTGACGGCACACACACATTCAG
TGATAAAAACCGCATCGCCTTTGCCACCCTCCCCGTACGGGCGGACGATC
CAAAAGTCGCCAAAGTGAAAAGTTGTATCGGGAAAGGAGTCCAGTTACAC
CAAGACGAGCGACAAAACTTGTGGGCTACGCGACTTGGTAAAAACCCTAT
ATTTGTGCGTGGTCATACCTTATGTCCAGAACTGGTCAAACTGAACGGCA
AACTTACGCAAGGCGTACCCATGAAAGTGTTAGATACGGCCGCTTTCAAG
GATTACATGCGTGAAGAAGTTGAGAAAAATGGCGGCGTCACTGAAGACCT
CAAAGATCGAATCATGTCTAAACTGAAGATTTGCATGAGTTTCATCAAAG
ATACACACTTAGACGAAGAAACGCCGTGTTGGTTCGAAATTTGGCTTGTC
AAAGTCAAGGAGCATGTTAGACGTTACCTTGACAACCAACAGAAACGAGA
GAAACGAAAATCAGGACATTTAGACATGCGTATTACACAAACACAAGAAT
CCGTTAAACGAATTGCAGCCATGCCTGAAATGAGGCGCGCTAAAAGCGGT
GATCATTTACGTAGACCACGAAGTAATACGGCAGGCCCGAATCCTGCCGA
AACGACGGGAAAACCGGCCCGTTCATCAAGACCGCCGTCACAAATAATCG
GCGAAAAATCCATCGCACGTCATCGAGGGACGACATCAGCAGACACAACG
GCGCAATGGCGTGTGGAACAAAAGATTACGCAAGAAATGTTACAACGTGA
ACGTAGTATGGACATGATTCGACGTGAGAAAAGCATGGACGTACGGCTGG
AGTCGCGACTTTTAATGGAACGCGAATATCGAAACAGTATGGGAAAACCT
TTAGTTGAATCTCAACACGTGAACAGAGTGAGGGGTAGCGAGAAAAGTAG
CCCCGGTCAAAGTCCACCGCAATCACTGGCCCGTAGTACGGGAAGCAGTA
TGGGATCACGTAAAGACAATTCGACCACAGCCAACGATTCCCCTCGTATA
GTTAACGGTCCACATACGCCCGTTTCACGTATGCCCGCCCACTCTCAACA
AAATCCTCATGAAGAATTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTG
AAGGAATGAGTTATCGACAAGTATTTGGACTTCAATCATCAGACTATTTA
TTTAACGTGACGCCGCCTAATTACACGCGCCATCGACGTTTCTCAGACTC
AGATACTGAATCCCTtcacaatttcaatttcatacaCAAAGTAATCACAC
AACCTTCAACGCCCACTCACCAATCCACCCAACAATTAACAAACGCCCAA
CAAACGCCCTCCCAACAAACAGAAGATCCGAAGAAATCGAAAGTACTTCA
ACAACCGAAAAGttggatgaaaaaagtacgACGAAAGTCGGAAGATAATC
CAAAACGAAAAGTTGTAGCGCAACTTTCTAACAAATAAATGGATTTGAAC
GACTTATGTGACCTTGAAAATCCTGATGATGATGTTATTGTTGACGCTAT
CAAAAAGAGATATGAGTGTGGGTATTTCTATACTTGTATTGGAGATATTC
TCATCTCAATCAACCCATACAAAGAGTCCATCTTGAATTCGCTTGAGGTA
TCACACAGATATAAAGATGAACCTTCTCTTACGCAAACCAACCCACATGT
CTTTGGTACCACAAACAATTTATATCATTTCCTCAATGTCAACAAAGAAA
GTCAATGCTTCATCGTCTCTGGTGAATCTGGTTCTGGAAAAAGTGAAGTC
ATTCATCAAGCTGTCACACATTTTTTATGTCTAGTTTCAACGTCTGATAG
GAGTTTCAAAGAAAGAATTTTACAGGCAAATGTAATTCTGGAAGCTTTTG
GAAATGCACGGACAAGTTTAAATTCAAATGCAACaagattttgcaaatat
ttaaaGTTCCATTTCGATAGCAAGTTACATCTATCCGGAGTATCAATCAC
AGATTATTTGCTTGAGTTGCCGAGAGTTTCAAATCAAAGACAGGGAGAAG
CAAATTTCAATATCTTTTATTACATGTTTTCTGGGCGAACCGAAGATGAG
CTATCAAAACAATTACTTGATACCCCTACACAACACAAATATTTGAAGTA
TGGTGAGTTTTTTGGGGATGATTTACTTTCTTGGAGTCAGGCTTATGAAA
GTCTTATTGATGCATTTCAAGTTGTCGGCTTCACACAAGAGactgTCAAA
GAGATATTTGGTATTTTGTCAGCCATTTTGAATATAGGTGATTTGAAGTT
CAAATGTGAAGACGAAACAACAGGTGTTTTTGTGGACAATCTAGAAATAC
TTGATAAAGtTTCTATTCTACTTGGAGTGgacacaagcgatttggaactT
TGTTTAACCAGTAATTTGTTTGTGAAACCAgATGATGGTGTTTCTGGCTT
CAAAAGTCTGAGTGAAGCTGAACAAACCAGAGATTTCATGGCCAATTTCA
TGTATGCAAGATTGTTTAGTTGGATAGTCAGCAACATTAACACTTTCTTG
AACCCTGGCGAACCAAAAAAGAAACAATCTGAGCATGTGCATGTTggatt
tcttgatatttttgggTTTGAAGATTTCCAGAAAAACACACTAGAACAAT
TGTGTATTAACACCACAAATGAACAGATTAATTTGCACTTTATACAACAC
GTCTTTGCACGGGAACAGgttgatTACCAAGAAGAAGGGCTTTCAGAATT
ACAATTAGTGGAATATTTTGATAACAAGAATATTGTTAATCTTCTCCTTG
AGACACCTCACGGCATCTTTGCATTATTGGAGGAAGAAAGCAAATGTTTG
CAAGCAGATGATCAGACGCTTGTCTCTTCTTTCAATGCTCATTGTTCAGA
ATTGAAGTTCTATATTCCGTCCACCGCAAACGCATCCACTTTCAGTATCG
TACActacaataaaaaaGTAACTTACGCAGCAGATGACTTCATTTTGAGG
AATAATGCAAAACTTGATGGCTGTCTGATTGAATGTTTAAGAGGTTCAAA
GGGACAGTTAACGAGTACTCTATTCAACTCGTCCTTAACCAAGACAGGAG
CACTAATCATCAAgCAAGGACATGGTACAGTGAATTGTTGCCAAGGGGAT
CTTCGAGGGGCTTACACCAAACGTATTAATCATAGGTTAAAGAAAGAGGG
GAAATGCAATACGAGCAAAGCTTGCCACAACACGAAGAGCAAGCAACGCA
CATTCACCGCtagaaaacataaaaataattcaGTTGCCGTTCAGTTCAGG
AACTCGTTAGTGGATTTGATAGAGACCATCCTGCTATGTCAGGCTCATTT
CGTCAGGTGCATAAAGCCGAACAAAGTAAAAGAAGCAGATAACTTTGACG
TGGATTTTGTTAGAGCTCAAATCAAATGCAACGGCATCCTGGATTCCGTT
CGTATTCGCAAAGACGGTTTTCCTGTTCGGCTGCCGTTCAAAATCTTTGT
GGAGAGaTATCGTTTTGTGAAATTTGATATGACGTCACCATTGGAGAACA
CTGGAGAAATATGTCAACAGATTCTTCAACATTGCAACATTGATGACGGC
TACAAGATTGGTGCCACCAGgGTGTTGCTTCGCCTTGAGCACGTACAGAA
ATTGTTATCCTCACTTGATGAACAAACTCGAAGAATCGTCATCGCGCAGA
AAATGGTAAGAGGAAAATTAGCGCGCATCGATTTTGATTTCTTACAAACG
TCACGCAAACAAGAAGATCGAAACGTCGGCAATTTGTTGGTCTCGATCTC
ATCACGCAGCAGCAAGATGCATGACAATCTCTTGATATTGAACGATTACG
ATTTGAAGCGACATCAACGTGTTAAAGATAAGGAGATGAAGAAAGAAATT
GAGAAGGAGAACTTCATCCAAAAACGCAAATTGACGAGTGCCACAGATCC
TGAATTGAAACTTCGTGAAAGTCAACAACGACCCGCCCCTGAAAACTCAC
CAAACAGAAAGGTTCCACGCAACAAACAACGCACACAAACAGAACCATTG
ATTCGCAACTTCATCTCGGGTCCACAATCAGCATGGTGTATGGTCAAATG
CTACGAACGCCAATTCCACATTGCATCTTTCCAAATGGAAGAAGCTGTCA
TTTGTGTTGACGGCACACACACATTCAGTGATAAAAACCGCATCGCCTTT
GCCACCCTCCCCGTACGGGCGGACGATCCAAAAGTCGCCAAAGTGAAAAG
TTGTATCGGGAAAGGAGTCCAGTTACACCAAGACGAGCGACAAAACTTGT
GGGCTACGCGACTTGGTAAAAACCCTATATTTGTGCGTGGTCATACCTTA
TGTCCAGAACTGGTCAAACTGAACGGCAAACTTACGCAAGGCGTACCCAT
GAAAGTGTTAGATACGGCCGCTTTCAAGGATTACATGCGTGAAGAAGTTG
AGAAAAATGGCGGCGTCACTGAAGACCTCAAAGATCGAATCATGTCTAAA
CTGAAGATTTGCATGAGTTTCATCAAAGATACACACTTAGACGAAGAAAC
GCCGTGTTGGTTCGAAATTTGGCTTGTCAAAGTCAAGGAGCATGTTAGAC
GTTACCTTGACAACCAACAGAAACGAGAGAAACGAAAATCAGGACATTTA
GACATGCGTATTACACAAACACAAGAATCCGTTAAACGAATTGCAGCCAT
GCCTGAAATGAGGCGCGCTAAAAGCGGTGATCATTTACGTAGACCACGAA
GTAATACGGCAGGCCCGAATCCTGCCGAAACGACGGGAAAACCGGCCCGT
TCATCAAGACCGCCGTCACAAATAATCGGCGAAAAATCCATCGCACGTCA
TCGAGGGACGACATCAGCAGACACAACGGCGCAATGGCGTGTGGAACAAA
AGATTACGCAAGAAATGTTACAACGTGAACGTAGTATGGACATGATTCGA
CGTGAGAAAAGCATGGACGTACGGCTGGAGTCGCGACTTTTAATGGAACG
CGAATATCGAAACAGTATGGGAAAACCTTTAGTTGAATCTCAACACGTGA
ACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCACCGCAA
TCACTGGCCCGTAGTACGGGAAGCAGTATGGGATCACGTAAAGACAATTC
GACCACAGCCAACGATTCCCCTCGTATAGTTAACGGTCCACATACGCCCG
TTTCACGTATGCCCGCCCACTCTCAACAAAATCCTCATGAAGAATTTCGA
AGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAATGAGTTATCGACAAGT
ATTTGGACTTCAATCATCAGACTATTTATTTAACGTGACGCCGCCTAATT
ACACGCGCCATCGACGTTTCTCAGACTCAGATACTGAATCCCTtcacaat
ttcaatttcatacaCAAAGTAATCACACAACCTTCAACGCCCACTCACCA
ATCCACCCAACAATTAACAAACGCCCAACAAACGCCCTCCCAACAAACAG
AAGATCCGAAGAAATCGAAAGTACTTCAACAACCGAAAAGttggatgaaa
aaagtacgACGAAAGTCGGAAGATAATCCAAAACGAAAAGTTGTAGCGCA
ACTTTCTAACAAATAAATGGATTTGAACGACTTATGTGACCTTGAAAATC
CTGATGATGATGTTATTGTTGACGCTATCAAAAAGAGATATGAGTGTGGG
TATTTCTATACTTGTATTGGAGATATTCTCATCTCAATCAACCCATACAA
AGAGTCCATCTTGAATTCGCTTGAGGTATCACACAGATATAAAGATGAAC
CTTCTCTTACGCAAACCAACCCACATGTCTTTGGTACCACAAACAATTTA
TATCATTTCCTCAATGTCAACAAAGAAAGTCAATGCTTCATCGTCTCTGG
TGAATCTGGTTCTGGAAAAAGTGAAGTCATTCATCAAGCTGTCACACATT
TTTTATGTCTAGTTTCAACGTCTGATAGGAGTTTCAAAGAAAGAATTTTA
CAGGCAAATGTAATTCTGGAAGCTTTTGGAAATGCACGGACAAGTTTAAA
TTCAAATGCAACaagattttgcaaatatttaaaGTTCCATTTCGATAGCA
AGTTACATCTATCCGGAGTATCAATCACAGATTATTTGCTTGAGTTGCCG
AGAGTTTCAAATCAAAGACAGGGAGAAGCAAATTTCAATATCTTTTATTA
CATGTTTTCTGGGCGAACCGAAGATGAGCTATCAAAACAATTACTTGATA
CCCCTACACAACACAAATATTTGAAGTATGGTGAGTTTTTTGGGGATGAT
TTACTTTCTTGGAGTCAGGCTTATGAAAGTCTTATTGATGCATTTCAAGT
TGTCGGCTTCACACAAGAGactgTCAAAGAGATATTTGGTATTTTGTCAG
CCATTTTGAATATAGGTGATTTGAAGTTCAAATGTGAAGACGAAACAACA
GGTGTTTTTGTGGACAATCTAGAAATACTTGATAAAGtTTCTATTCTACT
TGGAGTGgacacaagcgatttggaactTTGTTTAACCAGTAATTTGTTTG
TGAAACCAgATGATGGTGTTTCTGGCTTCAAAAGTCTGAGTGAAGCTGAA
CAAACCAGAGATTTCATGGCCAATTTCATGTATGCAAGATTGTTTAGTTG
GATAGTCAGCAACATTAACACTTTCTTGAACCCTGGCGAACCAAAAAAGA
AACAATCTGAGCATGTGCATGTTggatttcttgatatttttgggTTTGAA
GATTTCCAGAAAAACACACTAGAACAATTGTGTATTAACACCACAAATGA
ACAGATTAATTTGCACTTTATACAACACGTCTTTGCACGGGAACAGgttg
atTACCAAGAAGAAGGGCTTTCAGAATTACAATTAGTGGAATATTTTGAT
AACAAGAATATTGTTAATCTTCTCCTTGAGACACCTCACGGCATCTTTGC
ATTATTGGAGGAAGAAAGCAAATGTTTGCAAGCAGATGATCAGACGCTTG
TCTCTTCTTTCAATGCTCATTGTTCAGAATTGAAGTTCTATATTCCGTCC
ACCGCAAACGCATCCACTTTCAGTATCGTACActacaataaaaaaGTAAC
TTACGCAGCAGATGACTTCATTTTGAGGAATAATGCAAAACTTGATGGCT
GTCTGATTGAATGTTTAAGAGGTTCAAAGGGACAGTTAACGAGTACTCTA
TTCAACTCGTCCTTAACCAAGACAGGAGCACTAATCATCAAgCAAGGACA
TGGTACAGTGAATTGTTGCCAAGGGGATCTTCGAGGGGCTTACACCAAAC
GTATTAATCATAGGTTAAAGAAAGAGGGGAAATGCAATACGAGCAAAGCT
TGCCACAACACGAAGAGCAAGCAACGCACATTCACCGCtagaaaacataa
aaataattcaGTTGCCGTTCAGTTCAGGAACTCGTTAGTGGATTTGATAG
AGACCATCCTGCTATGTCAGGCTCATTTCGTCAGGTGCATAAAGCCGAAC
AAAGTAAAAGAAGCAGATAACTTTGACGTGGATTTTGTTAGAGCTCAAAT
CAAATGCAACGGCATCCTGGATTCCGTTCGTATTCGCAAAGACGGTTTTC
CTGTTCGGCTGCCGTTCAAAATCTTTGTGGAGAGaTATCGTTTTGTGAAA
TTTGATATGACGTCACCATTGGAGAACACTGGAGAAATATGTCAACAGAT
TCTTCAACATTGCAACATTGATGACGGCTACAAGATTGGTGCCACCAGgG
TGTTGCTTCGCCTTGAGCACGTACAGAAATTGTTATCCTCACTTGATGAA
CAAACTCGAAGAATCGTCATCGCGCAGAAAATGGTAAGAGGAAAATTAGC
GCGCATCGATTTTGATTTCTTACAAACGTCACGCAAACAAGAAGATCGAA
ACGTCGGCAATTTGTTGGTCTCGATCTCATCACGCAGCAGCAAGATGCAT
GACAATCTCTTGATATTGAACGATTACGATTTGAAGCGACATCAACGTGT
TAAAGATAAGGAGATGAAGAAAGAAATTGAGAAGGAGAACTTCATCCAAA
AACGCAAATTGACGAGTGCCACAGATCCTGAATTGAAACTTCGTGAAAGT
CAACAACGACCCGCCCCTGAAAACTCACCAAACAGAAAGGTTCCACGCAA
CAAACAACGCACACAAACAGAACCATTGATTCGCAACTTCATCTCGGGTC
CACAATCAGCATGGTGTATGGTCAAATGCTACGAACGCCAATTCCACATT
GCATCTTTCCAAATGGAAGAAGCTGTCATTTGTGTTGACGGCACACACAC
ATTCAGTGATAAAAACCGCATCGCCTTTGCCACCCTCCCCGTACGGGCGG
ACGATCCAAAAGTCGCCAAAGTGAAAAGTTGTATCGGGAAAGGAGTCCAG
TTACACCAAGACGAGCGACAAAACTTGTGGGCTACGCGACTTGGTAAAAA
CCCTATATTTGTGCGTGGTCATACCTTATGTCCAGAACTGGTCAAACTGA
ACGGCAAACTTACGCAAGGCGTACCCATGAAAGTGTTAGATACGGCCGCT
TTCAAGGATTACATGCGTGAAGAAGTTGAGAAAAATGGCGGCGTCACTGA
AGACCTCAAAGATCGAATCATGTCTAAACTGAAGATTTGCATGAGTTTCA
TCAAAGATACACACTTAGACGAAGAAACGCCGTGTTGGTTCGAAATTTGG
CTTGTCAAAGTCAAGGAGCATGTTAGACGTTACCTTGACAACCAACAGAA
ACGAGAGAAACGAAAATCAGGACATTTAGACATGCGTATTACACAAACAC
AAGAATCCGTTAAACGAATTGCAGCCATGCCTGAAATGAGGCGCGCTAAA
AGCGGTGATCATTTACGTAGACCACGAAGTAATACGGCAGGCCCGAATCC
TGCCGAAACGACGGGAAAACCGGCCCGTTCATCAAGACCGCCGTCACAAA
TAATCGGCGAAAAATCCATCGCACGTCATCGAGGGACGACATCAGCAGAC
ACAACGGCGCAATGGCGTGTGGAACAAAAGATTACGCAAGAAATGTTACA
ACGTGAACGTAGTATGGACATGATTCGACGTGAGAAAAGCATGGACGTAC
GGCTGGAGTCGCGACTTTTAATGGAACGCGAATATCGAAACAGTATGGGA
AAACCTTTAGTTGAATCTCAACACGTGAACAGAGTGAGGGGTAGCGAGAA
AAGTAGCCCCGGTCAAAGTCCACCGCAATCACTGGCCCGTAGTACGGGAA
GCAGTATGGGATCACGTAAAGACAATTCGACCACAGCCAACGATTCCCCT
CGTATAGTTAACGGTCCACATACGCCCGTTTCACGTATGCCCGCCCACTC
TCAACAAAATCCTCATGAAGAATTTCGAAGGGGCGGAAGTGTGGCGGCTG
CCCGTGAAGGAATGAGTTATCGACAAGTATTTGGACTTCAATCATCAGAC
TATTTATTTAACGTGACGCCGCCTAATTACACGCGCCATCGACGTTTCTC
AGACTCAGATACTGAATCCCTtcacaatttcaatttcatacaCAAAGTAA
TCACACAACCTTCAACGCCCACTCACCAATCCACCCAACAATTAACAAAC
GCCCAACAAACGCCCTCCCAACAAACAGAAGATCCGAAGAAATCGAAAGT
ACTTCAACAACCGAAAAGttggatgaaaaaagtacgACGAAAGTCGGAAG
ATAATCCAAAACGAAAAGTTGTAGCGCAACTTTCTAACAAATAAATGGAT
TTGAACGACTTATGTGACCTTGAAAATCCTGATGATGATGTTATTGTTGA
CGCTATCAAAAAGAGATATGAGTGTGGGTATTTCTATACTTGTATTGGAG
ATATTCTCATCTCAATCAACCCATACAAAGAGTCCATCTTGAATTCGCTT
GAGGTATCACACAGATATAAAGATGAACCTTCTCTTACGCAAACCAACCC
ACATGTCTTTGGTACCACAAACAATTTATATCATTTCCTCAATGTCAACA
AAGAAAGTCAATGCTTCATCGTCTCTGGTGAATCTGGTTCTGGAAAAAGT
GAAGTCATTCATCAAGCTGTCACACATTTTTTATGTCTAGTTTCAACGTC
TGATAGGAGTTTCAAAGAAAGAATTTTACAGGCAAATGTAATTCTGGAAG
CTTTTGGAAATGCACGGACAAGTTTAAATTCAAATGCAACaagattttgc
aaatatttaaaGTTCCATTTCGATAGCAAGTTACATCTATCCGGAGTATC
AATCACAGATTATTTGCTTGAGTTGCCGAGAGTTTCAAATCAAAGACAGG
GAGAAGCAAATTTCAATATCTTTTATTACATGTTTTCTGGGCGAACCGAA
GATGAGCTATCAAAACAATTACTTGATACCCCTACACAACACAAATATTT
GAAGTATGGTGAGTTTTTTGGGGATGATTTACTTTCTTGGAGTCAGGCTT
ATGAAAGTCTTATTGATGCATTTCAAGTTGTCGGCTTCACACAAGAGact
gTCAAAGAGATATTTGGTATTTTGTCAGCCATTTTGAATATAGGTGATTT
GAAGTTCAAATGTGAAGACGAAACAACAGGTGTTTTTGTGGACAATCTAG
AAATACTTGATAAAGtTTCTATTCTACTTGGAGTGgacacaagcgatttg
gaactTTGTTTAACCAGTAATTTGTTTGTGAAACCAgATGATGGTGTTTC
TGGCTTCAAAAGTCTGAGTGAAGCTGAACAAACCAGAGATTTCATGGCCA
ATTTCATGTATGCAAGATTGTTTAGTTGGATAGTCAGCAACATTAACACT
TTCTTGAACCCTGGCGAACCAAAAAAGAAACAATCTGAGCATGTGCATGT
TggatttcttgatatttttgggTTTGAAGATTTCCAGAAAAACACACTAG
AACAATTGTGTATTAACACCACAAATGAACAGATTAATTTGCACTTTATA
CAACACGTCTTTGCACGGGAACAGgttgatTACCAAGAAGAAGGGCTTTC
AGAATTACAATTAGTGGAATATTTTGATAACAAGAATATTGTTAATCTTC
TCCTTGAGACACCTCACGGCATCTTTGCATTATTGGAGGAAGAAAGCAAA
TGTTTGCAAGCAGATGATCAGACGCTTGTCTCTTCTTTCAATGCTCATTG
TTCAGAATTGAAGTTCTATATTCCGTCCACCGCAAACGCATCCACTTTCA
GTATCGTACActacaataaaaaaGTAACTTACGCAGCAGATGACTTCATT
TTGAGGAATAATGCAAAACTTGATGGCTGTCTGATTGAATGTTTAAGAGG
TTCAAAGGGACAGTTAACGAGTACTCTATTCAACTCGTCCTTAACCAAGA
CAGGAGCACTAATCATCAAgCAAGGACATGGTACAGTGAATTGTTGCCAA
GGGGATCTTCGAGGGGCTTACACCAAACGTATTAATCATAGGTTAAAGAA
AGAGGGGAAATGCAATACGAGCAAAGCTTGCCACAACACGAAGAGCAAGC
AACGCACATTCACCGCtagaaaacataaaaataattcaGTTGCCGTTCAG
TTCAGGAACTCGTTAGTGGATTTGATAGAGACCATCCTGCTATGTCAGGC
TCATTTCGTCAGGTGCATAAAGCCGAACAAAGTAAAAGAAGCAGATAACT
TTGACGTGGATTTTGTTAGAGCTCAAATCAAATGCAACGGCATCCTGGAT
TCCGTTCGTATTCGCAAAGACGGTTTTCCTGTTCGGCTGCCGTTCAAAAT
CTTTGTGGAGAGaTATCGTTTTGTGAAATTTGATATGACGTCACCATTGG
AGAACACTGGAGAAATATGTCAACAGATTCTTCAACATTGCAACATTGAT
GACGGCTACAAGATTGGTGCCACCAGgGTGTTGCTTCGCCTTGAGCACGT
ACAGAAATTGTTATCCTCACTTGATGAACAAACTCGAAGAATCGTCATCG
CGCAGAAAATGGTAAGAGGAAAATTAGCGCGCATCGATTTTGATTTCTTA
CAAACGTCACGCAAACAAGAAGATCGAAACGTCGGCAATTTGTTGGTCTC
GATCTCATCACGCAGCAGCAAGATGCATGACAATCTCTTGATATTGAACG
ATTACGATTTGAAGCGACATCAACGTGTTAAAGATAAGGAGATGAAGAAA
GAAATTGAGAAGGAGAACTTCATCCAAAAACGCAAATTGACGAGTGCCAC
AGATCCTGAATTGAAACTTCGTGAAAGTCAACAACGACCCGCCCCTGAAA
ACTCACCAAACAGAAAGGTTCCACGCAACAAACAACGCACACAAACAGAA
CCATTGATTCGCAACTTCATCTCGGGTCCACAATCAGCATGGTGTATGGT
CAAATGCTACGAACGCCAATTCCACATTGCATCTTTCCAAATGGAAGAAG
CTGTCATTTGTGTTGACGGCACACACACATTCAGTGATAAAAACCGCATC
GCCTTTGCCACCCTCCCCGTACGGGCGGACGATCCAAAAGTCGCCAAAGT
GAAAAGTTGTATCGGGAAAGGAGTCCAGTTACACCAAGACGAGCGACAAA
ACTTGTGGGCTACGCGACTTGGTAAAAACCCTATATTTGTGCGTGGTCAT
ACCTTATGTCCAGAACTGGTCAAACTGAACGGCAAACTTACGCAAGGCGT
ACCCATGAAAGTGTTAGATACGGCCGCTTTCAAGGATTACATGCGTGAAG
AAGTTGAGAAAAATGGCGGCGTCACTGAAGACCTCAAAGATCGAATCATG
TCTAAACTGAAGATTTGCATGAGTTTCATCAAAGATACACACTTAGACGA
AGAAACGCCGTGTTGGTTCGAAATTTGGCTTGTCAAAGTCAAGGAGCATG
TTAGACGTTACCTTGACAACCAACAGAAACGAGAGAAACGAAAATCAGGA
CATTTAGACATGCGTATTACACAAACACAAGAATCCGTTAAACGAATTGC
AGCCATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATCATTTACGTAGAC
CACGAAGTAATACGGCAGGCCCGAATCCTGCCGAAACGACGGGAAAACCG
GCCCGTTCATCAAGACCGCCGTCACAAATAATCGGCGAAAAATCCATCGC
ACGTCATCGAGGGACGACATCAGCAGACACAACGGCGCAATGGCGTGTGG
AACAAAAGATTACGCAAGAAATGTTACAACGTGAACGTAGTATGGACATG
ATTCGACGTGAGAAAAGCATGGACGTACGGCTGGAGTCGCGACTTTTAAT
GGAACGCGAATATCGAAACAGTATGGGAAAACCTTTAGTTGAATCTCAAC
ACGTGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCA
CCGCAATCACTGGCCCGTAGTACGGGAAGCAGTATGGGATCACGTAAAGA
CAATTCGACCACAGCCAACGATTCCCCTCGTATAGTTAACGGTCCACATA
CGCCCGTTTCACGTATGCCCGCCCACTCTCAACAAAATCCTCATGAAGAA
TTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAATGAGTTATCG
ACAAGTATTTGGACTTCAATCATCAGACTATTTATTTAACGTGACGCCGC
CTAATTACACGCGCCATCGACGTTTCTCAGACTCAGATACTGAATCCCTt
cacaatttcaatttcatacaCAAAGTAATCACACAACCTTCAACGCCCAC
TCACCAATCCACCCAACAATTAACAAACGCCCAACAAACGCCCTCCCAAC
AAACAGAAGATCCGAAGAAATCGAAAGTACTTCAACAACCGAAAAGttgg
atgaaaaaagtacgACGAAAGTCGGAAGATAATCCAAAACGAAAAGTTGT
AGCGCAACTTTCTAACAAATAAATGGATTTGAACGACTTATGTGACCTTG
AAAATCCTGATGATGATGTTATTGTTGACGCTATCAAAAAGAGATATGAG
TGTGGGTATTTCTATACTTGTATTGGAGATATTCTCATCTCAATCAACCC
ATACAAAGAGTCCATCTTGAATTCGCTTGAGGTATCACACAGATATAAAG
ATGAACCTTCTCTTACGCAAACCAACCCACATGTCTTTGGTACCACAAAC
AATTTATATCATTTCCTCAATGTCAACAAAGAAAGTCAATGCTTCATCGT
CTCTGGTGAATCTGGTTCTGGAAAAAGTGAAGTCATTCATCAAGCTGTCA
CACATTTTTTATGTCTAGTTTCAACGTCTGATAGGAGTTTCAAAGAAAGA
ATTTTACAGGCAAATGTAATTCTGGAAGCTTTTGGAAATGCACGGACAAG
TTTAAATTCAAATGCAACaagattttgcaaatatttaaaGTTCCATTTCG
ATAGCAAGTTACATCTATCCGGAGTATCAATCACAGATTATTTGCTTGAG
TTGCCGAGAGTTTCAAATCAAAGACAGGGAGAAGCAAATTTCAATATCTT
TTATTACATGTTTTCTGGGCGAACCGAAGATGAGCTATCAAAACAATTAC
TTGATACCCCTACACAACACAAATATTTGAAGTATGGTGAGTTTTTTGGG
GATGATTTACTTTCTTGGAGTCAGGCTTATGAAAGTCTTATTGATGCATT
TCAAGTTGTCGGCTTCACACAAGAGactgTCAAAGAGATATTTGGTATTT
TGTCAGCCATTTTGAATATAGGTGATTTGAAGTTCAAATGTGAAGACGAA
ACAACAGGTGTTTTTGTGGACAATCTAGAAATACTTGATAAAGtTTCTAT
TCTACTTGGAGTGgacacaagcgatttggaactTTGTTTAACCAGTAATT
TGTTTGTGAAACCAgATGATGGTGTTTCTGGCTTCAAAAGTCTGAGTGAA
GCTGAACAAACCAGAGATTTCATGGCCAATTTCATGTATGCAAGATTGTT
TAGTTGGATAGTCAGCAACATTAACACTTTCTTGAACCCTGGCGAACCAA
AAAAGAAACAATCTGAGCATGTGCATGTTggatttcttgatatttttggg
TTTGAAGATTTCCAGAAAAACACACTAGAACAATTGTGTATTAACACCAC
AAATGAACAGATTAATTTGCACTTTATACAACACGTCTTTGCACGGGAAC
AGgttgatTACCAAGAAGAAGGGCTTTCAGAATTACAATTAGTGGAATAT
TTTGATAACAAGAATATTGTTAATCTTCTCCTTGAGACACCTCACGGCAT
CTTTGCATTATTGGAGGAAGAAAGCAAATGTTTGCAAGCAGATGATCAGA
CGCTTGTCTCTTCTTTCAATGCTCATTGTTCAGAATTGAAGTTCTATATT
CCGTCCACCGCAAACGCATCCACTTTCAGTATCGTACActacaataaaaa
aGTAACTTACGCAGCAGATGACTTCATTTTGAGGAATAATGCAAAACTTG
ATGGCTGTCTGATTGAATGTTTAAGAGGTTCAAAGGGACAGTTAACGAGT
ACTCTATTCAACTCGTCCTTAACCAAGACAGGAGCACTAATCATCAAgCA
AGGACATGGTACAGTGAATTGTTGCCAAGGGGATCTTCGAGGGGCTTACA
CCAAACGTATTAATCATAGGTTAAAGAAAGAGGGGAAATGCAATACGAGC
AAAGCTTGCCACAACACGAAGAGCAAGCAACGCACATTCACCGCtagaaa
acataaaaataattcaGTTGCCGTTCAGTTCAGGAACTCGTTAGTGGATT
TGATAGAGACCATCCTGCTATGTCAGGCTCATTTCGTCAGGTGCATAAAG
CCGAACAAAGTAAAAGAAGCAGATAACTTTGACGTGGATTTTGTTAGAGC
TCAAATCAAATGCAACGGCATCCTGGATTCCGTTCGTATTCGCAAAGACG
GTTTTCCTGTTCGGCTGCCGTTCAAAATCTTTGTGGAGAGaTATCGTTTT
GTGAAATTTGATATGACGTCACCATTGGAGAACACTGGAGAAATATGTCA
ACAGATTCTTCAACATTGCAACATTGATGACGGCTACAAGATTGGTGCCA
CCAGgGTGTTGCTTCGCCTTGAGCACGTACAGAAATTGTTATCCTCACTT
GATGAACAAACTCGAAGAATCGTCATCGCGCAGAAAATGGTAAGAGGAAA
ATTAGCGCGCATCGATTTTGATTTCTTACAAACGTCACGCAAACAAGAAG
ATCGAAACGTCGGCAATTTGTTGGTCTCGATCTCATCACGCAGCAGCAAG
ATGCATGACAATCTCTTGATATTGAACGATTACGATTTGAAGCGACATCA
ACGTGTTAAAGATAAGGAGATGAAGAAAGAAATTGAGAAGGAGAACTTCA
TCCAAAAACGCAAATTGACGAGTGCCACAGATCCTGAATTGAAACTTCGT
GAAAGTCAACAACGACCCGCCCCTGAAAACTCACCAAACAGAAAGGTTCC
ACGCAACAAACAACGCACACAAACAGAACCATTGATTCGCAACTTCATCT
CGGGTCCACAATCAGCATGGTGTATGGTCAAATGCTACGAACGCCAATTC
CACATTGCATCTTTCCAAATGGAAGAAGCTGTCATTTGTGTTGACGGCAC
ACACACATTCAGTGATAAAAACCGCATCGCCTTTGCCACCCTCCCCGTAC
GGGCGGACGATCCAAAAGTCGCCAAAGTGAAAAGTTGTATCGGGAAAGGA
GTCCAGTTACACCAAGACGAGCGACAAAACTTGTGGGCTACGCGACTTGG
TAAAAACCCTATATTTGTGCGTGGTCATACCTTATGTCCAGAACTGGTCA
AACTGAACGGCAAACTTACGCAAGGCGTACCCATGAAAGTGTTAGATACG
GCCGCTTTCAAGGATTACATGCGTGAAGAAGTTGAGAAAAATGGCGGCGT
CACTGAAGACCTCAAAGATCGAATCATGTCTAAACTGAAGATTTGCATGA
GTTTCATCAAAGATACACACTTAGACGAAGAAACGCCGTGTTGGTTCGAA
ATTTGGCTTGTCAAAGTCAAGGAGCATGTTAGACGTTACCTTGACAACCA
ACAGAAACGAGAGAAACGAAAATCAGGACATTTAGACATGCGTATTACAC
AAACACAAGAATCCGTTAAACGAATTGCAGCCATGCCTGAAATGAGGCGC
GCTAAAAGCGGTGATCATTTACGTAGACCACGAAGTAATACGGCAGGCCC
GAATCCTGCCGAAACGACGGGAAAACCGGCCCGTTCATCAAGACCGCCGT
CACAAATAATCGGCGAAAAATCCATCGCACGTCATCGAGGGACGACATCA
GCAGACACAACGGCGCAATGGCGTGTGGAACAAAAGATTACGCAAGAAAT
GTTACAACGTGAACGTAGTATGGACATGATTCGACGTGAGAAAAGCATGG
ACGTACGGCTGGAGTCGCGACTTTTAATGGAACGCGAATATCGAAACAGT
ATGGGAAAACCTTTAGTTGAATCTCAACACGTGAACAGAGTGAGGGGTAG
CGAGAAAAGTAGCCCCGGTCAAAGTCCACCGCAATCACTGGCCCGTAGTA
CGGGAAGCAGTATGGGATCACGTAAAGACAATTCGACCACAGCCAACGAT
TCCCCTCGTATAGTTAACGGTCCACATACGCCCGTTTCACGTATGCCCGC
CCACTCTCAACAAAATCCTCATGAAGAATTTCGAAGGGGCGGAAGTGTGG
CGGCTGCCCGTGAAGGAATGAGTTATCGACAAGTATTTGGACTTCAATCA
TCAGACTATTTATTTAACGTGACGCCGCCTAATTACACGCGCCATCGACG
TTTCTCAGACTCAGATACTGAATCCCTtcacaatttcaatttcatacaCA
AAGTAATCACACAACCTTCAACGCCCACTCACCAATCCACCCAACAATTA
ACAAACGCCCAACAAACGCCCTCCCAACAAACAGAAGATCCGAAGAAATC
GAAAGTACTTCAACAACCGAAAAGttggatgaaaaaagtacgACGAAAGT
CGGAAGATAATCCAAAACGAAAAGTTGTAGCGCAACTTTCTAACAAATAA
ATGGATTTGAACGACTTATGTGACCTTGAAAATCCTGATGATGATGTTAT
TGTTGACGCTATCAAAAAGAGATATGAGTGTGGGTATTTCTATACTTGTA
TTGGAGATATTCTCATCTCAATCAACCCATACAAAGAGTCCATCTTGAAT
TCGCTTGAGGTATCACACAGATATAAAGATGAACCTTCTCTTACGCAAAC
CAACCCACATGTCTTTGGTACCACAAACAATTTATATCATTTCCTCAATG
TCAACAAAGAAAGTCAATGCTTCATCGTCTCTGGTGAATCTGGTTCTGGA
AAAAGTGAAGTCATTCATCAAGCTGTCACACATTTTTTATGTCTAGTTTC
AACGTCTGATAGGAGTTTCAAAGAAAGAATTTTACAGGCAAATGTAATTC
TGGAAGCTTTTGGAAATGCACGGACAAGTTTAAATTCAAATGCAACaaga
ttttgcaaatatttaaaGTTCCATTTCGATAGCAAGTTACATCTATCCGG
AGTATCAATCACAGATTATTTGCTTGAGTTGCCGAGAGTTTCAAATCAAA
GACAGGGAGAAGCAAATTTCAATATCTTTTATTACATGTTTTCTGGGCGA
ACCGAAGATGAGCTATCAAAACAATTACTTGATACCCCTACACAACACAA
ATATTTGAAGTATGGTGAGTTTTTTGGGGATGATTTACTTTCTTGGAGTC
AGGCTTATGAAAGTCTTATTGATGCATTTCAAGTTGTCGGCTTCACACAA
GAGactgTCAAAGAGATATTTGGTATTTTGTCAGCCATTTTGAATATAGG
TGATTTGAAGTTCAAATGTGAAGACGAAACAACAGGTGTTTTTGTGGACA
ATCTAGAAATACTTGATAAAGtTTCTATTCTACTTGGAGTGgacacaagc
gatttggaactTTGTTTAACCAGTAATTTGTTTGTGAAACCAgATGATGG
TGTTTCTGGCTTCAAAAGTCTGAGTGAAGCTGAACAAACCAGAGATTTCA
TGGCCAATTTCATGTATGCAAGATTGTTTAGTTGGATAGTCAGCAACATT
AACACTTTCTTGAACCCTGGCGAACCAAAAAAGAAACAATCTGAGCATGT
GCATGTTggatttcttgatatttttgggTTTGAAGATTTCCAGAAAAACA
CACTAGAACAATTGTGTATTAACACCACAAATGAACAGATTAATTTGCAC
TTTATACAACACGTCTTTGCACGGGAACAGgttgatTACCAAGAAGAAGG
GCTTTCAGAATTACAATTAGTGGAATATTTTGATAACAAGAATATTGTTA
ATCTTCTCCTTGAGACACCTCACGGCATCTTTGCATTATTGGAGGAAGAA
AGCAAATGTTTGCAAGCAGATGATCAGACGCTTGTCTCTTCTTTCAATGC
TCATTGTTCAGAATTGAAGTTCTATATTCCGTCCACCGCAAACGCATCCA
CTTTCAGTATCGTACActacaataaaaaaGTAACTTACGCAGCAGATGAC
TTCATTTTGAGGAATAATGCAAAACTTGATGGCTGTCTGATTGAATGTTT
AAGAGGTTCAAAGGGACAGTTAACGAGTACTCTATTCAACTCGTCCTTAA
CCAAGACAGGAGCACTAATCATCAAgCAAGGACATGGTACAGTGAATTGT
TGCCAAGGGGATCTTCGAGGGGCTTACACCAAACGTATTAATCATAGGTT
AAAGAAAGAGGGGAAATGCAATACGAGCAAAGCTTGCCACAACACGAAGA
GCAAGCAACGCACATTCACCGCtagaaaacataaaaataattcaGTTGCC
GTTCAGTTCAGGAACTCGTTAGTGGATTTGATAGAGACCATCCTGCTATG
TCAGGCTCATTTCGTCAGGTGCATAAAGCCGAACAAAGTAAAAGAAGCAG
ATAACTTTGACGTGGATTTTGTTAGAGCTCAAATCAAATGCAACGGCATC
CTGGATTCCGTTCGTATTCGCAAAGACGGTTTTCCTGTTCGGCTGCCGTT
CAAAATCTTTGTGGAGAGaTATCGTTTTGTGAAATTTGATATGACGTCAC
CATTGGAGAACACTGGAGAAATATGTCAACAGATTCTTCAACATTGCAAC
ATTGATGACGGCTACAAGATTGGTGCCACCAGgGTGTTGCTTCGCCTTGA
GCACGTACAGAAATTGTTATCCTCACTTGATGAACAAACTCGAAGAATCG
TCATCGCGCAGAAAATGGTAAGAGGAAAATTAGCGCGCATCGATTTTGAT
TTCTTACAAACGTCACGCAAACAAGAAGATCGAAACGTCGGCAATTTGTT
GGTCTCGATCTCATCACGCAGCAGCAAGATGCATGACAATCTCTTGATAT
TGAACGATTACGATTTGAAGCGACATCAACGTGTTAAAGATAAGGAGATG
AAGAAAGAAATTGAGAAGGAGAACTTCATCCAAAAACGCAAATTGACGAG
TGCCACAGATCCTGAATTGAAACTTCGTGAAAGTCAACAACGACCCGCCC
CTGAAAACTCACCAAACAGAAAGGTTCCACGCAACAAACAACGCACACAA
ACAGAACCATTGATTCGCAACTTCATCTCGGGTCCACAATCAGCATGGTG
TATGGTCAAATGCTACGAACGCCAATTCCACATTGCATCTTTCCAAATGG
AAGAAGCTGTCATTTGTGTTGACGGCACACACACATTCAGTGATAAAAAC
CGCATCGCCTTTGCCACCCTCCCCGTACGGGCGGACGATCCAAAAGTCGC
CAAAGTGAAAAGTTGTATCGGGAAAGGAGTCCAGTTACACCAAGACGAGC
GACAAAACTTGTGGGCTACGCGACTTGGTAAAAACCCTATATTTGTGCGT
GGTCATACCTTATGTCCAGAACTGGTCAAACTGAACGGCAAACTTACGCA
AGGCGTACCCATGAAAGTGTTAGATACGGCCGCTTTCAAGGATTACATGC
GTGAAGAAGTTGAGAAAAATGGCGGCGTCACTGAAGACCTCAAAGATCGA
ATCATGTCTAAACTGAAGATTTGCATGAGTTTCATCAAAGATACACACTT
AGACGAAGAAACGCCGTGTTGGTTCGAAATTTGGCTTGTCAAAGTCAAGG
AGCATGTTAGACGTTACCTTGACAACCAACAGAAACGAGAGAAACGAAAA
TCAGGACATTTAGACATGCGTATTACACAAACACAAGAATCCGTTAAACG
AATTGCAGCCATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATCATTTAC
GTAGACCACGAAGTAATACGGCAGGCCCGAATCCTGCCGAAACGACGGGA
AAACCGGCCCGTTCATCAAGACCGCCGTCACAAATAATCGGCGAAAAATC
CATCGCACGTCATCGAGGGACGACATCAGCAGACACAACGGCGCAATGGC
GTGTGGAACAAAAGATTACGCAAGAAATGTTACAACGTGAACGTAGTATG
GACATGATTCGACGTGAGAAAAGCATGGACGTACGGCTGGAGTCGCGACT
TTTAATGGAACGCGAATATCGAAACAGTATGGGAAAACCTTTAGTTGAAT
CTCAACACGTGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCCGGTCAA
AGTCCACCGCAATCACTGGCCCGTAGTACGGGAAGCAGTATGGGATCACG
TAAAGACAATTCGACCACAGCCAACGATTCCCCTCGTATAGTTAACGGTC
CACATACGCCCGTTTCACGTATGCCCGCCCACTCTCAACAAAATCCTCAT
GAAGAATTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGGAATGAG
TTATCGACAAGTATTTGGACTTCAATCATCAGACTATTTATTTAACGTGA
CGCCGCCTAATTACACGCGCCATCGACGTTTCTCAGACTCAGATACTGAA
TCCCTtcacaatttcaatttcatacaCAAAGTAATCACACAACCTTCAAC
GCCCACTCACCAATCCACCCAACAATTAACAAACGCCCAACAAACGCCCT
CCCAACAAACAGAAGATCCGAAGAAATCGAAAGTACTTCAACAACCGAAA
AGttggatgaaaaaagtacgACGAAAGTCGGAAGATAATCCAAAACGAAA
AGTTGTAGCGCAACTTTCTAACAAATAAATGGATTTGAACGACTTATGTG
ACCTTGAAAATCCTGATGATGATGTTATTGTTGACGCTATCAAAAAGAGA
TATGAGTGTGGGTATTTCTATACTTGTATTGGAGATATTCTCATCTCAAT
CAACCCATACAAAGAGTCCATCTTGAATTCGCTTGAGGTATCACACAGAT
ATAAAGATGAACCTTCTCTTACGCAAACCAACCCACATGTCTTTGGTACC
ACAAACAATTTATATCATTTCCTCAATGTCAACAAAGAAAGTCAATGCTT
CATCGTCTCTGGTGAATCTGGTTCTGGAAAAAGTGAAGTCATTCATCAAG
CTGTCACACATTTTTTATGTCTAGTTTCAACGTCTGATAGGAGTTTCAAA
GAAAGAATTTTACAGGCAAATGTAATTCTGGAAGCTTTTGGAAATGCACG
GACAAGTTTAAATTCAAATGCAACaagattttgcaaatatttaaaGTTCC
ATTTCGATAGCAAGTTACATCTATCCGGAGTATCAATCACAGATTATTTG
CTTGAGTTGCCGAGAGTTTCAAATCAAAGACAGGGAGAAGCAAATTTCAA
TATCTTTTATTACATGTTTTCTGGGCGAACCGAAGATGAGCTATCAAAAC
AATTACTTGATACCCCTACACAACACAAATATTTGAAGTATGGTGAGTTT
TTTGGGGATGATTTACTTTCTTGGAGTCAGGCTTATGAAAGTCTTATTGA
TGCATTTCAAGTTGTCGGCTTCACACAAGAGactgTCAAAGAGATATTTG
GTATTTTGTCAGCCATTTTGAATATAGGTGATTTGAAGTTCAAATGTGAA
GACGAAACAACAGGTGTTTTTGTGGACAATCTAGAAATACTTGATAAAGt
TTCTATTCTACTTGGAGTGgacacaagcgatttggaactTTGTTTAACCA
GTAATTTGTTTGTGAAACCAgATGATGGTGTTTCTGGCTTCAAAAGTCTG
AGTGAAGCTGAACAAACCAGAGATTTCATGGCCAATTTCATGTATGCAAG
ATTGTTTAGTTGGATAGTCAGCAACATTAACACTTTCTTGAACCCTGGCG
AACCAAAAAAGAAACAATCTGAGCATGTGCATGTTggatttcttgatatt
tttgggTTTGAAGATTTCCAGAAAAACACACTAGAACAATTGTGTATTAA
CACCACAAATGAACAGATTAATTTGCACTTTATACAACACGTCTTTGCAC
GGGAACAGgttgatTACCAAGAAGAAGGGCTTTCAGAATTACAATTAGTG
GAATATTTTGATAACAAGAATATTGTTAATCTTCTCCTTGAGACACCTCA
CGGCATCTTTGCATTATTGGAGGAAGAAAGCAAATGTTTGCAAGCAGATG
ATCAGACGCTTGTCTCTTCTTTCAATGCTCATTGTTCAGAATTGAAGTTC
TATATTCCGTCCACCGCAAACGCATCCACTTTCAGTATCGTACActacaa
taaaaaaGTAACTTACGCAGCAGATGACTTCATTTTGAGGAATAATGCAA
AACTTGATGGCTGTCTGATTGAATGTTTAAGAGGTTCAAAGGGACAGTTA
ACGAGTACTCTATTCAACTCGTCCTTAACCAAGACAGGAGCACTAATCAT
CAAgCAAGGACATGGTACAGTGAATTGTTGCCAAGGGGATCTTCGAGGGG
CTTACACCAAACGTATTAATCATAGGTTAAAGAAAGAGGGGAAATGCAAT
ACGAGCAAAGCTTGCCACAACACGAAGAGCAAGCAACGCACATTCACCGC
tagaaaacataaaaataattcaGTTGCCGTTCAGTTCAGGAACTCGTTAG
TGGATTTGATAGAGACCATCCTGCTATGTCAGGCTCATTTCGTCAGGTGC
ATAAAGCCGAACAAAGTAAAAGAAGCAGATAACTTTGACGTGGATTTTGT
TAGAGCTCAAATCAAATGCAACGGCATCCTGGATTCCGTTCGTATTCGCA
AAGACGGTTTTCCTGTTCGGCTGCCGTTCAAAATCTTTGTGGAGAGaTAT
CGTTTTGTGAAATTTGATATGACGTCACCATTGGAGAACACTGGAGAAAT
ATGTCAACAGATTCTTCAACATTGCAACATTGATGACGGCTACAAGATTG
GTGCCACCAGgGTGTTGCTTCGCCTTGAGCACGTACAGAAATTGTTATCC
TCACTTGATGAACAAACTCGAAGAATCGTCATCGCGCAGAAAATGGTAAG
AGGAAAATTAGCGCGCATCGATTTTGATTTCTTACAAACGTCACGCAAAC
AAGAAGATCGAAACGTCGGCAATTTGTTGGTCTCGATCTCATCACGCAGC
AGCAAGATGCATGACAATCTCTTGATATTGAACGATTACGATTTGAAGCG
ACATCAACGTGTTAAAGATAAGGAGATGAAGAAAGAAATTGAGAAGGAGA
ACTTCATCCAAAAACGCAAATTGACGAGTGCCACAGATCCTGAATTGAAA
CTTCGTGAAAGTCAACAACGACCCGCCCCTGAAAACTCACCAAACAGAAA
GGTTCCACGCAACAAACAACGCACACAAACAGAACCATTGATTCGCAACT
TCATCTCGGGTCCACAATCAGCATGGTGTATGGTCAAATGCTACGAACGC
CAATTCCACATTGCATCTTTCCAAATGGAAGAAGCTGTCATTTGTGTTGA
CGGCACACACACATTCAGTGATAAAAACCGCATCGCCTTTGCCACCCTCC
CCGTACGGGCGGACGATCCAAAAGTCGCCAAAGTGAAAAGTTGTATCGGG
AAAGGAGTCCAGTTACACCAAGACGAGCGACAAAACTTGTGGGCTACGCG
ACTTGGTAAAAACCCTATATTTGTGCGTGGTCATACCTTATGTCCAGAAC
TGGTCAAACTGAACGGCAAACTTACGCAAGGCGTACCCATGAAAGTGTTA
GATACGGCCGCTTTCAAGGATTACATGCGTGAAGAAGTTGAGAAAAATGG
CGGCGTCACTGAAGACCTCAAAGATCGAATCATGTCTAAACTGAAGATTT
GCATGAGTTTCATCAAAGATACACACTTAGACGAAGAAACGCCGTGTTGG
TTCGAAATTTGGCTTGTCAAAGTCAAGGAGCATGTTAGACGTTACCTTGA
CAACCAACAGAAACGAGAGAAACGAAAATCAGGACATTTAGACATGCGTA
TTACACAAACACAAGAATCCGTTAAACGAATTGCAGCCATGCCTGAAATG
AGGCGCGCTAAAAGCGGTGATCATTTACGTAGACCACGAAGTAATACGGC
AGGCCCGAATCCTGCCGAAACGACGGGAAAACCGGCCCGTTCATCAAGAC
CGCCGTCACAAATAATCGGCGAAAAATCCATCGCACGTCATCGAGGGACG
ACATCAGCAGACACAACGGCGCAATGGCGTGTGGAACAAAAGATTACGCA
AGAAATGTTACAACGTGAACGTAGTATGGACATGATTCGACGTGAGAAAA
GCATGGACGTACGGCTGGAGTCGCGACTTTTAATGGAACGCGAATATCGA
AACAGTATGGGAAAACCTTTAGTTGAATCTCAACACGTGAACAGAGTGAG
GGGTAGCGAGAAAAGTAGCCCCGGTCAAAGTCCACCGCAATCACTGGCCC
GTAGTACGGGAAGCAGTATGGGATCACGTAAAGACAATTCGACCACAGCC
AACGATTCCCCTCGTATAGTTAACGGTCCACATACGCCCGTTTCACGTAT
GCCCGCCCACTCTCAACAAAATCCTCATGAAGAATTTCGAAGGGGCGGAA
GTGTGGCGGCTGCCCGTGAAGGAATGAGTTATCGACAAGTATTTGGACTT
CAATCATCAGACTATTTATTTAACGTGACGCCGCCTAATTACACGCGCCA
TCGACGTTTCTCAGACTCAGATACTGAATCCCTtcacaatttcaatttca
tacaCAAAGTAATCACACAACCTTCAACGCCCACTCACCAATCCACCCAA
CAATTAACAAACGCCCAACAAACGCCCTCCCAACAAACAGAAGATCCGAA
GAAATCGAAAGTACTTCAACAACCGAAAAGttggatgaaaaaagtacgAC
GAAAGTCGGAAGATAATCCAAAACGAAAAGTTGTAGCGCAACTTTCTAAC
AAATAAATGGATTTGAACGACTTATGTGACCTTGAAAATCCTGATGATGA
TGTTATTGTTGACGCTATCAAAAAGAGATATGAGTGTGGGTATTTCTATA
CTTGTATTGGAGATATTCTCATCTCAATCAACCCATACAAAGAGTCCATC
TTGAATTCGCTTGAGGTATCACACAGATATAAAGATGAACCTTCTCTTAC
GCAAACCAACCCACATGTCTTTGGTACCACAAACAATTTATATCATTTCC
TCAATGTCAACAAAGAAAGTCAATGCTTCATCGTCTCTGGTGAATCTGGT
TCTGGAAAAAGTGAAGTCATTCATCAAGCTGTCACACATTTTTTATGTCT
AGTTTCAACGTCTGATAGGAGTTTCAAAGAAAGAATTTTACAGGCAAATG
TAATTCTGGAAGCTTTTGGAAATGCACGGACAAGTTTAAATTCAAATGCA
ACaagattttgcaaatatttaaaGTTCCATTTCGATAGCAAGTTACATCT
ATCCGGAGTATCAATCACAGATTATTTGCTTGAGTTGCCGAGAGTTTCAA
ATCAAAGACAGGGAGAAGCAAATTTCAATATCTTTTATTACATGTTTTCT
GGGCGAACCGAAGATGAGCTATCAAAACAATTACTTGATACCCCTACACA
ACACAAATATTTGAAGTATGGTGAGTTTTTTGGGGATGATTTACTTTCTT
GGAGTCAGGCTTATGAAAGTCTTATTGATGCATTTCAAGTTGTCGGCTTC
ACACAAGAGactgTCAAAGAGATATTTGGTATTTTGTCAGCCATTTTGAA
TATAGGTGATTTGAAGTTCAAATGTGAAGACGAAACAACAGGTGTTTTTG
TGGACAATCTAGAAATACTTGATAAAGtTTCTATTCTACTTGGAGTGgac
acaagcgatttggaactTTGTTTAACCAGTAATTTGTTTGTGAAACCAgA
TGATGGTGTTTCTGGCTTCAAAAGTCTGAGTGAAGCTGAACAAACCAGAG
ATTTCATGGCCAATTTCATGTATGCAAGATTGTTTAGTTGGATAGTCAGC
AACATTAACACTTTCTTGAACCCTGGCGAACCAAAAAAGAAACAATCTGA
GCATGTGCATGTTggatttcttgatatttttgggTTTGAAGATTTCCAGA
AAAACACACTAGAACAATTGTGTATTAACACCACAAATGAACAGATTAAT
TTGCACTTTATACAACACGTCTTTGCACGGGAACAGgttgatTACCAAGA
AGAAGGGCTTTCAGAATTACAATTAGTGGAATATTTTGATAACAAGAATA
TTGTTAATCTTCTCCTTGAGACACCTCACGGCATCTTTGCATTATTGGAG
GAAGAAAGCAAATGTTTGCAAGCAGATGATCAGACGCTTGTCTCTTCTTT
CAATGCTCATTGTTCAGAATTGAAGTTCTATATTCCGTCCACCGCAAACG
CATCCACTTTCAGTATCGTACActacaataaaaaaGTAACTTACGCAGCA
GATGACTTCATTTTGAGGAATAATGCAAAACTTGATGGCTGTCTGATTGA
ATGTTTAAGAGGTTCAAAGGGACAGTTAACGAGTACTCTATTCAACTCGT
CCTTAACCAAGACAGGAGCACTAATCATCAAgCAAGGACATGGTACAGTG
AATTGTTGCCAAGGGGATCTTCGAGGGGCTTACACCAAACGTATTAATCA
TAGGTTAAAGAAAGAGGGGAAATGCAATACGAGCAAAGCTTGCCACAACA
CGAAGAGCAAGCAACGCACATTCACCGCtagaaaacataaaaataattca
GTTGCCGTTCAGTTCAGGAACTCGTTAGTGGATTTGATAGAGACCATCCT
GCTATGTCAGGCTCATTTCGTCAGGTGCATAAAGCCGAACAAAGTAAAAG
AAGCAGATAACTTTGACGTGGATTTTGTTAGAGCTCAAATCAAATGCAAC
GGCATCCTGGATTCCGTTCGTATTCGCAAAGACGGTTTTCCTGTTCGGCT
GCCGTTCAAAATCTTTGTGGAGAGaTATCGTTTTGTGAAATTTGATATGA
CGTCACCATTGGAGAACACTGGAGAAATATGTCAACAGATTCTTCAACAT
TGCAACATTGATGACGGCTACAAGATTGGTGCCACCAGgGTGTTGCTTCG
CCTTGAGCACGTACAGAAATTGTTATCCTCACTTGATGAACAAACTCGAA
GAATCGTCATCGCGCAGAAAATGGTAAGAGGAAAATTAGCGCGCATCGAT
TTTGATTTCTTACAAACGTCACGCAAACAAGAAGATCGAAACGTCGGCAA
TTTGTTGGTCTCGATCTCATCACGCAGCAGCAAGATGCATGACAATCTCT
TGATATTGAACGATTACGATTTGAAGCGACATCAACGTGTTAAAGATAAG
GAGATGAAGAAAGAAATTGAGAAGGAGAACTTCATCCAAAAACGCAAATT
GACGAGTGCCACAGATCCTGAATTGAAACTTCGTGAAAGTCAACAACGAC
CCGCCCCTGAAAACTCACCAAACAGAAAGGTTCCACGCAACAAACAACGC
ACACAAACAGAACCATTGATTCGCAACTTCATCTCGGGTCCACAATCAGC
ATGGTGTATGGTCAAATGCTACGAACGCCAATTCCACATTGCATCTTTCC
AAATGGAAGAAGCTGTCATTTGTGTTGACGGCACACACACATTCAGTGAT
AAAAACCGCATCGCCTTTGCCACCCTCCCCGTACGGGCGGACGATCCAAA
AGTCGCCAAAGTGAAAAGTTGTATCGGGAAAGGAGTCCAGTTACACCAAG
ACGAGCGACAAAACTTGTGGGCTACGCGACTTGGTAAAAACCCTATATTT
GTGCGTGGTCATACCTTATGTCCAGAACTGGTCAAACTGAACGGCAAACT
TACGCAAGGCGTACCCATGAAAGTGTTAGATACGGCCGCTTTCAAGGATT
ACATGCGTGAAGAAGTTGAGAAAAATGGCGGCGTCACTGAAGACCTCAAA
GATCGAATCATGTCTAAACTGAAGATTTGCATGAGTTTCATCAAAGATAC
ACACTTAGACGAAGAAACGCCGTGTTGGTTCGAAATTTGGCTTGTCAAAG
TCAAGGAGCATGTTAGACGTTACCTTGACAACCAACAGAAACGAGAGAAA
CGAAAATCAGGACATTTAGACATGCGTATTACACAAACACAAGAATCCGT
TAAACGAATTGCAGCCATGCCTGAAATGAGGCGCGCTAAAAGCGGTGATC
ATTTACGTAGACCACGAAGTAATACGGCAGGCCCGAATCCTGCCGAAACG
ACGGGAAAACCGGCCCGTTCATCAAGACCGCCGTCACAAATAATCGGCGA
AAAATCCATCGCACGTCATCGAGGGACGACATCAGCAGACACAACGGCGC
AATGGCGTGTGGAACAAAAGATTACGCAAGAAATGTTACAACGTGAACGT
AGTATGGACATGATTCGACGTGAGAAAAGCATGGACGTACGGCTGGAGTC
GCGACTTTTAATGGAACGCGAATATCGAAACAGTATGGGAAAACCTTTAG
TTGAATCTCAACACGTGAACAGAGTGAGGGGTAGCGAGAAAAGTAGCCCC
GGTCAAAGTCCACCGCAATCACTGGCCCGTAGTACGGGAAGCAGTATGGG
ATCACGTAAAGACAATTCGACCACAGCCAACGATTCCCCTCGTATAGTTA
ACGGTCCACATACGCCCGTTTCACGTATGCCCGCCCACTCTCAACAAAAT
CCTCATGAAGAATTTCGAAGGGGCGGAAGTGTGGCGGCTGCCCGTGAAGG
AATGAGTTATCGACAAGTATTTGGACTTCAATCATCAGACTATTTATTTA
ACGTGACGCCGCCTAATTACACGCGCCATCGACGTTTCTCAGACTCAGAT
ACTGAATCCCTtcacaatttcaatttcatacaCAAAGTAATCACACAACC
TTCAACGCCCACTCACCAATCCACCCAACAATTAACAAACGCCCAACAAA
CGCCCTCCCAACAAACAGAAGATCCGAAGAAATCGAAAGTACTTCAACAA
CCGAAAAGttggatgaaaaaagtacgACGAAAGTCGGAAGATAATCCAAA
ACGAAAAGTTGTAGCGCAACTTTCTAACAAATAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000041XLOC_000041Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000078-proteinTCONS_00000078-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000078-exon-sc0000001-1491911889:1683867..1684103TCONS_00000078-exon-sc0000001-1491911889:1683867..1684103Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1683867..1684103TCONS_00000078-exon-sc0000001-1510915933:1683867..1684103Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1683867..1684103TCONS_00000078-exon-sc0000001-1575043694:1683867..1684103Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1687904..1687969TCONS_00000078-exon-sc0000001-1491911889:1687904..1687969Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1687904..1687969TCONS_00000078-exon-sc0000001-1510915933:1687904..1687969Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1687904..1687969TCONS_00000078-exon-sc0000001-1575043694:1687904..1687969Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1690162..1690389TCONS_00000078-exon-sc0000001-1491911889:1690162..1690389Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1690162..1690389TCONS_00000078-exon-sc0000001-1510915933:1690162..1690389Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1690162..1690389TCONS_00000078-exon-sc0000001-1575043694:1690162..1690389Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1690655..1690769TCONS_00000078-exon-sc0000001-1491911889:1690655..1690769Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1690655..1690769TCONS_00000078-exon-sc0000001-1510915933:1690655..1690769Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1690655..1690769TCONS_00000078-exon-sc0000001-1575043694:1690655..1690769Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1691052..1691104TCONS_00000078-exon-sc0000001-1491911889:1691052..1691104Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1691052..1691104TCONS_00000078-exon-sc0000001-1510915933:1691052..1691104Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1691052..1691104TCONS_00000078-exon-sc0000001-1575043694:1691052..1691104Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1691234..1691328TCONS_00000078-exon-sc0000001-1491911889:1691234..1691328Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1691234..1691328TCONS_00000078-exon-sc0000001-1510915933:1691234..1691328Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1691234..1691328TCONS_00000078-exon-sc0000001-1575043694:1691234..1691328Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1692594..1692696TCONS_00000078-exon-sc0000001-1491911889:1692594..1692696Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1692594..1692696TCONS_00000078-exon-sc0000001-1510915933:1692594..1692696Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1692594..1692696TCONS_00000078-exon-sc0000001-1575043694:1692594..1692696Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1693135..1693252TCONS_00000078-exon-sc0000001-1491911889:1693135..1693252Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1693135..1693252TCONS_00000078-exon-sc0000001-1510915933:1693135..1693252Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1693135..1693252TCONS_00000078-exon-sc0000001-1575043694:1693135..1693252Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1694057..1694128TCONS_00000078-exon-sc0000001-1491911889:1694057..1694128Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1694057..1694128TCONS_00000078-exon-sc0000001-1510915933:1694057..1694128Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1694057..1694128TCONS_00000078-exon-sc0000001-1575043694:1694057..1694128Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1694238..1694379TCONS_00000078-exon-sc0000001-1491911889:1694238..1694379Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1694238..1694379TCONS_00000078-exon-sc0000001-1510915933:1694238..1694379Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1694238..1694379TCONS_00000078-exon-sc0000001-1575043694:1694238..1694379Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1694949..1695093TCONS_00000078-exon-sc0000001-1491911889:1694949..1695093Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1694949..1695093TCONS_00000078-exon-sc0000001-1510915933:1694949..1695093Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1694949..1695093TCONS_00000078-exon-sc0000001-1575043694:1694949..1695093Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1695630..1695713TCONS_00000078-exon-sc0000001-1491911889:1695630..1695713Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1695630..1695713TCONS_00000078-exon-sc0000001-1510915933:1695630..1695713Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1695630..1695713TCONS_00000078-exon-sc0000001-1575043694:1695630..1695713Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1696227..1696391TCONS_00000078-exon-sc0000001-1491911889:1696227..1696391Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1696227..1696391TCONS_00000078-exon-sc0000001-1510915933:1696227..1696391Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1696227..1696391TCONS_00000078-exon-sc0000001-1575043694:1696227..1696391Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1697115..1697190TCONS_00000078-exon-sc0000001-1491911889:1697115..1697190Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1697115..1697190TCONS_00000078-exon-sc0000001-1510915933:1697115..1697190Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1697115..1697190TCONS_00000078-exon-sc0000001-1575043694:1697115..1697190Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1697556..1697625TCONS_00000078-exon-sc0000001-1491911889:1697556..1697625Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1697556..1697625TCONS_00000078-exon-sc0000001-1510915933:1697556..1697625Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1697556..1697625TCONS_00000078-exon-sc0000001-1575043694:1697556..1697625Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1697930..1698001TCONS_00000078-exon-sc0000001-1491911889:1697930..1698001Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1697930..1698001TCONS_00000078-exon-sc0000001-1510915933:1697930..1698001Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1697930..1698001TCONS_00000078-exon-sc0000001-1575043694:1697930..1698001Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1698576..1698614TCONS_00000078-exon-sc0000001-1491911889:1698576..1698614Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1698576..1698614TCONS_00000078-exon-sc0000001-1510915933:1698576..1698614Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1698576..1698614TCONS_00000078-exon-sc0000001-1575043694:1698576..1698614Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1698883..1698958TCONS_00000078-exon-sc0000001-1491911889:1698883..1698958Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1698883..1698958TCONS_00000078-exon-sc0000001-1510915933:1698883..1698958Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1698883..1698958TCONS_00000078-exon-sc0000001-1575043694:1698883..1698958Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1699305..1699360TCONS_00000078-exon-sc0000001-1491911889:1699305..1699360Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1699305..1699360TCONS_00000078-exon-sc0000001-1510915933:1699305..1699360Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1699305..1699360TCONS_00000078-exon-sc0000001-1575043694:1699305..1699360Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1699611..1699760TCONS_00000078-exon-sc0000001-1491911889:1699611..1699760Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1699611..1699760TCONS_00000078-exon-sc0000001-1510915933:1699611..1699760Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1699611..1699760TCONS_00000078-exon-sc0000001-1575043694:1699611..1699760Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1700224..1700338TCONS_00000078-exon-sc0000001-1491911889:1700224..1700338Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1700224..1700338TCONS_00000078-exon-sc0000001-1510915933:1700224..1700338Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1700224..1700338TCONS_00000078-exon-sc0000001-1575043694:1700224..1700338Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1700780..1700861TCONS_00000078-exon-sc0000001-1491911889:1700780..1700861Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1700780..1700861TCONS_00000078-exon-sc0000001-1510915933:1700780..1700861Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1700780..1700861TCONS_00000078-exon-sc0000001-1575043694:1700780..1700861Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1716666..1716757TCONS_00000078-exon-sc0000001-1491911889:1716666..1716757Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1716666..1716757TCONS_00000078-exon-sc0000001-1510915933:1716666..1716757Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1716666..1716757TCONS_00000078-exon-sc0000001-1575043694:1716666..1716757Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1729754..1729840TCONS_00000078-exon-sc0000001-1491911889:1729754..1729840Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1729754..1729840TCONS_00000078-exon-sc0000001-1510915933:1729754..1729840Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1729754..1729840TCONS_00000078-exon-sc0000001-1575043694:1729754..1729840Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1737297..1737425TCONS_00000078-exon-sc0000001-1491911889:1737297..1737425Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1737297..1737425TCONS_00000078-exon-sc0000001-1510915933:1737297..1737425Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1737297..1737425TCONS_00000078-exon-sc0000001-1575043694:1737297..1737425Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1743361..1743855TCONS_00000078-exon-sc0000001-1491911889:1743361..1743855Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1743361..1743855TCONS_00000078-exon-sc0000001-1510915933:1743361..1743855Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1743361..1743855TCONS_00000078-exon-sc0000001-1575043694:1743361..1743855Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1744164..1744257TCONS_00000078-exon-sc0000001-1491911889:1744164..1744257Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1744164..1744257TCONS_00000078-exon-sc0000001-1510915933:1744164..1744257Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1744164..1744257TCONS_00000078-exon-sc0000001-1575043694:1744164..1744257Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1491911889:1744470..1745865TCONS_00000078-exon-sc0000001-1491911889:1744470..1745865Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1510915933:1744470..1745865TCONS_00000078-exon-sc0000001-1510915933:1744470..1745865Clytia hemisphaericaexon
TCONS_00000078-exon-sc0000001-1575043694:1744470..1745865TCONS_00000078-exon-sc0000001-1575043694:1744470..1745865Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1683867..1745865 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
12.9149 12.9232 3.53885 2.68143 9.40598 7.46521 9.87574 11.3957 6.24579 7.82208 7.40741 5.74973 7.97042 7.94157 7.25309 10.6167 8.97803 9.79047 4.9989 7.12322 7.53951 8.67595 8.68946 11.3677 12.2392 13.4957 12.1849 8.11915 5.76527 6.83032
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001609Myosin_head_motor_dom
IPR001132SMAD_dom_Dwarfin-type
IPR017855SMAD_dom-like
IPR000048IQ_motif_EF-hand-BS
IPR027417P-loop_NTPase
IPR008984SMAD_FHA_domain
Vocabulary: Cellular Component
TermDefinition
GO:0016459myosin complex
GO:0005622intracellular
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0003774motor activity
GO:0005515protein binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
cellular_component GO:0005622 intracellular
cellular_component GO:0016459 myosin complex
molecular_function GO:0005524 ATP binding
molecular_function GO:0003774 motor activity
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00000078 vs. Swiss-Prot (Human)
Match: MYO3B (Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4)

HSP 1 Score: 428.713 bits (1101), Expect = 1.137e-125
Identity = 276/779 (35.43%), Postives = 425/779 (54.56%), Query Frame = 1
Query:  154 NDLCDLENPDDDVIVDAIKKRYECGYFYTCIGDILISINPYKESILNSLEVSHRYKDEPSLTQTNPHVFGTTNNLYHFLNVNKESQCFIVXXXXXXXXXXVIHQAVTHFLCLVSTSDRSFKERILQANVILEAFGNARTSLNSNATRFCKYLKFHFDSKLHLSGVSITDYLLELPRVSNQRQGEANFNIFYYMFSG-RTEDELSKQLLDTPTQHKYL--KYGEFFGD--DLLSWSQAYESLIDAFQVVGFTQETVKEIFGILSAILNIGDLKFKC---EDETTGVFVDNLEILDKVSILLGVDTSDLELCLTSNLFVKPDDGVSGFKSLSEAEQTRDFMANFMYARLFSWIVSNINTFLNPGEPKKKQSEHVHVGFLDIFGFEDFQKNTLEQLCINTTNEQINLHFIQHVFAREQVDYQEEGLSELQLVEYFDNKNIVNLLLETPHGIFALLEEESKCLQADDQTLVSSFNAHCSELKFYIPSTANASTFSIVHYNKKVTYAADDFILRNNAKLDGCLIECLRGSKGQLTSTLFNSSLTKTGALIIKQGHGTVNCCQGDLRGAYTKRINHRLKKEGKCNTSKACHNTKSKQRTFTARKHKNNSVAVQFRNSLVDLIETILLCQAHFVRCIKPNKVKEADNFDVDFVRAQIKCNGILDSVRIRKDGFPVRLPFKIFVERYRFVKFDMTSPLENTGEICQQILQHCNIDDGYKIGATRVLLRLEHVQKLLSSLDEQTRRIVIAQKMVRGKLARIDFDFLQTSRKQEDRNVGNLLVSISSRS 2466
            +DL +LE  D+D I+  ++KRY     YT +GDILI++NP++   + S + S  Y      +   PH+F + +  Y  +    + QC ++SGESGSGK+E  H  V H   L   ++++ +E+ILQ N ++EAFGN+ T++N N++RF KYL+  F     + G  I++YLLE  RV  Q   E NF+IFYY+++G   + +LS   L      +Y+  + G    D     S+ + +E++   F+++GFT + V  ++ IL+ ILNIG+++F     + +T    V N E L   + +L +   +L+  LTS+  V   + +    ++  A   RD M+  +Y RLFSWIV+ INT L P E        ++VG LDIFGFE+FQ+N+ EQLCIN  NEQI  +F QHVFA EQ++YQ EG+  +  VEY DN+ ++++ L+ P G+ ALL+EES+  QA DQTLV  F  +     F+ P       F I HY  KV Y A   + +N   L   ++  LR S+ +L   LF+  LTKTG L   +   TV         A +    H    + K +T +   + +           K  +VA  FR SL+DL+  +++ Q HFVRCIKPN  +EA  F  + V AQ++  GIL++V IR+ G+  R+ F+ FV+RY ++ F        + E C  IL+   +D  + +G T+V L+  HV++L   L E   R+V+ Q   +G L    +      R +E R  G + +  + R 
Sbjct:  346 DDLVNLEVLDEDTIIHQLQKRYADLLIYTYVGDILIALNPFQNLSIYSPQFSRLYHGVKRASNP-PHIFASADAAYQCMVTLSKDQCIVISGESGSGKTESAHLIVQHLTFLGKANNQTLREKILQVNSLVEAFGNSCTAINDNSSRFGKYLEMMFTPTGVVMGARISEYLLEKSRVIKQAAREKNFHIFYYIYAGLHHQKKLSDFRLPEEKPPRYIADETGRVMHDITSKESYRRQFEAIQHCFRIIGFTDKEVHSVYRILAGILNIGNIEFAAISSQHQTDKSEVPNAEALQNAASVLCISPEELQEALTSHCVVTRGETIIRANTVDRAADVRDAMSKALYGRLFSWIVNRINTLLQPDENICSAGGGMNVGILDIFGFENFQRNSFEQLCINIANEQIQYYFNQHVFALEQMEYQNEGIDAVP-VEYEDNRPLLDMFLQKPLGLLALLDEESRFPQATDQTLVDKFEDNLRCKYFWRPKGVEL-CFGIQHYAGKVLYDASGVLEKNRDTLPADVVVVLRTSENKLLQQLFSIPLTKTGNLAQTRARITV---------ASSSLPPHFSAGKAKVDTLEVIRHPEETTNM------KRQTVASYFRYSLMDLLSKMVVGQPHFVRCIKPNDDREALQFSRERVLAQLRSTGILETVSIRRQGYSHRILFEEFVKRYYYLAFTAHQTPLASKESCVAILEKSRLDH-WVLGKTKVFLKYYHVEQLNLLLREVIGRVVVLQAYTKGWLGARRY-----KRVREKREKGAIAIQSAWRG 1100          
The following BLAST results are available for this feature:
BLAST of TCONS_00000078 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MYO3B1.137e-12535.43Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4[more]
back to top