TCONS_00000072 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000072
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1871

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000072 ID=TCONS_00000072|Name=|organism=Clytia hemisphaerica|type=transcript|length=1871bp
CTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaacacattGCAATA
CAAGATGGCggacaaaaagtccaaaaagaGAAGGaagGGAGATGAAGATC
AAAATCCCACAAAAGATGAGACAGAAGTCGCTAAATATCTACGCTTTAAT
CTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAAAgcagtgtatttctc
agGATCAAATGCTGTCGACTTTTTGATGGACTCAAAATGGGCTAGTGGAA
AAGGCAAATCAAGTATTGAGTTCACACACAGGGATTCTGTTGCCGATTAC
TTACGAAGgatGTTAAATTGTCAACTATTCAGCCGTGTACACGTTATAAA
GACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACAAAAAGTCTGAAG
AAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaagatacaaaaagt
CCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGAGGGTAAAGAagcaag
aaaaatcaaaaagaaggtCAAGGTGACACTGGAAGTGAATGATATTCAGG
AATTTTTCGATTCTGATGAAGAGTTTTATGTATGGATATTTGACCCTATC
AGTTGGAAGACTTTCATCCTTGGTATCATGCTGGttcTTGGAGTTGTTAT
TGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTCGTGATTACAGTTGGT
ATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGAATACTTATTCTTGCT
ATTTTACGTTATATTATTTATGGATTGTTATGGCTTGGCACAATGGGTAA
ATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGTGTGGATTCTTTG
AGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaagaagaaaaaaaa
gaagacaaatcTATTGACGGTGACGACAAAGACAAAGCAAAAGAATCTTT
GGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAGACTGGGTCAAAG
TGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAAGAGGTTTTGTCT
TAATCACATGGTTTgattatttgttttgattggatcattgtttacttatc
ttattacacttatataactaCTAAAGTTATTAACGTGCATTGGTTATCCT
CACGTTAACTACAACTGCTTAACAAATTTCTAGTCAAGGTAATTCTGCGT
TATTTAGctatataagtgtaataagaTTAACTTATACTGAATTGTCTCCG
TTAGACCTATtgtctctcctttttttttaaaaagacaatGAATTTCTTTA
ATAATGCATTCATACCCCCCTCCCTGTTTCATATTGACACCATTCCccaa
aaagctcaaaaaattcTCAGTCGCGCAAAACAGCGTCCATCATAGTCTAG
TTTGCTTCTTTAGTTAAAAATGTTCCTGCTTTTTATCGTCTCCGTAAGGA
AAATtataaatattatcaaaataacaatggaaagaaaaattatttaggAA
TTAGAAATAGTAGATTTTTaggatattttgttttttccatcttttttttt
ttttgcctttttagttttataattatttatttttagtagTAAAAAGGTGT
TCTCTCTGCTATACTGCATCGATTTTCATTGATGTTTATACAGCTTTGTC
ACCTTCAGAGATTTTTGTACTTCTCGTTTTTTCTCTGCTTTTAACCATTA
TGAAAGCTTGATAAAAAGGAGAATacaatttgtaacttttttagaaaaaa
aagaattcgaTATTATATTTCACATCAGTTTATTTTAAGTGTACTTCTTT
TTAGCAAAGAGTGTGTCTAAGTATGTTCAAAATTTaggattttcaatatt
tttccttTATTAAGATATCGA
Run BLAST on NCBI

protein sequence of TCONS_00000072-protein

>TCONS_00000072-protein ID=TCONS_00000072-protein|Name=TCONS_00000072-protein|organism=Clytia hemisphaerica|type=polypeptide|length=350bp
LDLRSFPRPQNKNTLQYKMADKKSKKRRKGDEDQNPTKDETEVAKYLRFN
LPTKKATLFGEKAVYFSGSNAVDFLMDSKWASGKGKSSIEFTHRDSVADY
LRRMLNCQLFSRVHVIKTEKKVKKKDEPDKKSEEKAIEEKKSENKKDTKS
PKEPNSPKAKKEGKEARKIKKKVKVTLEVNDIQEFFDSDEEFYVWIFDPI
SWKTFILGIMLVLGVVIVCLFPLWPESVRDYSWYLSVAGAIFVGGILILA
ILRYIIYGLLWLGTMGKLHFWLLPNLTAECGFFESFVPAYQYTVKKEEKK
EDKSIDGDDKDKAKESLENEDESEKSENGDWVKVKKDDAEEDGVQEEVLS
Run BLAST on NCBI

transcript from alignment at sc0000001:1630935..1638159+

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000072 ID=TCONS_00000072|Name=TCONS_00000072|organism=Clytia hemisphaerica|type=transcript|length=7225bp|location=Sequence derived from alignment at sc0000001:1630935..1638159+ (Clytia hemisphaerica)
CTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaacacattGCAATA CAAGATGGCggacaaaaagtccaaaaagaGAAGGaaggtatgattttttt ttatcatcttatTCTTTCGAAGAACATATCATCATTATAAATCCTTAAGC ACGTTGTATTCGAAGAAGATGGTTTGAACCACTAACTCTACATAGCCTGg gcttttttgataaaaatctgGGTAGGGGGGGGGACAAAAAACATCCTATC CTCCTGCCTTTCTGGTGTGCTGGTGTTTGCGTAATGTGTTACAGTCTCCA TGGTTTTTAGGGCAGTTGTCAGGCACAGACCTATGCCAACTTTTGAGATG ACAATTTTAGgcgggaaaaaatttcaaagcaaatacAAAAAGTGTTTTCT ATTaccttttttccaaaaatcggaaaatcagggaaatatttttctgaaaa ttggaaTATCAGGGAAAtactttttatgaaaatttgaaaattggaaatat tttttctgaaaattggagtcaaggaagttttttttcttctgaaaattgga ATCAGGAAAAtacttcttttgaaaatttgaaaatcagggaaatatttttt tcaaaatttggaaaatcagggaagtattttttgcaaaagttggaaaatca ggaaaaattattaaaaaaaaattgaaaatcagggaaatattttttaaggg tAACATTTTTCTGAAAATTGGAATCAGGGAAATATTTTTTCTGAAAATTG GAATCATggaaatattttttctgtaaattggAATCAGGGAAAtacttttt atgaaaattggaaaatcagagaaattttttttctaaaaattggaaaatca gggaaatttctttttcataaattggaaaatcagtgaaatatttttttcaa aaattggaaaatcagggaaatattttttcaaaaattggaaaatcaggaaa atatttatttcaaaattggggAAATAtatattctttcaaaaaaacttgga AATCTTTCCCAAAAATCAGAAGATCGGagaagaagtatttttttccaaaa tttggaaaatcaaggaaatattttttgggagatattttacctaaaaatca ggaaatccgaaaatatttttttcatatactgtatttacattggaaaattt ggggaaatgTTTCTTCTAAATATCGGAGAAACTGGAAAATTGgacaaaat ttctcaaaaatgaaaaaatatgtacaGAAAGTTGTACAAAAAGTGTGTAA AAGTCAATGACCAAATGCATGAATTTCATGTTCAATgcacggttagtgta aaacgcaggtcacaggttacaggtcacaggtcaacaaagtgcagaccgga gaaaaaaataagatcataacatatacataacataacatcaatacatcaTA GCAtgtattacaaaaaagtaatacatgctatttagatattataaaatgac aattgaatagaataacaacctattttgaccTAGTGACACaattacttaca aaaataatgacaaaatcataaaatatgataccatatataaaatatttatt atacaaaatgtgatgtggatggtgtgaatggataaaaaaaggcatcaaac agaagcttgtgaggtccctaagagagtagttttagaaggatgaaactaat taatcattcaattgttattttaatgacttaatgacaatttttgacaaaaa tattgacagaatcacatatcatgtcttacaagagaaaaacaccaaaaata tttagcataccgaatgtgatgataactatatggctggatataaaattaca ccaatcagaagctcgtgagttctctgagaaggtagtttatttagagcgat gtgttttattatatgtaaccatcatataacattacaaacattacaatatg taatatacagCAAActgcgcaaactgcgaaagatcgataaaagcacatgg ttaaattttgatgtttgaaatggtttttatATGGATgtaattgcttgaga attatgtttttgatagttctttgtgttttccaaacattttcctctgcaat gacattgattagagtcaacctgtcatcactgacctgtgacctgcaacctg tgacctgcgttttacactaaccgttcAATGCATGAGAGTTTGCACCTCTG CTTCAAACTGAAGAAATCTTTTTACCATGAAATAGCCCTTCAAAATGggc caaaaaagttttgcaATAATTTCCCAATTTTCCTAGATCAAAATTCATGG ACATGTATGTGGTAACctgtaaaataaatatttttgaactgTTTTTCAGC TAGGTcaagccatttttcatgcccatCGGACCCTGCCCCTCCTGAAAAAC ACTAAAATGTTGGTAAAAAtagcctttttagtggaaaaacaccggaaaaa gtgccctttttggccatcAACGGACGCTGCCTTGGCTTTATAAAATATGG CCTgtaggtaaatctattttaaaagaCCTACGTTCCAGGCAGGTCACTTG GTTTGCAAGTTGCAACTGCAAGCAATAATGTACAAGCATACTAAGGCTCg gatttgcaaaaaaaatgagCATAGTGCTAAGCATAGCTCGAAGCCGGGGA AAGTCATCATTTTGATTTTACAATCTTATATTTTGActtacaaaatttga catataatataaaataagaatataaacagtcattgtaaaaagtaaaagtg aaattgaaatttgccaaaattgacaacgttttgaaaaaacttctgTATAA CCAAGcatttgaggctcaaaatgaAATCTTAAGCAAACGCAAATTAAAAA CAGAAGAGGTCCGAGGACTGTGCCTTGAGGAACTCCAGAGATaacattag ctttttcagatgtCTCACCGTTAATAACAACAGTTTGGGTGCAATTGGAG AGGTAGTTAGTGATCCATTCAAGGGTTTTACTTCTTACGCCTTGGTGATG AAGTTTTAATTGGGTCTGCCTATTGAGTAGACTGATAGGATCAGAAAGaa tgaatgaaaatatttatcaaTCCTTTCTCTCTCTTGAGTTTCAGCAAATT AGCTCTTTTTATTTACTGACCAGTGGttaaatctgaaatttttagatttt ttcaataccATCTAGGGAGATGAAGATCAAAATCCCACAAAAGATGAGAC AGAAGTCGCTAAATATCTACGCTTTAATCTGCCAACCAAGAAAGCAACAC TCTTTGGAGAAAAAgcagtgtatttctcaggtaggtttcttgtatttttt tgctgaaattgcGTTCACATAAAGATTCTAAATGTGAACTTTCACTATTT TATATTTCTTGCTTTCTTGTCCAACTTGAcataaaaaatgatatttgttA GTTTAACCCAACGGAATTCAGATAAAAATTTCATGTGTATGAAAATGGAT TTTTCTATGATGGATTAGTGTTATTTCTTATAGGATCAAATGCTGTCGAC TTTTTGATGGACTCAAAATGGGCTAGTGGAAAAGGCAAATCAAGTATTGA GTTCACACACAGGGATTCTGTTGCCGATTACTTACGAAGGTATATAACAT TTTACACCATGTACTGGGACTCCTTTGTCCAAGGAAAAATTGGCCTAAAA CTACTCAAATTTTGACTCTAaggattttatcaaataaataattAACTTCC CTTGTATAATTTCATACTTAAGCTTAAAAAAAAACCTCACAAGATATCTC TTTTTATTcttatttaaatgtttttaaaattatcactttagatttctttt catttttccaggatGTTAAATTGTCAACTATTCAGCCGTGTACACGTTAT AAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACAAAAAGTCTG AAGAAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaagatacaaaa agtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGTCttcgaaaaaat gtttttgctttcCTCTCATGATTTAAACTATGAACAAGTTATAGGGATTA CTAATTACTTTTAAGTAAGGTCTGAACTAACATGCAAATCTTTTCCATAC TTTTTTGGTCAAACATTGAACAGATTAGTGAAAAGTTTTCTTTAATTCTA TTTCTAGGAGGGTAAAGAagcaagaaaaatcaaaaagaaggtATGTCATC TTGATAATATTCTAACTCTGTACTGACACTAAAGAAGTCTTCTTCTTAAA ACTACATGGTATGTCATTAATTGACGCATTGACAGAGAAAGTATATTACA TAAGGATAGATACGGATTATCtacatttcattttcattatgtATAGATTT GGTTTAGTAGTAAGTTtgtgaccgcagtcgagggcgatcCGTAGGCTtcc ttttctctagctgtctatCCAAATGTAAGGGAGGGTActactcctttccc tggatttctccccTTACCCTTGGTCTGTCTTTTAGAtgctgagcatcaag ctgaGAGGCACCAAGTaacattttgggaatctttggtgtgACCCTTCTGG GAAGcaaacccacaaccttgcgcaccgtagctggatgctctgcTTTCATG CTACGATCGCTAAATTAttaaatttgctttttaaaCATAGATACACAAAA GCATAGTAAAAAGAGATACTCGCGtcacatttttcttcatttttaggtCA AGGTGACACTGGAAGTGAATGATATTCAGGAATTTTTCGATTCTGATGAA GAGGTGATGACTGATGCATAATATTTCgtaaaaatttcacttttcaatGT CTTGCCTAAGGTTTCTGAGGAAAGCTACATGCTGAAATTTCTACCTTATt aattacacgaatattactagtcattttattaacacaaattgaaaaatttt gtgttaataaaaacccccttaattaaaaccagccgctgtttcctttaaaa agcagaaaaatttgtgttaatttgaaaacatgcaaatttcaaggccgtta aatacttacctagtaatatttgtgtaataaggtaatttAAATTGCTTTAC TTTTTGTTTGTTATAGATAATTTAGCGTTATATTATCGTTTTGTACTTTG TACTTTTTATCTAGTTTTATGTATGGATATTTGACCCTATCAGTTGGAAG ACTTTCATCCTTGGTATCATGCTGGGTAAGCTCCTTTTTATTTTGCCATT TCAATATGAGTTTTCAAAGATTATGGGCAATGATTTCCAGATTTGTGTTT AATCAAATTGGAAAATGAGAATTAGGTAGGAAAGTACAATACGAACTTTT TATCTTTAAAGTGTTCTGAGCTCTTTCCTCTCAGACAGAGGTTTCTTTCT TAGCGAAGTTAAAAAAGATTGTTGGATTCCGTATCAAGATCTATATTGTT TTCCTAATATCTTTCAAATGACTTTTACAATGTTAATGACTTTAACAGTG CAATTTCAaaatcgttcgttcgttcgttcgttcgttcgttcgttcgttcg ttcgttcgttcgttcgttcgttcgttttgTTCAATAATGGAAAGACAAGT ATTTACATTCATTTATCATTCAGTTTTGTTAATACAATGTTGAAAGGTAC CAAATAATATTAGACGAACTTTTATAGAGTTTTTTATTGATTATTCTACT TGAATTTCtgtcattttaaatttttttagttcTTGGAGTTGTTATTGTTT GTTTGTTCCCATTATGGCCTGAAAGTGTTCGTGATTACAGTTGGTATTTA TCTGTAGCTGGAGCCATTTTTGTTGGTGGAATACTTATTCTTGCTATTTG TAAGTCGTGTttccttttaaatttgaaaagaatattttaatgTGTATTCT GATCTCATTCGAACTTAAAGTGATATGTTAGTACAGTattagtctcttta actcgaacctctataactcgaatgtctccttaacttggACAAGTTTTCTT GTCCCTTCAGTGTCACATAAACCTTACTTTATAACTCGAAATATTCTTAA CCCAAACAAGTTTTCTcgccccttcagttaacaatgccttataaacctta ctccataacttgaaatttcctgaactcgaacaaatttgtgtcccCCCTGT GGGTTCTATCCTGTTGATTGAAAACTCATTGAAAGACGTGTATGTACTCT TTCTTCAGTACGTTATATTATTTATGGATTGTTATGGCTTGGCACAATGG GTAAATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGTGTGGATTC TTTGAGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaagaagaaaa aaaagaagacaaatcTATTGACGGTGACGACAAAGACAAAGCAAAAGAAT CTTTGGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAGACTGGGTC AAAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAAGAGGTTTT GTCTTAATCACATGGTTTgattatttgttttgattggatcattgtttact tatcttattacacttatataactaCTAAAGTTATTAACGTGCATTGGTTA TCCTCACGTTAACTACAACTGCTTAACAAATTTCTAGTCAAGGTAATTCT GCGTTATTTAGctatataagtgtaataagaTTAACTTATACTGAATTGTC TCCGTTAGACCTATtgtctctcctttttttttaaaaagacaatGAATTTC TTTAATAATGCATTCATACCCCCCTCCCTGTTTCATATTGACACCATTCC ccaaaaagctcaaaaaattcTCAGTCGCGCAAAACAGCGTCCATCATAGT CTAGTTTGCTTCTTTAGTTAAAAATGTTCCTGCTTTTTATCGTCTCCGTA AGGAAAATtataaatattatcaaaataacaatggaaagaaaaattattta ggAATTAGAAATAGTAGATTTTTaggatattttgttttttccatcttttt ttttttttgcctttttagttttataattatttatttttagtagTAAAAAG GTGTTCTCTCTGCTATACTGCATCGATTTTCATTGATGTTTATACAGCTT TGTCACCTTCAGAGATTTTTGTACTTCTCGTTTTTTCTCTGCTTTTAACC ATTATGAAAGCTTGATAAAAAGGAGAATacaatttgtaacttttttagaa aaaaaagaattcgaTATTATATTTCACATCAGTTTATTTTAAGTGTACTT CTTTTTAGCAAAGAGTGTGTCTAAGTATGTTCAAAATTTaggattttcaa tatttttccttTATTAAGATATCGA

Coding sequence (CDS) from alignment at sc0000001:1630935..1638159+

>TCONS_00000072 ID=TCONS_00000072|Name=|organism=Clytia hemisphaerica|type=CDS|length=9477bp|location=Sequence derived from alignment at sc0000001:1630935..1638159+ (Clytia hemisphaerica)
CTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaacacattGCAATA
CAAGATGGCggacaaaaagtccaaaaagaGAAGGaagGGAGATGAAGATC
AAAATCCCACAAAAGATGAGACAGAAGTCGCTAAATATCTACGCTTTAAT
CTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAAAgcagtgtatttctc
agGATCAAATGCTGTCGACTTTTTGATGGACTCAAAATGGGCTAGTGGAA
AAGGCAAATCAAGTATTGAGTTCACACACAGGGATTCTGTTGCCGATTAC
TTACGAAGgatGTTAAATTGTCAACTATTCAGCCGTGTACACGTTATAAA
GACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACAAAAAGTCTGAAG
AAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaagatacaaaaagt
CCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGAGGGTAAAGAagcaag
aaaaatcaaaaagaaggtCAAGGTGACACTGGAAGTGAATGATATTCAGG
AATTTTTCGATTCTGATGAAGAGTTTTATGTATGGATATTTGACCCTATC
AGTTGGAAGACTTTCATCCTTGGTATCATGCTGGttcTTGGAGTTGTTAT
TGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTCGTGATTACAGTTGGT
ATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGAATACTTATTCTTGCT
ATTTTACGTTATATTATTTATGGATTGTTATGGCTTGGCACAATGGGTAA
ATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGTGTGGATTCTTTG
AGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaagaagaaaaaaaa
gaagacaaatcTATTGACGGTGACGACAAAGACAAAGCAAAAGAATCTTT
GGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAGACTGGGTCAAAG
TGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAAGAGGTTTTGTCT
TAACTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaacacattGCA
ATACAAGATGGCggacaaaaagtccaaaaagaGAAGGaagGGAGATGAAG
ATCAAAATCCCACAAAAGATGAGACAGAAGTCGCTAAATATCTACGCTTT
AATCTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAAAgcagtgtattt
ctcagGATCAAATGCTGTCGACTTTTTGATGGACTCAAAATGGGCTAGTG
GAAAAGGCAAATCAAGTATTGAGTTCACACACAGGGATTCTGTTGCCGAT
TACTTACGAAGgatGTTAAATTGTCAACTATTCAGCCGTGTACACGTTAT
AAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACAAAAAGTCTG
AAGAAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaagatacaaaa
agtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGAGGGTAAAGAagc
aagaaaaatcaaaaagaaggtCAAGGTGACACTGGAAGTGAATGATATTC
AGGAATTTTTCGATTCTGATGAAGAGTTTTATGTATGGATATTTGACCCT
ATCAGTTGGAAGACTTTCATCCTTGGTATCATGCTGGttcTTGGAGTTGT
TATTGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTCGTGATTACAGTT
GGTATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGAATACTTATTCTT
GCTATTTTACGTTATATTATTTATGGATTGTTATGGCTTGGCACAATGGG
TAAATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGTGTGGATTCT
TTGAGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaagaagaaaaa
aaagaagacaaatcTATTGACGGTGACGACAAAGACAAAGCAAAAGAATC
TTTGGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAGACTGGGTCA
AAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAAGAGGTTTTG
TCTTAACTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaacacatt
GCAATACAAGATGGCggacaaaaagtccaaaaagaGAAGGaagGGAGATG
AAGATCAAAATCCCACAAAAGATGAGACAGAAGTCGCTAAATATCTACGC
TTTAATCTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAAAgcagtgta
tttctcagGATCAAATGCTGTCGACTTTTTGATGGACTCAAAATGGGCTA
GTGGAAAAGGCAAATCAAGTATTGAGTTCACACACAGGGATTCTGTTGCC
GATTACTTACGAAGgatGTTAAATTGTCAACTATTCAGCCGTGTACACGT
TATAAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACAAAAAGT
CTGAAGAAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaagataca
aaaagtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGAGGGTAAAGA
agcaagaaaaatcaaaaagaaggtCAAGGTGACACTGGAAGTGAATGATA
TTCAGGAATTTTTCGATTCTGATGAAGAGTTTTATGTATGGATATTTGAC
CCTATCAGTTGGAAGACTTTCATCCTTGGTATCATGCTGGttcTTGGAGT
TGTTATTGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTCGTGATTACA
GTTGGTATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGAATACTTATT
CTTGCTATTTTACGTTATATTATTTATGGATTGTTATGGCTTGGCACAAT
GGGTAAATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGTGTGGAT
TCTTTGAGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaagaagaa
aaaaaagaagacaaatcTATTGACGGTGACGACAAAGACAAAGCAAAAGA
ATCTTTGGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAGACTGGG
TCAAAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAAGAGGTT
TTGTCTTAACTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaacac
attGCAATACAAGATGGCggacaaaaagtccaaaaagaGAAGGaagGGAG
ATGAAGATCAAAATCCCACAAAAGATGAGACAGAAGTCGCTAAATATCTA
CGCTTTAATCTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAAAgcagt
gtatttctcagGATCAAATGCTGTCGACTTTTTGATGGACTCAAAATGGG
CTAGTGGAAAAGGCAAATCAAGTATTGAGTTCACACACAGGGATTCTGTT
GCCGATTACTTACGAAGgatGTTAAATTGTCAACTATTCAGCCGTGTACA
CGTTATAAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACAAAA
AGTCTGAAGAAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaagat
acaaaaagtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGAGGGTAA
AGAagcaagaaaaatcaaaaagaaggtCAAGGTGACACTGGAAGTGAATG
ATATTCAGGAATTTTTCGATTCTGATGAAGAGTTTTATGTATGGATATTT
GACCCTATCAGTTGGAAGACTTTCATCCTTGGTATCATGCTGGttcTTGG
AGTTGTTATTGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTCGTGATT
ACAGTTGGTATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGAATACTT
ATTCTTGCTATTTTACGTTATATTATTTATGGATTGTTATGGCTTGGCAC
AATGGGTAAATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGTGTG
GATTCTTTGAGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaagaa
gaaaaaaaagaagacaaatcTATTGACGGTGACGACAAAGACAAAGCAAA
AGAATCTTTGGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAGACT
GGGTCAAAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAAGAG
GTTTTGTCTTAACTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaa
cacattGCAATACAAGATGGCggacaaaaagtccaaaaagaGAAGGaagG
GAGATGAAGATCAAAATCCCACAAAAGATGAGACAGAAGTCGCTAAATAT
CTACGCTTTAATCTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAAAgc
agtgtatttctcagGATCAAATGCTGTCGACTTTTTGATGGACTCAAAAT
GGGCTAGTGGAAAAGGCAAATCAAGTATTGAGTTCACACACAGGGATTCT
GTTGCCGATTACTTACGAAGgatGTTAAATTGTCAACTATTCAGCCGTGT
ACACGTTATAAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACA
AAAAGTCTGAAGAAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaa
gatacaaaaagtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGAGGG
TAAAGAagcaagaaaaatcaaaaagaaggtCAAGGTGACACTGGAAGTGA
ATGATATTCAGGAATTTTTCGATTCTGATGAAGAGTTTTATGTATGGATA
TTTGACCCTATCAGTTGGAAGACTTTCATCCTTGGTATCATGCTGGttcT
TGGAGTTGTTATTGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTCGTG
ATTACAGTTGGTATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGAATA
CTTATTCTTGCTATTTTACGTTATATTATTTATGGATTGTTATGGCTTGG
CACAATGGGTAAATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGT
GTGGATTCTTTGAGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaa
gaagaaaaaaaagaagacaaatcTATTGACGGTGACGACAAAGACAAAGC
AAAAGAATCTTTGGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAG
ACTGGGTCAAAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAA
GAGGTTTTGTCTTAACTAGATCTACGGTCCTTTCCAAGAccacaaaataa
aaacacattGCAATACAAGATGGCggacaaaaagtccaaaaagaGAAGGa
agGGAGATGAAGATCAAAATCCCACAAAAGATGAGACAGAAGTCGCTAAA
TATCTACGCTTTAATCTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAA
AgcagtgtatttctcagGATCAAATGCTGTCGACTTTTTGATGGACTCAA
AATGGGCTAGTGGAAAAGGCAAATCAAGTATTGAGTTCACACACAGGGAT
TCTGTTGCCGATTACTTACGAAGgatGTTAAATTGTCAACTATTCAGCCG
TGTACACGTTATAAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTG
ACAAAAAGTCTGAAGAAAAAGCAATCGAAGAGAAGaagtcagaaaataaa
aaagatacaaaaagtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGA
GGGTAAAGAagcaagaaaaatcaaaaagaaggtCAAGGTGACACTGGAAG
TGAATGATATTCAGGAATTTTTCGATTCTGATGAAGAGTTTTATGTATGG
ATATTTGACCCTATCAGTTGGAAGACTTTCATCCTTGGTATCATGCTGGt
tcTTGGAGTTGTTATTGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTC
GTGATTACAGTTGGTATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGA
ATACTTATTCTTGCTATTTTACGTTATATTATTTATGGATTGTTATGGCT
TGGCACAATGGGTAAATTACATTTCTGGCTGCTACCAAACTTGACGGCTG
AGTGTGGATTCTTTGAGTCGTTTGTTCCTGCTTACCAATACACTgttaag
aaagaagaaaaaaaagaagacaaatcTATTGACGGTGACGACAAAGACAA
AGCAAAAGAATCTTTGGAGAATGAAGatgaaagtgaaaaaagtgAGAATG
GAGACTGGGTCAAAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAG
GAAGAGGTTTTGTCTTAACTAGATCTACGGTCCTTTCCAAGAccacaaaa
taaaaacacattGCAATACAAGATGGCggacaaaaagtccaaaaagaGAA
GGaagGGAGATGAAGATCAAAATCCCACAAAAGATGAGACAGAAGTCGCT
AAATATCTACGCTTTAATCTGCCAACCAAGAAAGCAACACTCTTTGGAGA
AAAAgcagtgtatttctcagGATCAAATGCTGTCGACTTTTTGATGGACT
CAAAATGGGCTAGTGGAAAAGGCAAATCAAGTATTGAGTTCACACACAGG
GATTCTGTTGCCGATTACTTACGAAGgatGTTAAATTGTCAACTATTCAG
CCGTGTACACGTTATAAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAAC
CTGACAAAAAGTCTGAAGAAAAAGCAATCGAAGAGAAGaagtcagaaaat
aaaaaagatacaaaaagtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAA
GGAGGGTAAAGAagcaagaaaaatcaaaaagaaggtCAAGGTGACACTGG
AAGTGAATGATATTCAGGAATTTTTCGATTCTGATGAAGAGTTTTATGTA
TGGATATTTGACCCTATCAGTTGGAAGACTTTCATCCTTGGTATCATGCT
GGttcTTGGAGTTGTTATTGTTTGTTTGTTCCCATTATGGCCTGAAAGTG
TTCGTGATTACAGTTGGTATTTATCTGTAGCTGGAGCCATTTTTGTTGGT
GGAATACTTATTCTTGCTATTTTACGTTATATTATTTATGGATTGTTATG
GCTTGGCACAATGGGTAAATTACATTTCTGGCTGCTACCAAACTTGACGG
CTGAGTGTGGATTCTTTGAGTCGTTTGTTCCTGCTTACCAATACACTgtt
aagaaagaagaaaaaaaagaagacaaatcTATTGACGGTGACGACAAAGA
CAAAGCAAAAGAATCTTTGGAGAATGAAGatgaaagtgaaaaaagtgAGA
ATGGAGACTGGGTCAAAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTC
CAGGAAGAGGTTTTGTCTTAACTAGATCTACGGTCCTTTCCAAGAccaca
aaataaaaacacattGCAATACAAGATGGCggacaaaaagtccaaaaaga
GAAGGaagGGAGATGAAGATCAAAATCCCACAAAAGATGAGACAGAAGTC
GCTAAATATCTACGCTTTAATCTGCCAACCAAGAAAGCAACACTCTTTGG
AGAAAAAgcagtgtatttctcagGATCAAATGCTGTCGACTTTTTGATGG
ACTCAAAATGGGCTAGTGGAAAAGGCAAATCAAGTATTGAGTTCACACAC
AGGGATTCTGTTGCCGATTACTTACGAAGgatGTTAAATTGTCAACTATT
CAGCCGTGTACACGTTATAAAGACTGAAAAGAAAGTCAAGAAAAAAGATG
AACCTGACAAAAAGTCTGAAGAAAAAGCAATCGAAGAGAAGaagtcagaa
aataaaaaagatacaaaaagtCCAAAGGAGCCAAACAGCCCCAAAGCTAA
AAAGGAGGGTAAAGAagcaagaaaaatcaaaaagaaggtCAAGGTGACAC
TGGAAGTGAATGATATTCAGGAATTTTTCGATTCTGATGAAGAGTTTTAT
GTATGGATATTTGACCCTATCAGTTGGAAGACTTTCATCCTTGGTATCAT
GCTGGttcTTGGAGTTGTTATTGTTTGTTTGTTCCCATTATGGCCTGAAA
GTGTTCGTGATTACAGTTGGTATTTATCTGTAGCTGGAGCCATTTTTGTT
GGTGGAATACTTATTCTTGCTATTTTACGTTATATTATTTATGGATTGTT
ATGGCTTGGCACAATGGGTAAATTACATTTCTGGCTGCTACCAAACTTGA
CGGCTGAGTGTGGATTCTTTGAGTCGTTTGTTCCTGCTTACCAATACACT
gttaagaaagaagaaaaaaaagaagacaaatcTATTGACGGTGACGACAA
AGACAAAGCAAAAGAATCTTTGGAGAATGAAGatgaaagtgaaaaaagtg
AGAATGGAGACTGGGTCAAAGTGAAGAAAGATGATGCCGAAGAAGATGGT
GTCCAGGAAGAGGTTTTGTCTTAACTAGATCTACGGTCCTTTCCAAGAcc
acaaaataaaaacacattGCAATACAAGATGGCggacaaaaagtccaaaa
agaGAAGGaagGGAGATGAAGATCAAAATCCCACAAAAGATGAGACAGAA
GTCGCTAAATATCTACGCTTTAATCTGCCAACCAAGAAAGCAACACTCTT
TGGAGAAAAAgcagtgtatttctcagGATCAAATGCTGTCGACTTTTTGA
TGGACTCAAAATGGGCTAGTGGAAAAGGCAAATCAAGTATTGAGTTCACA
CACAGGGATTCTGTTGCCGATTACTTACGAAGgatGTTAAATTGTCAACT
ATTCAGCCGTGTACACGTTATAAAGACTGAAAAGAAAGTCAAGAAAAAAG
ATGAACCTGACAAAAAGTCTGAAGAAAAAGCAATCGAAGAGAAGaagtca
gaaaataaaaaagatacaaaaagtCCAAAGGAGCCAAACAGCCCCAAAGC
TAAAAAGGAGGGTAAAGAagcaagaaaaatcaaaaagaaggtCAAGGTGA
CACTGGAAGTGAATGATATTCAGGAATTTTTCGATTCTGATGAAGAGTTT
TATGTATGGATATTTGACCCTATCAGTTGGAAGACTTTCATCCTTGGTAT
CATGCTGGttcTTGGAGTTGTTATTGTTTGTTTGTTCCCATTATGGCCTG
AAAGTGTTCGTGATTACAGTTGGTATTTATCTGTAGCTGGAGCCATTTTT
GTTGGTGGAATACTTATTCTTGCTATTTTACGTTATATTATTTATGGATT
GTTATGGCTTGGCACAATGGGTAAATTACATTTCTGGCTGCTACCAAACT
TGACGGCTGAGTGTGGATTCTTTGAGTCGTTTGTTCCTGCTTACCAATAC
ACTgttaagaaagaagaaaaaaaagaagacaaatcTATTGACGGTGACGA
CAAAGACAAAGCAAAAGAATCTTTGGAGAATGAAGatgaaagtgaaaaaa
gtgAGAATGGAGACTGGGTCAAAGTGAAGAAAGATGATGCCGAAGAAGAT
GGTGTCCAGGAAGAGGTTTTGTCTTAA
Gene-mRNA-Prot