Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000072 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000072
Unique NameTCONS_00000072
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1871

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000072 ID=TCONS_00000072|Name=TCONS_00000072|organism=Clytia hemisphaerica|type=transcript|length=1871bp
CTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaacacattGCAATA
CAAGATGGCggacaaaaagtccaaaaagaGAAGGaagGGAGATGAAGATC
AAAATCCCACAAAAGATGAGACAGAAGTCGCTAAATATCTACGCTTTAAT
CTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAAAgcagtgtatttctc
agGATCAAATGCTGTCGACTTTTTGATGGACTCAAAATGGGCTAGTGGAA
AAGGCAAATCAAGTATTGAGTTCACACACAGGGATTCTGTTGCCGATTAC
TTACGAAGgatGTTAAATTGTCAACTATTCAGCCGTGTACACGTTATAAA
GACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACAAAAAGTCTGAAG
AAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaagatacaaaaagt
CCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGAGGGTAAAGAagcaag
aaaaatcaaaaagaaggtCAAGGTGACACTGGAAGTGAATGATATTCAGG
AATTTTTCGATTCTGATGAAGAGTTTTATGTATGGATATTTGACCCTATC
AGTTGGAAGACTTTCATCCTTGGTATCATGCTGGttcTTGGAGTTGTTAT
TGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTCGTGATTACAGTTGGT
ATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGAATACTTATTCTTGCT
ATTTTACGTTATATTATTTATGGATTGTTATGGCTTGGCACAATGGGTAA
ATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGTGTGGATTCTTTG
AGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaagaagaaaaaaaa
gaagacaaatcTATTGACGGTGACGACAAAGACAAAGCAAAAGAATCTTT
GGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAGACTGGGTCAAAG
TGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAAGAGGTTTTGTCT
TAATCACATGGTTTgattatttgttttgattggatcattgtttacttatc
ttattacacttatataactaCTAAAGTTATTAACGTGCATTGGTTATCCT
CACGTTAACTACAACTGCTTAACAAATTTCTAGTCAAGGTAATTCTGCGT
TATTTAGctatataagtgtaataagaTTAACTTATACTGAATTGTCTCCG
TTAGACCTATtgtctctcctttttttttaaaaagacaatGAATTTCTTTA
ATAATGCATTCATACCCCCCTCCCTGTTTCATATTGACACCATTCCccaa
aaagctcaaaaaattcTCAGTCGCGCAAAACAGCGTCCATCATAGTCTAG
TTTGCTTCTTTAGTTAAAAATGTTCCTGCTTTTTATCGTCTCCGTAAGGA
AAATtataaatattatcaaaataacaatggaaagaaaaattatttaggAA
TTAGAAATAGTAGATTTTTaggatattttgttttttccatcttttttttt
ttttgcctttttagttttataattatttatttttagtagTAAAAAGGTGT
TCTCTCTGCTATACTGCATCGATTTTCATTGATGTTTATACAGCTTTGTC
ACCTTCAGAGATTTTTGTACTTCTCGTTTTTTCTCTGCTTTTAACCATTA
TGAAAGCTTGATAAAAAGGAGAATacaatttgtaacttttttagaaaaaa
aagaattcgaTATTATATTTCACATCAGTTTATTTTAAGTGTACTTCTTT
TTAGCAAAGAGTGTGTCTAAGTATGTTCAAAATTTaggattttcaatatt
tttccttTATTAAGATATCGA
Run BLAST on NCBI

protein sequence of TCONS_00000072-protein

>TCONS_00000072-protein ID=TCONS_00000072-protein|Name=TCONS_00000072-protein|organism=Clytia hemisphaerica|type=polypeptide|length=350bp
LDLRSFPRPQNKNTLQYKMADKKSKKRRKGDEDQNPTKDETEVAKYLRFN
LPTKKATLFGEKAVYFSGSNAVDFLMDSKWASGKGKSSIEFTHRDSVADY
LRRMLNCQLFSRVHVIKTEKKVKKKDEPDKKSEEKAIEEKKSENKKDTKS
PKEPNSPKAKKEGKEARKIKKKVKVTLEVNDIQEFFDSDEEFYVWIFDPI
SWKTFILGIMLVLGVVIVCLFPLWPESVRDYSWYLSVAGAIFVGGILILA
ILRYIIYGLLWLGTMGKLHFWLLPNLTAECGFFESFVPAYQYTVKKEEKK
EDKSIDGDDKDKAKESLENEDESEKSENGDWVKVKKDDAEEDGVQEEVLS
Run BLAST on NCBI

transcript from alignment at sc0000001:1630935..1638159+

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000072 ID=TCONS_00000072|Name=TCONS_00000072|organism=Clytia hemisphaerica|type=transcript|length=7225bp|location=Sequence derived from alignment at sc0000001:1630935..1638159+ (Clytia hemisphaerica)
CTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaacacattGCAATA CAAGATGGCggacaaaaagtccaaaaagaGAAGGaaggtatgattttttt ttatcatcttatTCTTTCGAAGAACATATCATCATTATAAATCCTTAAGC ACGTTGTATTCGAAGAAGATGGTTTGAACCACTAACTCTACATAGCCTGg gcttttttgataaaaatctgGGTAGGGGGGGGGACAAAAAACATCCTATC CTCCTGCCTTTCTGGTGTGCTGGTGTTTGCGTAATGTGTTACAGTCTCCA TGGTTTTTAGGGCAGTTGTCAGGCACAGACCTATGCCAACTTTTGAGATG ACAATTTTAGgcgggaaaaaatttcaaagcaaatacAAAAAGTGTTTTCT ATTaccttttttccaaaaatcggaaaatcagggaaatatttttctgaaaa ttggaaTATCAGGGAAAtactttttatgaaaatttgaaaattggaaatat tttttctgaaaattggagtcaaggaagttttttttcttctgaaaattgga ATCAGGAAAAtacttcttttgaaaatttgaaaatcagggaaatatttttt tcaaaatttggaaaatcagggaagtattttttgcaaaagttggaaaatca ggaaaaattattaaaaaaaaattgaaaatcagggaaatattttttaaggg tAACATTTTTCTGAAAATTGGAATCAGGGAAATATTTTTTCTGAAAATTG GAATCATggaaatattttttctgtaaattggAATCAGGGAAAtacttttt atgaaaattggaaaatcagagaaattttttttctaaaaattggaaaatca gggaaatttctttttcataaattggaaaatcagtgaaatatttttttcaa aaattggaaaatcagggaaatattttttcaaaaattggaaaatcaggaaa atatttatttcaaaattggggAAATAtatattctttcaaaaaaacttgga AATCTTTCCCAAAAATCAGAAGATCGGagaagaagtatttttttccaaaa tttggaaaatcaaggaaatattttttgggagatattttacctaaaaatca ggaaatccgaaaatatttttttcatatactgtatttacattggaaaattt ggggaaatgTTTCTTCTAAATATCGGAGAAACTGGAAAATTGgacaaaat ttctcaaaaatgaaaaaatatgtacaGAAAGTTGTACAAAAAGTGTGTAA AAGTCAATGACCAAATGCATGAATTTCATGTTCAATgcacggttagtgta aaacgcaggtcacaggttacaggtcacaggtcaacaaagtgcagaccgga gaaaaaaataagatcataacatatacataacataacatcaatacatcaTA GCAtgtattacaaaaaagtaatacatgctatttagatattataaaatgac aattgaatagaataacaacctattttgaccTAGTGACACaattacttaca aaaataatgacaaaatcataaaatatgataccatatataaaatatttatt atacaaaatgtgatgtggatggtgtgaatggataaaaaaaggcatcaaac agaagcttgtgaggtccctaagagagtagttttagaaggatgaaactaat taatcattcaattgttattttaatgacttaatgacaatttttgacaaaaa tattgacagaatcacatatcatgtcttacaagagaaaaacaccaaaaata tttagcataccgaatgtgatgataactatatggctggatataaaattaca ccaatcagaagctcgtgagttctctgagaaggtagtttatttagagcgat gtgttttattatatgtaaccatcatataacattacaaacattacaatatg taatatacagCAAActgcgcaaactgcgaaagatcgataaaagcacatgg ttaaattttgatgtttgaaatggtttttatATGGATgtaattgcttgaga attatgtttttgatagttctttgtgttttccaaacattttcctctgcaat gacattgattagagtcaacctgtcatcactgacctgtgacctgcaacctg tgacctgcgttttacactaaccgttcAATGCATGAGAGTTTGCACCTCTG CTTCAAACTGAAGAAATCTTTTTACCATGAAATAGCCCTTCAAAATGggc caaaaaagttttgcaATAATTTCCCAATTTTCCTAGATCAAAATTCATGG ACATGTATGTGGTAACctgtaaaataaatatttttgaactgTTTTTCAGC TAGGTcaagccatttttcatgcccatCGGACCCTGCCCCTCCTGAAAAAC ACTAAAATGTTGGTAAAAAtagcctttttagtggaaaaacaccggaaaaa gtgccctttttggccatcAACGGACGCTGCCTTGGCTTTATAAAATATGG CCTgtaggtaaatctattttaaaagaCCTACGTTCCAGGCAGGTCACTTG GTTTGCAAGTTGCAACTGCAAGCAATAATGTACAAGCATACTAAGGCTCg gatttgcaaaaaaaatgagCATAGTGCTAAGCATAGCTCGAAGCCGGGGA AAGTCATCATTTTGATTTTACAATCTTATATTTTGActtacaaaatttga catataatataaaataagaatataaacagtcattgtaaaaagtaaaagtg aaattgaaatttgccaaaattgacaacgttttgaaaaaacttctgTATAA CCAAGcatttgaggctcaaaatgaAATCTTAAGCAAACGCAAATTAAAAA CAGAAGAGGTCCGAGGACTGTGCCTTGAGGAACTCCAGAGATaacattag ctttttcagatgtCTCACCGTTAATAACAACAGTTTGGGTGCAATTGGAG AGGTAGTTAGTGATCCATTCAAGGGTTTTACTTCTTACGCCTTGGTGATG AAGTTTTAATTGGGTCTGCCTATTGAGTAGACTGATAGGATCAGAAAGaa tgaatgaaaatatttatcaaTCCTTTCTCTCTCTTGAGTTTCAGCAAATT AGCTCTTTTTATTTACTGACCAGTGGttaaatctgaaatttttagatttt ttcaataccATCTAGGGAGATGAAGATCAAAATCCCACAAAAGATGAGAC AGAAGTCGCTAAATATCTACGCTTTAATCTGCCAACCAAGAAAGCAACAC TCTTTGGAGAAAAAgcagtgtatttctcaggtaggtttcttgtatttttt tgctgaaattgcGTTCACATAAAGATTCTAAATGTGAACTTTCACTATTT TATATTTCTTGCTTTCTTGTCCAACTTGAcataaaaaatgatatttgttA GTTTAACCCAACGGAATTCAGATAAAAATTTCATGTGTATGAAAATGGAT TTTTCTATGATGGATTAGTGTTATTTCTTATAGGATCAAATGCTGTCGAC TTTTTGATGGACTCAAAATGGGCTAGTGGAAAAGGCAAATCAAGTATTGA GTTCACACACAGGGATTCTGTTGCCGATTACTTACGAAGGTATATAACAT TTTACACCATGTACTGGGACTCCTTTGTCCAAGGAAAAATTGGCCTAAAA CTACTCAAATTTTGACTCTAaggattttatcaaataaataattAACTTCC CTTGTATAATTTCATACTTAAGCTTAAAAAAAAACCTCACAAGATATCTC TTTTTATTcttatttaaatgtttttaaaattatcactttagatttctttt catttttccaggatGTTAAATTGTCAACTATTCAGCCGTGTACACGTTAT AAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACAAAAAGTCTG AAGAAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaagatacaaaa agtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGTCttcgaaaaaat gtttttgctttcCTCTCATGATTTAAACTATGAACAAGTTATAGGGATTA CTAATTACTTTTAAGTAAGGTCTGAACTAACATGCAAATCTTTTCCATAC TTTTTTGGTCAAACATTGAACAGATTAGTGAAAAGTTTTCTTTAATTCTA TTTCTAGGAGGGTAAAGAagcaagaaaaatcaaaaagaaggtATGTCATC TTGATAATATTCTAACTCTGTACTGACACTAAAGAAGTCTTCTTCTTAAA ACTACATGGTATGTCATTAATTGACGCATTGACAGAGAAAGTATATTACA TAAGGATAGATACGGATTATCtacatttcattttcattatgtATAGATTT GGTTTAGTAGTAAGTTtgtgaccgcagtcgagggcgatcCGTAGGCTtcc ttttctctagctgtctatCCAAATGTAAGGGAGGGTActactcctttccc tggatttctccccTTACCCTTGGTCTGTCTTTTAGAtgctgagcatcaag ctgaGAGGCACCAAGTaacattttgggaatctttggtgtgACCCTTCTGG GAAGcaaacccacaaccttgcgcaccgtagctggatgctctgcTTTCATG CTACGATCGCTAAATTAttaaatttgctttttaaaCATAGATACACAAAA GCATAGTAAAAAGAGATACTCGCGtcacatttttcttcatttttaggtCA AGGTGACACTGGAAGTGAATGATATTCAGGAATTTTTCGATTCTGATGAA GAGGTGATGACTGATGCATAATATTTCgtaaaaatttcacttttcaatGT CTTGCCTAAGGTTTCTGAGGAAAGCTACATGCTGAAATTTCTACCTTATt aattacacgaatattactagtcattttattaacacaaattgaaaaatttt gtgttaataaaaacccccttaattaaaaccagccgctgtttcctttaaaa agcagaaaaatttgtgttaatttgaaaacatgcaaatttcaaggccgtta aatacttacctagtaatatttgtgtaataaggtaatttAAATTGCTTTAC TTTTTGTTTGTTATAGATAATTTAGCGTTATATTATCGTTTTGTACTTTG TACTTTTTATCTAGTTTTATGTATGGATATTTGACCCTATCAGTTGGAAG ACTTTCATCCTTGGTATCATGCTGGGTAAGCTCCTTTTTATTTTGCCATT TCAATATGAGTTTTCAAAGATTATGGGCAATGATTTCCAGATTTGTGTTT AATCAAATTGGAAAATGAGAATTAGGTAGGAAAGTACAATACGAACTTTT TATCTTTAAAGTGTTCTGAGCTCTTTCCTCTCAGACAGAGGTTTCTTTCT TAGCGAAGTTAAAAAAGATTGTTGGATTCCGTATCAAGATCTATATTGTT TTCCTAATATCTTTCAAATGACTTTTACAATGTTAATGACTTTAACAGTG CAATTTCAaaatcgttcgttcgttcgttcgttcgttcgttcgttcgttcg ttcgttcgttcgttcgttcgttcgttttgTTCAATAATGGAAAGACAAGT ATTTACATTCATTTATCATTCAGTTTTGTTAATACAATGTTGAAAGGTAC CAAATAATATTAGACGAACTTTTATAGAGTTTTTTATTGATTATTCTACT TGAATTTCtgtcattttaaatttttttagttcTTGGAGTTGTTATTGTTT GTTTGTTCCCATTATGGCCTGAAAGTGTTCGTGATTACAGTTGGTATTTA TCTGTAGCTGGAGCCATTTTTGTTGGTGGAATACTTATTCTTGCTATTTG TAAGTCGTGTttccttttaaatttgaaaagaatattttaatgTGTATTCT GATCTCATTCGAACTTAAAGTGATATGTTAGTACAGTattagtctcttta actcgaacctctataactcgaatgtctccttaacttggACAAGTTTTCTT GTCCCTTCAGTGTCACATAAACCTTACTTTATAACTCGAAATATTCTTAA CCCAAACAAGTTTTCTcgccccttcagttaacaatgccttataaacctta ctccataacttgaaatttcctgaactcgaacaaatttgtgtcccCCCTGT GGGTTCTATCCTGTTGATTGAAAACTCATTGAAAGACGTGTATGTACTCT TTCTTCAGTACGTTATATTATTTATGGATTGTTATGGCTTGGCACAATGG GTAAATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGTGTGGATTC TTTGAGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaagaagaaaa aaaagaagacaaatcTATTGACGGTGACGACAAAGACAAAGCAAAAGAAT CTTTGGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAGACTGGGTC AAAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAAGAGGTTTT GTCTTAATCACATGGTTTgattatttgttttgattggatcattgtttact tatcttattacacttatataactaCTAAAGTTATTAACGTGCATTGGTTA TCCTCACGTTAACTACAACTGCTTAACAAATTTCTAGTCAAGGTAATTCT GCGTTATTTAGctatataagtgtaataagaTTAACTTATACTGAATTGTC TCCGTTAGACCTATtgtctctcctttttttttaaaaagacaatGAATTTC TTTAATAATGCATTCATACCCCCCTCCCTGTTTCATATTGACACCATTCC ccaaaaagctcaaaaaattcTCAGTCGCGCAAAACAGCGTCCATCATAGT CTAGTTTGCTTCTTTAGTTAAAAATGTTCCTGCTTTTTATCGTCTCCGTA AGGAAAATtataaatattatcaaaataacaatggaaagaaaaattattta ggAATTAGAAATAGTAGATTTTTaggatattttgttttttccatcttttt ttttttttgcctttttagttttataattatttatttttagtagTAAAAAG GTGTTCTCTCTGCTATACTGCATCGATTTTCATTGATGTTTATACAGCTT TGTCACCTTCAGAGATTTTTGTACTTCTCGTTTTTTCTCTGCTTTTAACC ATTATGAAAGCTTGATAAAAAGGAGAATacaatttgtaacttttttagaa aaaaaagaattcgaTATTATATTTCACATCAGTTTATTTTAAGTGTACTT CTTTTTAGCAAAGAGTGTGTCTAAGTATGTTCAAAATTTaggattttcaa tatttttccttTATTAAGATATCGA

Coding sequence (CDS) from alignment at sc0000001:1630935..1638159+

>TCONS_00000072 ID=TCONS_00000072|Name=TCONS_00000072|organism=Clytia hemisphaerica|type=CDS|length=9477bp|location=Sequence derived from alignment at sc0000001:1630935..1638159+ (Clytia hemisphaerica)
CTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaacacattGCAATA
CAAGATGGCggacaaaaagtccaaaaagaGAAGGaagGGAGATGAAGATC
AAAATCCCACAAAAGATGAGACAGAAGTCGCTAAATATCTACGCTTTAAT
CTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAAAgcagtgtatttctc
agGATCAAATGCTGTCGACTTTTTGATGGACTCAAAATGGGCTAGTGGAA
AAGGCAAATCAAGTATTGAGTTCACACACAGGGATTCTGTTGCCGATTAC
TTACGAAGgatGTTAAATTGTCAACTATTCAGCCGTGTACACGTTATAAA
GACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACAAAAAGTCTGAAG
AAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaagatacaaaaagt
CCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGAGGGTAAAGAagcaag
aaaaatcaaaaagaaggtCAAGGTGACACTGGAAGTGAATGATATTCAGG
AATTTTTCGATTCTGATGAAGAGTTTTATGTATGGATATTTGACCCTATC
AGTTGGAAGACTTTCATCCTTGGTATCATGCTGGttcTTGGAGTTGTTAT
TGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTCGTGATTACAGTTGGT
ATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGAATACTTATTCTTGCT
ATTTTACGTTATATTATTTATGGATTGTTATGGCTTGGCACAATGGGTAA
ATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGTGTGGATTCTTTG
AGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaagaagaaaaaaaa
gaagacaaatcTATTGACGGTGACGACAAAGACAAAGCAAAAGAATCTTT
GGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAGACTGGGTCAAAG
TGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAAGAGGTTTTGTCT
TAACTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaacacattGCA
ATACAAGATGGCggacaaaaagtccaaaaagaGAAGGaagGGAGATGAAG
ATCAAAATCCCACAAAAGATGAGACAGAAGTCGCTAAATATCTACGCTTT
AATCTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAAAgcagtgtattt
ctcagGATCAAATGCTGTCGACTTTTTGATGGACTCAAAATGGGCTAGTG
GAAAAGGCAAATCAAGTATTGAGTTCACACACAGGGATTCTGTTGCCGAT
TACTTACGAAGgatGTTAAATTGTCAACTATTCAGCCGTGTACACGTTAT
AAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACAAAAAGTCTG
AAGAAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaagatacaaaa
agtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGAGGGTAAAGAagc
aagaaaaatcaaaaagaaggtCAAGGTGACACTGGAAGTGAATGATATTC
AGGAATTTTTCGATTCTGATGAAGAGTTTTATGTATGGATATTTGACCCT
ATCAGTTGGAAGACTTTCATCCTTGGTATCATGCTGGttcTTGGAGTTGT
TATTGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTCGTGATTACAGTT
GGTATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGAATACTTATTCTT
GCTATTTTACGTTATATTATTTATGGATTGTTATGGCTTGGCACAATGGG
TAAATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGTGTGGATTCT
TTGAGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaagaagaaaaa
aaagaagacaaatcTATTGACGGTGACGACAAAGACAAAGCAAAAGAATC
TTTGGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAGACTGGGTCA
AAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAAGAGGTTTTG
TCTTAACTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaacacatt
GCAATACAAGATGGCggacaaaaagtccaaaaagaGAAGGaagGGAGATG
AAGATCAAAATCCCACAAAAGATGAGACAGAAGTCGCTAAATATCTACGC
TTTAATCTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAAAgcagtgta
tttctcagGATCAAATGCTGTCGACTTTTTGATGGACTCAAAATGGGCTA
GTGGAAAAGGCAAATCAAGTATTGAGTTCACACACAGGGATTCTGTTGCC
GATTACTTACGAAGgatGTTAAATTGTCAACTATTCAGCCGTGTACACGT
TATAAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACAAAAAGT
CTGAAGAAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaagataca
aaaagtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGAGGGTAAAGA
agcaagaaaaatcaaaaagaaggtCAAGGTGACACTGGAAGTGAATGATA
TTCAGGAATTTTTCGATTCTGATGAAGAGTTTTATGTATGGATATTTGAC
CCTATCAGTTGGAAGACTTTCATCCTTGGTATCATGCTGGttcTTGGAGT
TGTTATTGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTCGTGATTACA
GTTGGTATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGAATACTTATT
CTTGCTATTTTACGTTATATTATTTATGGATTGTTATGGCTTGGCACAAT
GGGTAAATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGTGTGGAT
TCTTTGAGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaagaagaa
aaaaaagaagacaaatcTATTGACGGTGACGACAAAGACAAAGCAAAAGA
ATCTTTGGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAGACTGGG
TCAAAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAAGAGGTT
TTGTCTTAACTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaacac
attGCAATACAAGATGGCggacaaaaagtccaaaaagaGAAGGaagGGAG
ATGAAGATCAAAATCCCACAAAAGATGAGACAGAAGTCGCTAAATATCTA
CGCTTTAATCTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAAAgcagt
gtatttctcagGATCAAATGCTGTCGACTTTTTGATGGACTCAAAATGGG
CTAGTGGAAAAGGCAAATCAAGTATTGAGTTCACACACAGGGATTCTGTT
GCCGATTACTTACGAAGgatGTTAAATTGTCAACTATTCAGCCGTGTACA
CGTTATAAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACAAAA
AGTCTGAAGAAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaagat
acaaaaagtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGAGGGTAA
AGAagcaagaaaaatcaaaaagaaggtCAAGGTGACACTGGAAGTGAATG
ATATTCAGGAATTTTTCGATTCTGATGAAGAGTTTTATGTATGGATATTT
GACCCTATCAGTTGGAAGACTTTCATCCTTGGTATCATGCTGGttcTTGG
AGTTGTTATTGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTCGTGATT
ACAGTTGGTATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGAATACTT
ATTCTTGCTATTTTACGTTATATTATTTATGGATTGTTATGGCTTGGCAC
AATGGGTAAATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGTGTG
GATTCTTTGAGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaagaa
gaaaaaaaagaagacaaatcTATTGACGGTGACGACAAAGACAAAGCAAA
AGAATCTTTGGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAGACT
GGGTCAAAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAAGAG
GTTTTGTCTTAACTAGATCTACGGTCCTTTCCAAGAccacaaaataaaaa
cacattGCAATACAAGATGGCggacaaaaagtccaaaaagaGAAGGaagG
GAGATGAAGATCAAAATCCCACAAAAGATGAGACAGAAGTCGCTAAATAT
CTACGCTTTAATCTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAAAgc
agtgtatttctcagGATCAAATGCTGTCGACTTTTTGATGGACTCAAAAT
GGGCTAGTGGAAAAGGCAAATCAAGTATTGAGTTCACACACAGGGATTCT
GTTGCCGATTACTTACGAAGgatGTTAAATTGTCAACTATTCAGCCGTGT
ACACGTTATAAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTGACA
AAAAGTCTGAAGAAAAAGCAATCGAAGAGAAGaagtcagaaaataaaaaa
gatacaaaaagtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGAGGG
TAAAGAagcaagaaaaatcaaaaagaaggtCAAGGTGACACTGGAAGTGA
ATGATATTCAGGAATTTTTCGATTCTGATGAAGAGTTTTATGTATGGATA
TTTGACCCTATCAGTTGGAAGACTTTCATCCTTGGTATCATGCTGGttcT
TGGAGTTGTTATTGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTCGTG
ATTACAGTTGGTATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGAATA
CTTATTCTTGCTATTTTACGTTATATTATTTATGGATTGTTATGGCTTGG
CACAATGGGTAAATTACATTTCTGGCTGCTACCAAACTTGACGGCTGAGT
GTGGATTCTTTGAGTCGTTTGTTCCTGCTTACCAATACACTgttaagaaa
gaagaaaaaaaagaagacaaatcTATTGACGGTGACGACAAAGACAAAGC
AAAAGAATCTTTGGAGAATGAAGatgaaagtgaaaaaagtgAGAATGGAG
ACTGGGTCAAAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAGGAA
GAGGTTTTGTCTTAACTAGATCTACGGTCCTTTCCAAGAccacaaaataa
aaacacattGCAATACAAGATGGCggacaaaaagtccaaaaagaGAAGGa
agGGAGATGAAGATCAAAATCCCACAAAAGATGAGACAGAAGTCGCTAAA
TATCTACGCTTTAATCTGCCAACCAAGAAAGCAACACTCTTTGGAGAAAA
AgcagtgtatttctcagGATCAAATGCTGTCGACTTTTTGATGGACTCAA
AATGGGCTAGTGGAAAAGGCAAATCAAGTATTGAGTTCACACACAGGGAT
TCTGTTGCCGATTACTTACGAAGgatGTTAAATTGTCAACTATTCAGCCG
TGTACACGTTATAAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAACCTG
ACAAAAAGTCTGAAGAAAAAGCAATCGAAGAGAAGaagtcagaaaataaa
aaagatacaaaaagtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAAGGA
GGGTAAAGAagcaagaaaaatcaaaaagaaggtCAAGGTGACACTGGAAG
TGAATGATATTCAGGAATTTTTCGATTCTGATGAAGAGTTTTATGTATGG
ATATTTGACCCTATCAGTTGGAAGACTTTCATCCTTGGTATCATGCTGGt
tcTTGGAGTTGTTATTGTTTGTTTGTTCCCATTATGGCCTGAAAGTGTTC
GTGATTACAGTTGGTATTTATCTGTAGCTGGAGCCATTTTTGTTGGTGGA
ATACTTATTCTTGCTATTTTACGTTATATTATTTATGGATTGTTATGGCT
TGGCACAATGGGTAAATTACATTTCTGGCTGCTACCAAACTTGACGGCTG
AGTGTGGATTCTTTGAGTCGTTTGTTCCTGCTTACCAATACACTgttaag
aaagaagaaaaaaaagaagacaaatcTATTGACGGTGACGACAAAGACAA
AGCAAAAGAATCTTTGGAGAATGAAGatgaaagtgaaaaaagtgAGAATG
GAGACTGGGTCAAAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTCCAG
GAAGAGGTTTTGTCTTAACTAGATCTACGGTCCTTTCCAAGAccacaaaa
taaaaacacattGCAATACAAGATGGCggacaaaaagtccaaaaagaGAA
GGaagGGAGATGAAGATCAAAATCCCACAAAAGATGAGACAGAAGTCGCT
AAATATCTACGCTTTAATCTGCCAACCAAGAAAGCAACACTCTTTGGAGA
AAAAgcagtgtatttctcagGATCAAATGCTGTCGACTTTTTGATGGACT
CAAAATGGGCTAGTGGAAAAGGCAAATCAAGTATTGAGTTCACACACAGG
GATTCTGTTGCCGATTACTTACGAAGgatGTTAAATTGTCAACTATTCAG
CCGTGTACACGTTATAAAGACTGAAAAGAAAGTCAAGAAAAAAGATGAAC
CTGACAAAAAGTCTGAAGAAAAAGCAATCGAAGAGAAGaagtcagaaaat
aaaaaagatacaaaaagtCCAAAGGAGCCAAACAGCCCCAAAGCTAAAAA
GGAGGGTAAAGAagcaagaaaaatcaaaaagaaggtCAAGGTGACACTGG
AAGTGAATGATATTCAGGAATTTTTCGATTCTGATGAAGAGTTTTATGTA
TGGATATTTGACCCTATCAGTTGGAAGACTTTCATCCTTGGTATCATGCT
GGttcTTGGAGTTGTTATTGTTTGTTTGTTCCCATTATGGCCTGAAAGTG
TTCGTGATTACAGTTGGTATTTATCTGTAGCTGGAGCCATTTTTGTTGGT
GGAATACTTATTCTTGCTATTTTACGTTATATTATTTATGGATTGTTATG
GCTTGGCACAATGGGTAAATTACATTTCTGGCTGCTACCAAACTTGACGG
CTGAGTGTGGATTCTTTGAGTCGTTTGTTCCTGCTTACCAATACACTgtt
aagaaagaagaaaaaaaagaagacaaatcTATTGACGGTGACGACAAAGA
CAAAGCAAAAGAATCTTTGGAGAATGAAGatgaaagtgaaaaaagtgAGA
ATGGAGACTGGGTCAAAGTGAAGAAAGATGATGCCGAAGAAGATGGTGTC
CAGGAAGAGGTTTTGTCTTAACTAGATCTACGGTCCTTTCCAAGAccaca
aaataaaaacacattGCAATACAAGATGGCggacaaaaagtccaaaaaga
GAAGGaagGGAGATGAAGATCAAAATCCCACAAAAGATGAGACAGAAGTC
GCTAAATATCTACGCTTTAATCTGCCAACCAAGAAAGCAACACTCTTTGG
AGAAAAAgcagtgtatttctcagGATCAAATGCTGTCGACTTTTTGATGG
ACTCAAAATGGGCTAGTGGAAAAGGCAAATCAAGTATTGAGTTCACACAC
AGGGATTCTGTTGCCGATTACTTACGAAGgatGTTAAATTGTCAACTATT
CAGCCGTGTACACGTTATAAAGACTGAAAAGAAAGTCAAGAAAAAAGATG
AACCTGACAAAAAGTCTGAAGAAAAAGCAATCGAAGAGAAGaagtcagaa
aataaaaaagatacaaaaagtCCAAAGGAGCCAAACAGCCCCAAAGCTAA
AAAGGAGGGTAAAGAagcaagaaaaatcaaaaagaaggtCAAGGTGACAC
TGGAAGTGAATGATATTCAGGAATTTTTCGATTCTGATGAAGAGTTTTAT
GTATGGATATTTGACCCTATCAGTTGGAAGACTTTCATCCTTGGTATCAT
GCTGGttcTTGGAGTTGTTATTGTTTGTTTGTTCCCATTATGGCCTGAAA
GTGTTCGTGATTACAGTTGGTATTTATCTGTAGCTGGAGCCATTTTTGTT
GGTGGAATACTTATTCTTGCTATTTTACGTTATATTATTTATGGATTGTT
ATGGCTTGGCACAATGGGTAAATTACATTTCTGGCTGCTACCAAACTTGA
CGGCTGAGTGTGGATTCTTTGAGTCGTTTGTTCCTGCTTACCAATACACT
gttaagaaagaagaaaaaaaagaagacaaatcTATTGACGGTGACGACAA
AGACAAAGCAAAAGAATCTTTGGAGAATGAAGatgaaagtgaaaaaagtg
AGAATGGAGACTGGGTCAAAGTGAAGAAAGATGATGCCGAAGAAGATGGT
GTCCAGGAAGAGGTTTTGTCTTAACTAGATCTACGGTCCTTTCCAAGAcc
acaaaataaaaacacattGCAATACAAGATGGCggacaaaaagtccaaaa
agaGAAGGaagGGAGATGAAGATCAAAATCCCACAAAAGATGAGACAGAA
GTCGCTAAATATCTACGCTTTAATCTGCCAACCAAGAAAGCAACACTCTT
TGGAGAAAAAgcagtgtatttctcagGATCAAATGCTGTCGACTTTTTGA
TGGACTCAAAATGGGCTAGTGGAAAAGGCAAATCAAGTATTGAGTTCACA
CACAGGGATTCTGTTGCCGATTACTTACGAAGgatGTTAAATTGTCAACT
ATTCAGCCGTGTACACGTTATAAAGACTGAAAAGAAAGTCAAGAAAAAAG
ATGAACCTGACAAAAAGTCTGAAGAAAAAGCAATCGAAGAGAAGaagtca
gaaaataaaaaagatacaaaaagtCCAAAGGAGCCAAACAGCCCCAAAGC
TAAAAAGGAGGGTAAAGAagcaagaaaaatcaaaaagaaggtCAAGGTGA
CACTGGAAGTGAATGATATTCAGGAATTTTTCGATTCTGATGAAGAGTTT
TATGTATGGATATTTGACCCTATCAGTTGGAAGACTTTCATCCTTGGTAT
CATGCTGGttcTTGGAGTTGTTATTGTTTGTTTGTTCCCATTATGGCCTG
AAAGTGTTCGTGATTACAGTTGGTATTTATCTGTAGCTGGAGCCATTTTT
GTTGGTGGAATACTTATTCTTGCTATTTTACGTTATATTATTTATGGATT
GTTATGGCTTGGCACAATGGGTAAATTACATTTCTGGCTGCTACCAAACT
TGACGGCTGAGTGTGGATTCTTTGAGTCGTTTGTTCCTGCTTACCAATAC
ACTgttaagaaagaagaaaaaaaagaagacaaatcTATTGACGGTGACGA
CAAAGACAAAGCAAAAGAATCTTTGGAGAATGAAGatgaaagtgaaaaaa
gtgAGAATGGAGACTGGGTCAAAGTGAAGAAAGATGATGCCGAAGAAGAT
GGTGTCCAGGAAGAGGTTTTGTCTTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000037XLOC_000037Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000072-proteinTCONS_00000072-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000072-exon-sc0000001-1491911889:1630935..1631021TCONS_00000072-exon-sc0000001-1491911889:1630935..1631021Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1510915933:1630935..1631021TCONS_00000072-exon-sc0000001-1510915933:1630935..1631021Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1575043694:1630935..1631021TCONS_00000072-exon-sc0000001-1575043694:1630935..1631021Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1491911889:1634050..1634164TCONS_00000072-exon-sc0000001-1491911889:1634050..1634164Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1510915933:1634050..1634164TCONS_00000072-exon-sc0000001-1510915933:1634050..1634164Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1575043694:1634050..1634164TCONS_00000072-exon-sc0000001-1575043694:1634050..1634164Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1491911889:1634368..1634473TCONS_00000072-exon-sc0000001-1491911889:1634368..1634473Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1510915933:1634368..1634473TCONS_00000072-exon-sc0000001-1510915933:1634368..1634473Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1575043694:1634368..1634473TCONS_00000072-exon-sc0000001-1575043694:1634368..1634473Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1491911889:1634696..1634870TCONS_00000072-exon-sc0000001-1491911889:1634696..1634870Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1510915933:1634696..1634870TCONS_00000072-exon-sc0000001-1510915933:1634696..1634870Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1575043694:1634696..1634870TCONS_00000072-exon-sc0000001-1575043694:1634696..1634870Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1491911889:1635042..1635074TCONS_00000072-exon-sc0000001-1491911889:1635042..1635074Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1510915933:1635042..1635074TCONS_00000072-exon-sc0000001-1510915933:1635042..1635074Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1575043694:1635042..1635074TCONS_00000072-exon-sc0000001-1575043694:1635042..1635074Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1491911889:1635581..1635637TCONS_00000072-exon-sc0000001-1491911889:1635581..1635637Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1510915933:1635581..1635637TCONS_00000072-exon-sc0000001-1510915933:1635581..1635637Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1575043694:1635581..1635637TCONS_00000072-exon-sc0000001-1575043694:1635581..1635637Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1491911889:1635999..1636059TCONS_00000072-exon-sc0000001-1491911889:1635999..1636059Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1510915933:1635999..1636059TCONS_00000072-exon-sc0000001-1510915933:1635999..1636059Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1575043694:1635999..1636059TCONS_00000072-exon-sc0000001-1575043694:1635999..1636059Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1491911889:1636564..1636683TCONS_00000072-exon-sc0000001-1491911889:1636564..1636683Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1510915933:1636564..1636683TCONS_00000072-exon-sc0000001-1510915933:1636564..1636683Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1575043694:1636564..1636683TCONS_00000072-exon-sc0000001-1575043694:1636564..1636683Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1491911889:1637043..1638159TCONS_00000072-exon-sc0000001-1491911889:1637043..1638159Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1510915933:1637043..1638159TCONS_00000072-exon-sc0000001-1510915933:1637043..1638159Clytia hemisphaericaexon
TCONS_00000072-exon-sc0000001-1575043694:1637043..1638159TCONS_00000072-exon-sc0000001-1575043694:1637043..1638159Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1630935..1638159 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
119.22 125.417 112.412 110.782 99.4873 81.5052 130.278 128.131 80.7131 78.5639 60.4036 54.8334 35.123 30.4159 38.606 35.9148 57.9773 52.3129 21.1033 31.035 59.2544 58.65 86.4226 83.288 51.3837 56.5769 72.3266 60.789 78.9683 73.9145
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR004728Sec62
IPR015943WD40/YVTN_repeat-like_dom
IPR011991WHTH_DNA-bd_dom
Vocabulary: Molecular Function
TermDefinition
GO:0008565protein transporter activity
GO:0005515protein binding
Vocabulary: Biological Process
TermDefinition
GO:0015031protein transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0015031 protein transport
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005515 protein binding
molecular_function GO:0008565 protein transporter activity
Blast
BLAST of TCONS_00000072 vs. Swiss-Prot (Human)
Match: SEC62 (Translocation protein SEC62 OS=Homo sapiens GN=SEC62 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.912e-20
Identity = 58/116 (50.00%), Postives = 81/116 (69.83%), Query Frame = 1
Query:  529 LEVNDIQEFFDSDEEFYVWIFDPISWKTFXXXXXXXXXXXXXXXFPLWPESVRDYSWYLSVAGAIFVXXXXXXXXXXXXXXXXXWLGTMGKLHFWLLPNLTAECGFFESFVPAYQY 876
            LE +D Q F D +E  YVWI+DP+ +KTF++G++LV+ V+   LFPLWP  +R   +YLSV    FV  IL+LA+ R I++ ++WL T G+ HFW LPNLTA+ GF +SF P Y +
Sbjct:  170 LEPHDDQVFLDGNE-VYVWIYDPVHFKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILLLAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTH 284          

HSP 2 Score: 83.5741 bits (205), Expect = 4.992e-17
Identity = 40/78 (51.28%), Postives = 47/78 (60.26%), Query Frame = 1
Query:  106 PTKDETEVAKYLRFNLPTKKATLFGEKAVYFSGSNAVDFLMDSKWASGKGKSSIEFTHRDSVADYLRRMLNCQLFSRV 339
            P+K+E  VAKYLRFN PTK   + G +  YF  S AVD L+DSKWA  K      FT R+SV DY  R+L  Q F R 
Sbjct:   17 PSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRA 94          
The following BLAST results are available for this feature:
BLAST of TCONS_00000072 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SEC622.912e-2050.00Translocation protein SEC62 OS=Homo sapiens GN=SEC... [more]
back to top