TCONS_00000067 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000067
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2129

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000067 ID=TCONS_00000067|Name=|organism=Clytia hemisphaerica|type=transcript|length=2129bp
aggagaagaaaaaaaggaagatatCTTAAATTTTGAGTATATTCAATATG
TTGCATAAATCGGATAACATTGTCAAATCGAAGAGGCAGTGAAATTGAGT
AAACAAGGGGGAGAAACAGATCCTTTTTAACCACAAGGACACAACCGAGG
GATATACGTAcatcttcttcttcaaaaaaaaacaatcaaaaagagGAAAG
AACAGAAAGAGAAAGAGcAATATCGTAGACCGATCACCATCATCACCAGG
GCTCGACCGTGACCACGAAGACCGTAGATTGATTGATAGTCTTGTTCTTA
ACCAACCATCTTCAACTTATCgtgaacaaaagaaaaattgttcaTAGACT
TCAAATAAAACATGCTAGAACAACAAAACGCTCGGACGTTACTCCTAATC
ACGTCAACAGTCATCTACATGTTGTTAGGAGCGGCTGTTTTCAGTGCTCT
AGAATACGATGAACACATTCgacaaaaatcgaaatatcgGAACATCTATA
ACCTACTGCAAAAGAAATATAACATGACCATCGAAGATGTAGAAGAACTG
GCTAATTATCTTCATAAAAGGAGGTCATTGTACCATTCCCTTGATCCCTG
GTCCTTCGCTGGATCTGTTTATTTCACAAGCGTCACTATTACAACTATag
gtTACGGTCATTCAGTTCCACAAACCATCAGCGGACAGATCTTTTGTATG
TTATACGCGTGTATCGGAATCCCATTGAACTTAACCATGTTTCAAGCTAT
CGGGGAGCGTATGGGCGTCTTTATGTCGTACATATTACGTCGCACGAAAC
GTTGTCTAGGTATGAAGAGTACAGAAGTCAACTTGGTTCATCTAGTGGCA
TTTGGAGTCATGATATGGTTTGTTTTTCAATGTTTGGGTGCAGCTGTATT
CAGTTACTACGAGACTTGGTCCTTTTTCAGGTCCTTATATTATTTCTTTG
TTACCTTGACAACCATCGGGTTTGGAGACTTGGTAGCGTTACAGgaaatc
aagaaaaaacatCCAGATAATAACGGATATTATAATCAAAACTTATACGT
TGCTTTGACAATGATTTTGATATACATTGGATTAACAATAGCATCTTCTG
TTATAAACTTATTGGTTATGCGTTTGATGGAATTACAACAGCCGAAAAGA
CGGCGTAGAAACGTGTCATGGAAAAATGgtacaaaatgtaaacattgcaa
atCGAATAAAGCGACAGCATGTGTAGAAGAAGTAGCGAACAGTGTTATGG
AGAATCATTCCGTGATGATTTTACAAAACTTTGAAGAGGAATTAGAATTC
ACGTCCTACAGACAGGTACATGAAACGGAAGATGGTGGAACACCTCCTta
ttaaaatattcttttgttaCTATTCATCATTATTCCCAAAACTTGAGCCT
TACTAACAGGGGGTTTCAGGAGGTATCCGATTCCGTCATTCCGTCATTCC
GTCAATTTTCCCTGATTTCCTTCCGTCAAACCGACAAATGAGAGCCGTAA
GTCCgcgaatttctttttaatttaagttttttgtTGACAATTCCTTTTTT
TAACTTCCACTTAAATTTCGACCAATATAATGCCAAATTCTATATTTCAG
GACAAAAATTACCCAGCTGAATTCCACAATTAGATCCAAATTTTTAGCAA
ATCCGTTATTCCACTAAAAACAGTAAATTCTCCGCCAACCGTGAAACCCT
TTAATCTCTTACCAGAGATTAATTGAGGTTTTATAAGGACTTTGTAAGAA
TACAATTCTGATTTTGATATCATCTTAATTAAAACAGGAATACCTGATAT
TTGAAACATAAGTTGTGTGGCTGTAGTTTATCAAGAGATAAATATCAGAT
AAAAAAGTGGAAAGGTCTAATGTCTGAAAATTGCACTATTTTTGCAAAAG
AACCTTAGAGTAGCAGCAAAATGAGTTCCGGCAAAAGCTTTTTTTTCCGG
CttgttttttacaaattttctgatATTAAAGTACCTCAAAATTACCTTTT
TCTTGGTACCATGACCCAGATCAAAGAAAGTTtgatattttgtattttga
gcTTGGTTTTCTTTTCATCTTGTCTGTgtttagagaaaaaatttattatg
attgaaaaaagaaatatcaaaatatttac
Run BLAST on NCBI

transcript from alignment at sc0000001:1488001..1493698+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000067 ID=TCONS_00000067|Name=TCONS_00000067|organism=Clytia hemisphaerica|type=transcript|length=5698bp|location=Sequence derived from alignment at sc0000001:1488001..1493698+ (Clytia hemisphaerica)
aggagaagaaaaaaaggaagatatCTTAAATTTTGAGTATATTCAATATG TTGCATAAATCGGATAACATTGTCAAATCGAAGAGGCAGTGAAATTGAGT AAACAAGGGGGAGAAACAGATCCTTTTTAACCACAAGGACACAACCGAGG GATATACGTAcatcttcttcttcaaaaaaaaacaatcaaaaagagGAAAG AACAGAAAGAGAAAGAGGTATACGAAAGtgcaatattttttaaatagatt ttttttaacaacTTACCAATAAAAAAAGACTACTCTTCGAATCTTCAACT AGTTTAAGGAGAGTCGTTATTTCAACATCGGAGTTGGCAACATTCGCTAC CTTTCCCATAAAGAGGGAAAGATACAGACAATACATATAAAAGAAGTTCA caatatatcaaaataaaaaagtaagaataattTTTGTGGCTTCAAAGGAA ACATTGAACGTAAACGCACAAAGATTATTTTTGGTTTTGGTgtaaaaatt tattcttttttggaccaaatatttttttgcgtgtGCTAAGAGTTTTATTG GATTATTTTAACACACTGATTCAACATTTCAAACGCCATTGAACTTGGTA CATTGGTATAAATAAATTCACAGCACTtcaattttctattttgaagcAAT ATCGTAGACCGATCACCATCATCACCAGGGCTCGACCGTGACCACGAAGA CCGTAGATTGATTGATAGTCTTGTTCTTAACCAACCATCTTCAACTTATC gtgaacaaaagaaaaattgttcaTAGACTTCAAATAAAACATGCTAGAAC AACAAAACGCTCGGACGTTACTCCTAATCACGTCAACAGTCATCTACATG TTGTTAGGAGCGGCTGTTTTCAGTGCTCTAGAATACGATGAACACATTCg acaaaaatcgaaatatcgGAACATCTATAACCTACTGCAAAAGAAATATA ACATGACCATCGAAGATGTAGAAGAACTGGCTAATTATCTTCATAAAAGG AGGTCATTGTACCATTCCCTTGATCCCTGGTCCTTCGCTGGATCTGTTTA TTTCACAAGCGTCACTATTACAACTATaggtaagaacatttttttacacc tgtttatgatattcatgacgtaatgttttatacggaagcacccaaaaaag aacGGGTGTTTGTNACACCTGTTTATGATATTcacgacgtaatgttttat acggaagcacccaaaaaagtaCGGGTGTTTGTCACTAATGGAACGGGCTG GAACGGCATCGCGCGgaaaaagtgagcgtaggagttaggtaagcatGGGA AGAATTTGTTGGCGACAAGGGCTGAAAAGTTAatgttaatcagcagcctc tcactaACTTTTGTCCGTTCTCCTACGCAGTTCCTATTCTAGGAAACgtc cgccgcctttatgtttccgccctctgacatgattaattaacagactagtt tgctagtctaaatTAACACAATAAAATAGTAGCAAACGCCCTGGCATAAT ATGAATATTATGAAAAACAGATTATTTCGAGGAGACATTCCCAGGGCATT CTCTTTTTACCGCTTATCTGTTTCAAATGAACCACTGCCAAGATCTAATC TACTTCGAAACGATCCTCCCGTACAAGGTTCTCTCGGGAGAAAAGAATAC CccaatcaaataaataaatcctctcACTGTAAGATATAATGCTCTTTTCC CATCCCATAATTTTctaacaatagaattcaaaccccaagtcataaaaaac ctgggaatatcaatccccatcgagttgcAGTTCATTATTTCTACCCCCac tgtttgaaaaaatactacctGGTCTTAGGAAGGGACTTATTTAAAAACAG CTGAAGTCTGTCAGAATCTTTACGATCCGTGTAAGCAGGACTCCGAATCA TTGGTGTAATATACTTGAAAAGCGTCATCCACGCAGTCCTATGAATATAT ACTGCGATGTCAGACAGCGATTCTTAACAGCACACATTCAAAGTATTTga gacatgcgcgataaaattatTATCGCCCGTCCTCAAAGGTTGAATTTCAG AGAAAGCTAAACTATGATGTACACTCGATTTATTATAATGTAAGAGCAGC TATGgagacattttttaaacttcaatTAATACCTTTAGGAGTCGGCAGCT CCGTGCCAGAAATCCCGGTCTGCATAATCATGATATGCACCTTTGCAATT TCTTCCACGgccccaacagctgattggttgaaagtgacatattaactgat tttacgtcacttacaaccaatcagatattgggtccgtgatgtaatgtcaa aaGACATTGTTATGGTGCATATCATTAATcagacaaaaaataatttcaaa ctttgacACCTTGTATGTTTTCCTGTGATGTGACGTATGAACGAAAAGCT TTTAACTTGATAGCAAGGGGAACTAAAAGCCGATTAGCAATCAGATAAAA GATCATACCTCTGTCTGACGTCAATGGTCTCATCGCGCAGCCTTCTGTTT ACAGTTCCATGTTACTGAAAGAGAGAAATATTACTCATACAATAGATCTT GAGCTGAAGTGAGTAGAGAGTAGAGAAAAAGAGTAGGGTAGATTAGCATT GcagtagactagcaaactagtctgttaaatAATAATTTCAGAGAGGGTGG GAACAAAAAGGCGGCGGGCgattgctagaataggagctgtgTAAGAGAac aagcaaaagttggtgagagatTGCTGATTAACATTAACCTTTTAGccccc ttgccgccgacaaaatttcttcctaggCTTCTAAATGCAggacaaaatct tttaaaaacacTTCAAAGTGCTTCTCTTAAACCACTAGCAAGGAAAAATT AGTCAGTTTTTTTACTACACTTTCAACATTTtctaagccttcggatgttc ttaactattttgagtttcaagcctgaaaatgttctaaaTTTCCTTAGAAA TCGGATGTATTTGAGTCCGCAaggtcttaaaatgttcttaacttgttttt accttgttagccatcgaagccttatgttcttagaTGGCCGGAGGGAGCAC TGACCTTGGCGGTCGACGGGGACGTTCCCGCTgaggaccctgtcagatat aaatgtttggtaaatttagaACCCTATCAGAATGAAAAATTTTCCTGCGA AAACTGAACAAAAGTAGACCAAGTTCCTTGAGCagacaaaaatttaaatt tcttatcAATTCCTACTCTataaattgtcaaaaataacCAAACGTCGACC TTGTCAGATAAACATTTTCATAGTTAGAAAATTTGGGACCCTaccagata tcttcagagcctaaaaaagggatcCTTCCCAGCGGCACACCCTTTACCcg attttgcctaagtaaccccccACCCCGGGCTTATGTAGTTTGCTCTTAAA AAGTAACGTGCAACACAAAAgctaaaaatgaccaaaaataggCAAAATGG ACCCACTTTAGAAGGTGTAACTTTTGATcaaacaaaaatctaaaaatcta aaaacgcAGTGTAAAAGTGAgtgtaggagttaggtaagcgtagtaAGAAa atttgtcggcggcaagggctgaaagcccTTAATGGTTAATATGTTAatgt taatcagcagcctctcgcCAACTTTTGATCGCTCTCCTgagcagctccta ttctagcaaacgcccgccgcctttatgttcccgccctctgacatgattaa ttaacagactagtttgctagtctataccatcaggaaagttttaagtttcA GAAGAGTTTCtgatagaaaaaatcttttttttcatcttcattttcaaaat ctttagaTTCTGAAACGTTGAAATCATCCACttcatactatcttttcaac gaggaaCTACTTTTAATCATTTCTCCTTCAAGAGCAATCTATCAAAATTT GCGGACTGTCAATTCTCATAGAACAGATTTCATATGACATTTTGGGAGAA TTCACGAtgaaaaagcttaaaacttTCGATAAAATGCAGTTTTGTAGTAA CCTTAAATTTTGCTTAAACGTCACAgagaaatttcttcattttttcctac acgtttttttcttattagaacaaattatataagaacatatggcttcgatg gctaaaatattaagaacattttaaggcttataactcaaaaagctaagaac atccgaaggcaaATATGTAACATAAATCAtcaccaaaaaaacaaacaaat ctcttcaatttcatttcaggtTACGGTCATTCAGTTCCACAAACCATCAG CGGACAGATCTTTTGTATGTTATACGCGTGTATCGGAATCCCATTGAACT TAACCATGTTTCAAGCTATCGGGGAGCGTATGGGCGTCTTTATGTCGTAC ATATTACGTCGCACGAAACGTTGTCTAGGTATGAAGAGTACAGAAGTCAA CTTGGTTCATCTAGTGGCATTTGGAGTCATGATATGGTTTGTTTTTCAAT GTTTGGGTGCAGCTGTATTCAGTTACTACGAGACTTGGTCCTTTTTCAGG TCCTTATATTATTTCTTTGTTACCTTGACAACCATCGGGTTTGGAGACTT GGTAGCGTTACAGgaaatcaagaaaaaacatCCAGATAATAACGGATATT ATAATCAAAACTTATACGTTGCTTTGACAATGATTTTGATATACATTGGA TTAACAATAGCATCTTCTGTTATAAACTTATTGGTTATGCGTTTGATGGA ATTACAACAGCCGAAAAGACGGCGTAGAAACGTGTCATGGAAAAATGgta caaaatgtaaacattgcaaatCGAATAAAGCGACAGCATGTGTAGAAGAA GTAGCGAACAGTGTTATGGAGAATCATTCCGTGATGATTTTACAAAACTT TGAAGAGGAATTAGAATTCACGTCCTACAGACAGGTACATGAAACGGAAG ATGGTGGAACACCTCCTtattaaaatattcttttgttaCTATTCATCATT ATTCCCAAAACTTGAGCCTTACTAACAGGGGGTTTCAGGAGGTATCCGAT TCCGTCATTCCGTCATTCCGTCAATTTTCCCTGATTTCCTTCCGTCAAAC CGACAAATGAGAGCCGTAAGTCCgcgaatttctttttaatttaagttttt tgtTGACAATTCCTTTTTTTAACTTCCACTTAAATTTCGACCAATATAAT GCCAAATTCTATATTTCAGGACAAAAATTACCCAGCTGAATTCCACAATT AGATCCAAATTTTTAGCAAATCCGTTATTCCACTAAAAACAGTAAATTCT CCGCCAACCGTGAAACCCTTTAATCTCTTACCAGAGATTAATTGAGGTTT TATAAGGACTTTGTAAGAATACAATTCTGATTTTGATATCATCTTAATTA AAACAGGAATACCTGATATTTGAAACATAAGTTGTGTGGCTGTAGTTTAT CAAGAGATAAATATCAGATAAAAAAGTGGAAAGGTCTAATGTCTGAAAAT TGCACTATTTTTGCAAAAGAACCTTAGAGTAGCAGCAAAATGAGTTCCGG CAAAAGCTTTTTTTTCCGGCttgttttttacaaattttctgatATTAAAG TACCTCAAAATTACCTTTTTCTTGGTACCATGACCCAGATCAAAGAAAGT TtgatattttgtattttgagcTTGGTTTTCTTTTCATCTTGTCTGTgttt agagaaaaaatttattatgattgaaaaaagaaatatcaaaatatttac
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000033XLOC_000033Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000067-exon-sc0000001-1491911889:1488001..1488217TCONS_00000067-exon-sc0000001-1491911889:1488001..1488217Clytia hemisphaericaexon
TCONS_00000067-exon-sc0000001-1510915933:1488001..1488217TCONS_00000067-exon-sc0000001-1510915933:1488001..1488217Clytia hemisphaericaexon
TCONS_00000067-exon-sc0000001-1575043694:1488001..1488217TCONS_00000067-exon-sc0000001-1575043694:1488001..1488217Clytia hemisphaericaexon
TCONS_00000067-exon-sc0000001-1491911889:1488647..1489079TCONS_00000067-exon-sc0000001-1491911889:1488647..1489079Clytia hemisphaericaexon
TCONS_00000067-exon-sc0000001-1510915933:1488647..1489079TCONS_00000067-exon-sc0000001-1510915933:1488647..1489079Clytia hemisphaericaexon
TCONS_00000067-exon-sc0000001-1575043694:1488647..1489079TCONS_00000067-exon-sc0000001-1575043694:1488647..1489079Clytia hemisphaericaexon
TCONS_00000067-exon-sc0000001-1491911889:1492220..1493698TCONS_00000067-exon-sc0000001-1491911889:1492220..1493698Clytia hemisphaericaexon
TCONS_00000067-exon-sc0000001-1510915933:1492220..1493698TCONS_00000067-exon-sc0000001-1510915933:1492220..1493698Clytia hemisphaericaexon
TCONS_00000067-exon-sc0000001-1575043694:1492220..1493698TCONS_00000067-exon-sc0000001-1575043694:1492220..1493698Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1488001..1493698 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.0360379 0.0627652 0 0 0 2.23454 4.23346 0.941664 1.25136 0.773877 0.703841 0.622584 0.841659 0 0.453033 0.353574 0 0 0.585938 0 9.87954e-09 0.214976 5.31063e-06 0.503191 0 0.0398659 0.270403 0 0.0417911
Blast
BLAST of TCONS_00000067 vs. Swiss-Prot (Human)
Match: KCNK9 (Potassium channel subfamily K member 9 OS=Homo sapiens GN=KCNK9 PE=1 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.518e-67
Identity = 115/264 (43.56%), Postives = 163/264 (61.74%), Query Frame = 2
Query:  365 LEQQNARTLLLITSTVIYMLLGAAVFSALEYDEHIRQKSKYRNIYNLLQKKYNMTIEDVEELANYLHKRRSLYHSLDPWSFAGSVYFTSVTITTIGYGHSVPQTISGQIFCMLYACIGIPLNLTMFQAIGERMGVFMSYILRRTKRCLGMKSTEVNLVHLVAFGVMIWFVFQCLGAAVFSYYETWSFFRSLYYFFVTLTTIGFGDLVALQEIKKKHPDNNGYYNQNLYVALTMILIYIGLTIASSVINLLVMRLMELQQPKRRR 1156
            +++QN RTL LI  T  Y+L+GAAVF ALE D  +R++ K +     ++ KYN++ ED  +L   + +       +  W FAGS YF    ITTIGYGH+ P T +G+ FCM YA +GIPL L MFQ++GERM  F+ Y+L+R K+C GM++T+V++ ++V  G        C+GAA FS  E WSFF + YY F+TLTTIGFGD VALQ              + LYVA + + I +GLT+  + +NL+V+R + +     RR
Sbjct:    1 MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQ-WKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQ-------TKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERR 256          
The following BLAST results are available for this feature:
BLAST of TCONS_00000067 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KCNK91.518e-6743.56Potassium channel subfamily K member 9 OS=Homo sap... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php