Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000044 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000044
Unique NameTCONS_00000044
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2494

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000044 ID=TCONS_00000044|Name=TCONS_00000044|organism=Clytia hemisphaerica|type=transcript|length=2494bp
CTAGAAAAAACCTAAGGTTAAAAAAAAGATACAATTTCCACATGATGCAT
TCATTATGGATCATTATCGCAGCATCAATATCTATGTGTTCTGCATCTGA
ATGTAGCTTGACAGATTTTGAACTGTACCAACAGACTTGTATGAACAACA
CTTTATATAGCACCTTCAATGAGACAAAGATGTTGGAAGTTATCGAAAAT
TGTTTTCCTTGGATTTCACACAATTTTCCACAATGTTGGCAAGCTGTTCA
CAGCAATATTACAACGAGTAAATGTCAACAAACTTGCCAGTATTTTCAAA
ACCATTGTCCAATGTTAGCGTTGTTTGATTCAACAAAATGTTTCAGTAGA
TGTGTTGTTGGAGCAGAAAATAGGCAGCAGaaatatgaaaatcttttatc
cCTAAACTGCTCACAGAATACTGTCGCCAAAACTTGTGCTGGAAATTTTG
TTTCAAGCTCACATTCATCGGAATGGGCGATCCAGTGgaattatcaaaat
caaaaacaagatAACGAAATAGTGAATACTACATCTGGTTGTGCTCTTTC
TTGTGATAATCAGATTCAAGTATTTCGATCAGGCCAATTGCAAGTTGATG
GACCAATCATATGTTTTTCATTGTTGGGAATAATTGCTTCATCCTTCACC
GTGTTAAGCTTTCTGATTGACTGGAAAAGTCAAAACCGATATCCAGCCCT
TATTCTGTTCATAACGAGCATCTGTTTCATGATGTGTTTTCTTGGTTGGA
TTATTCAATTCTTTGGTGTTGGCAGAAAGATATCTTGTGATCCAACCAAT
CTTCGTAGAAACAAAGAACCAAGGCATGGAGATTCATTTTGGTGTATCCT
ATCTTTCATATTGATTTACTTCTCCGGTTTATCAACCAGTTGTTGGTTCG
TCATTCTGAATTACTCTTGGTACATCTCCTTCCGCACGATGGGATCTATC
AAAACACTGATACAAagcaaaattaaatatttccatTTCTTTGCATGGGG
TATCAGTGGATCGTTCACGTTAATGGCTCTTCTACTGCAAGCTGTTTCAG
CTCACCCCATTACCAATATATGTTTCATTCACCTATCGCATAATCAACAG
CATCTTCATGATGGACTGGTGGCTTTCCCTTTCACTGTCTGTTTGGTGGT
CGGTGAATTTCTATTACTCAAATGTGTAATACAACTAAAGAAACTTCGAA
ATGATTGCAGTATATTTCTGGTCCCAAAagctgtcaaaaatttgaccaaa
acctTCTACAGGATGATTATCTATGGATTAGGAGTGCTGGTGGCATTTAC
GTTACTGGTGTTCATCATGTATTACGAATTCAATATGAGAGAGGAATGGG
AGAAGAAGCATTCCAAGTATATCAGGTGCAGACTTGAAACTGTAAGCCTT
CCAACATCTCTTTCCAAAGAATGTATTCCGCCTGACAAATCAAGATTGCT
TTGTCTTCATTGCTATATTTTGTTGTTACTCCTCATGTCACTTCTTACGA
GCTCGTGGACATGGACATTTGGAACACTAAAGATCTGGAAGAAAGCTTGG
AAAAGACATTTGGAAACAGATAAAGCTAAAGAACGTTTGCAATTTCAAAG
GGCGTGGTACCGACGTATTAACAGCAAGAAAATACAgcCGTTTCTACCAC
CAATCAACCCTCAAAACCCATTGgaggaaaacaaaatcaaattcaTGCAA
CCTGACAAAAGGCTTTCGTTGCCCGACAATTTATTCGTCTCCACTCACCA
AGGTGATAAAAAGAACCGACGACATTCCGACGACATTCGATCAGTTGTCG
AACTATTTTCCATACGTCGAAACACCATGTGTAGCCTGAATTCCGTCATC
TCGAACGAGGTCAGTCTAAAGCCAGTTCATTCTATACAATCTTTTGGGCA
TCTGTCGATCGCTCATAATATACCCTCAAACAGAGGCGCTCCCACAAATC
TAACAGTCATTCAAGTCTATCAAAACCCGACAAATACCGACGAACTACAA
CGTCAGTTTCTAAATAAACCACAAACGACGAATTTGACGAGTGACGAAAT
TCGGCATATACGAGACAGGCTTTATACACCACTGACAACTGCACACAAAG
ATAGCATAATAGCGGACTGTTTACCGTACAACCGGACGGACTTAGAGCCG
GACTTAATCTCAAGTGCAGTTGAATTGAGACAAAGTGTTAGAAATCATGA
ATTTTATAACTCGATTGAATTGATTGAGTCATTAAGTATCCATAGTACGA
AAATTTGAGATAGTGCACCCCTGTATAGAATTGTAATATGAAGATATCTA
ATCCACAGATCCAGAACTATACTCCGAACTTACTCAATAGATTAACAATT
TCGCTACAGAGGACCTGGTCAATGCAGTAGCTTCAGGCGGGGGAGGGGGT
ATTTAACTCCCTTTTTAGAAAGTGATCTGTTTCTAAAACTGACTATTTTC
GTTTCTCTTTATCTGAACAAATTCTTTGAGTTTTTAGTTCTAAG
Run BLAST on NCBI

protein sequence of TCONS_00000044-protein

>TCONS_00000044-protein ID=TCONS_00000044-protein|Name=TCONS_00000044-protein|organism=Clytia hemisphaerica|type=polypeptide|length=751bp
RKNLRLKKRYNFHMMHSLWIIIAASISMCSASECSLTDFELYQQTCMNNT
LYSTFNETKMLEVIENCFPWISHNFPQCWQAVHSNITTSKCQQTCQYFQN
HCPMLALFDSTKCFSRCVVGAENRQQKYENLLSLNCSQNTVAKTCAGNFV
SSSHSSEWAIQWNYQNQKQDNEIVNTTSGCALSCDNQIQVFRSGQLQVDG
PIICFSLLGIIASSFTVLSFLIDWKSQNRYPALILFITSICFMMCFLGWI
IQFFGVGRKISCDPTNLRRNKEPRHGDSFWCILSFILIYFSGLSTSCWFV
ILNYSWYISFRTMGSIKTLIQSKIKYFHFFAWGISGSFTLMALLLQAVSA
HPITNICFIHLSHNQQHLHDGLVAFPFTVCLVVGEFLLLKCVIQLKKLRN
DCSIFLVPKAVKNLTKTFYRMIIYGLGVLVAFTLLVFIMYYEFNMREEWE
KKHSKYIRCRLETVSLPTSLSKECIPPDKSRLLCLHCYILLLLLMSLLTS
SWTWTFGTLKIWKKAWKRHLETDKAKERLQFQRAWYRRINSKKIQPFLPP
INPQNPLEENKIKFMQPDKRLSLPDNLFVSTHQGDKKNRRHSDDIRSVVE
LFSIRRNTMCSLNSVISNEVSLKPVHSIQSFGHLSIAHNIPSNRGAPTNL
TVIQVYQNPTNTDELQRQFLNKPQTTNLTSDEIRHIRDRLYTPLTTAHKD
SIIADCLPYNRTDLEPDLISSAVELRQSVRNHEFYNSIELIESLSIHSTK
I
Run BLAST on NCBI

transcript from alignment at sc0000001:1115592..1154382+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000044 ID=TCONS_00000044|Name=TCONS_00000044|organism=Clytia hemisphaerica|type=transcript|length=38791bp|location=Sequence derived from alignment at sc0000001:1115592..1154382+ (Clytia hemisphaerica)
CTAGAAAAAACCTAAGGTTAAAAAAAAGATACAATTTCCACATGATGCAT TCATTATGGATCATTATCGCAGCATCAATATCTATGTGTTCTGCATCTGA ATGTAGCTTGACAGATTTTGAACTGTACCAACAGACTTGTATGAACAACA CTTTATATAGCACCTTCAATGAGACAAAGATGTTGGAAGTTATCGAAAAT TGTTTTCCTTGGATTTCACACAATTTTCCACAATGTTGGCAAGCTGTTCA CAGCAATATTACAACGAGTAAATGTCAACAAACTTGCCAGTATTTTCAAA ACCATTGTCCAATGTTAGCGTTGTTTGATTCAACAAAATGTTTCAGTAGA TGTGTTGTTGGAGCAGAAAATAGGCAGCAGaaatatgaaaatcttttatc cCTAAACTGCTCACAGGTAtaagttttttaaattaaatgtggaacatatt ttgtatttttccaaatattttcaatcttcaATCATCTAAGAATTAAACGA AGAAGGTACAgacaactctctctaattcgaacctctaacATTCGaacctt tctgtaattcgaactataaTATTGATCCCCTCcagctggaaagtggttta aatttaTTCTTTATAATTCAAATGCTTTTGCAACTCGAAGAAGATTTCTG GCCCCTTCAAGATCCAATTAGAGAAGTCAACTGTATCACCaaaattacgc aaaatttcattaGGAACAATAAAAGCACTACTTGTGTGCTGCGCTTTCTT TGCACACGTTTTCTTTAACATTAAAAGTGTTTTAAAAGCAATTCTTTCTG AcccactttttaaagaaatGCCAGGCATCCTGGATTCAAAACTACTATAA AGATTTCACACTACTATAAACAAAATACTCGATCAAGCAAGCTTTTCCTA GTACCCATCCTGTCCTACTTAATTGAAAATCTTAGGATTTTTAATGTTGT CAATATTTTAGAATACTGTCGCCAAAACTTGTGCTGGAAATTTTGTTTCA AGCTCACATTCATCGGAATGGGCGATCCAGTGgaattatcaaaatcaaaa acaagatAACGAAATAGTGAATACTACATCTGGTTGTGCTCTTTCTTGTG ATAATCAGATTCAAGTATTTCGATCAGGCCAATTGCAAGTTGATGGACCA ATCATATGTTTTTCATTGTTGGGAATAATTGCTTCATCCTTCACCGTGGT GAGTTTGCAAACACGGTTAATttaccttttcgaccgtagtagCCACGTGA ACAGACGCTTGCCATTTGATAACTTCATTCCCCCCTAAACTAAATCCAAC ACCTcttccttttgtatttagatATTCAGAGGGTACTCGATTCCACAATA TTCAAACTTTGTGTCTAAAATTCCgggaatttgaatattttttgtccATC TGTTTTTCCGCAAAATGTTTTGCTCAATTCAATCCAATTTCCGAAGTTCT GTTGGAATTTTCCTCGAATTTTGCCAGTCCGTTTGAAAAAAGGACCGATT CGTGAAACCCTAACTACATCCCGGCTGAAAAAAGTAAtacactttctttt tctttcttttcgaaTTCAGTTAAGCTTTCTGATTGACTGGAAAAGTCAAA ACCGATATCCAGCCCTTATTCTGTTCATAACGAGCATCTGTTTCATGATG TGTTTTCTTGGTTGGATTATTCAATTCTTTGGTGTTGGCAGAAAGATATC TTGTGATCCAACCAATCTTCGTAGAAACAAAGAACCAAGGTAAATGGCCA AATTATTAAAGCTATGGGTGGATTTTCCATAACTGGAACAGGTACGGGGA ACACAGATCtgttcaagttaaggaaatttcgaattatCGAGTAAGGCTCA TAAAAATTGGAGGCCGAACAAAAAAAGCCTTTAAagtgaataaaagtttt gatattttaaatgaaaaaaggtTATTTCAACTTAAAATCACATAAATAAA TAAAGGGGTAGGCGAGGGTAAGGAATATTACAACTCTTTCTTCATGGCTT TCTTGGACTTGACCCCtcactttgaaatttgtttactaaaaaaaacaaTG CGCTAATGTTTTTCATATCTTTTGTTGGGAATCCGGCGATACTCATACAA CGGTCACTAAACGTGTTATTCTAAGTAATTAACTGTACTTGTAATTAACT GTAACTGTGGTGACCGTAGCTTGAttgtagagcatccggctacagAACGC AAGGCTATAGGCTCgataccccccccccaaatggtacatgatgcctctct gcttgatgctcgaCAATTAAAAAAGGGTGAAAGATAAATGgggaaatcca gggaaaggggTGCCCTCCCACTTTCGGGTAGAGAGCGACTGCAGACTTAC ACGCACTGTACCCAGGTCTGTTATTAAATGATTGAATATtttacattatt ttcttttagtttAACAATTTACTCATGGAAACTGATCTACCCTACTAATA TCTCATCTGATGTAATGATTTATGGTAATGGAAATctttctaattaaaaa aatttctcagtCTTGGTCTTTTCCTTTTGGATTTATCCTGGCTGGTGTTA GTGATAACTTGATAACACTTTTAACAGAATCTTCCTTAAAGAGTCATTTT AAATCAGTTTTAAGATATACGTaatcctaaaaataaaaaatgtgtcATAT CCTTGGGTAGATTTTCATACACACAAGGGTCAGTTTGATACTGATCTTCC TTTGGAGTGACAAATAGATTCGTCTACGAAGCGTCAATTCATCAGAAAAT AGTTATAAATCCTTTCTCCCATTTATAATGTTTTCTACCTTTACTTTGTC AATCATTCTTTTTCAGGCATGGAGATTCATTTTGGTGTATCCTATCTTTC ATATTGATTTACTTCTCCGGTTTATCAACCAGTTGTTGGTTCGTCATTCT GAATTACTCTTGGTACATCTCCTTCCGCACGATGGGATCTATCAAAACAC TGATACAAagcaaaattaaatatttccatTTCTTTGCATGGGGTATCAGT GGATCGTTCACGTTAATGGCTCTTCTACTGCAAGCTGTGAGTACActctg attttttgtttttttataagaagcaatttTAAGTTTATGAAGTAGAGTGT TGGCTTATGATTCTTTTGGCCTTGTATGATATCGGTTAGACTgacacgcc agtcgggctggaacggtatcacgcgggaaaagtgagcgtaggagttaggt aagcgtaggaagaaattttgtcagcggcaagggctgaaagcccgACTGGA GCGAAACGCCAGGAAGGAAAAAATCGCTTATCTGAAGCACGGCCGTATTT CGGCGTTGTCGAAATGAATGAACTTTGGGGGAGATTCCTGAAATGAGAAA TGGAAACTTCCGTCAAAGTCGCTGATCTTGTTATTTTGAATTTGGAGGAG TGAGTGATTGGAAGAAAAATGGCTGACTTCtagtggaaatttttatttga aaagatgttttgtttcttttttcttatttgatgAGTCTCTTCTTTGTGTA TGTTGCTTTTCTTCATGGTTCTCTTCGTGCAAAATTCTTGGGCTCAGTTT TGGTTGTTGGTCGCCCCACGCTAAGTGGAAGGAGACCATTAATCTCGGTG CTTTTCCTCGTCCTTAAGACAAAAAAGTGCAAGTTTAGTCACACGATTCG GAATCAAATGTTCGGGGAATCGGGAAATTATTTCCCGCGTCAATTCTTGC ATCAGTTCTATTATCTCCCTTATATTACGCCACGCAATCTTATCATGTAG CATTTGCCTTACATTCTTGTTAGCTCCGTAGTAATTAGCGTACCTGTTTC ATGAAGTTTTTAAATAACGGAGATAATTGGAAGCCTCGTTGAAAGTTTGA GTGCATCTTCAGAATGAATGAttcttcaaatttaaatttatggTTCTTCA TTGACATTATTCCATTCAAATTACCAAACTTTGGGAAGCTGttgaaaaca aacttttttgaatCGCTCTTGAGGTAAACATTTGGAAGATGTGATGTTGG TTTTCCACAAGAAAGAGGAACGAAGAAGGTTTCAATATCTGTGATAACAA ATACAGTATGTCCCAACCAAAGACCACTCACTACACTGCACTACATATGA TGGCAACCTAACCAATGTAGTAATTTCCAGAGCAAGTATACCATGACTTT ACAATTAGCAGATTTGGTGGGCGTAAAATTCTTAATTCAACCGAAAGAAC ATCTATCGCTATCGCAGTATATCCACCTAGCTAcgtacaaaaaaaattga tatggCATGGATTGATATGTACAaagattgaaagattttgtgtAACCATT CTCCAAGTATTAACTAAAAGTCTCTTGAGCAAAACTACAATTGTTTGCTG TCTGACAGttagtctaaacttaaactcctatatcaggattagaaactagg ctagtcatacctcttttatcttttcctttacaacaatacaatgctgacaa gttgacacaacacatttgTACATGTACCACTTCAGCTGTTTATcgaattt ccaccaatgaggttgccgcatNGGTTAGATTAttaacaaagtgccgtaaa caatcattgaataaaagaagaaaagattGCTCAAGTTtctgggtcaccga taaaccattATTCTCCTCACTATTCTTGTACATAGATATTATcgaactca aaaaaaaaaatctggttCACGATCGTGCCCAATAATAAAGACCATTTTTC GATAATTTTACTATACgatattcaatgggtaaaagttggttaataaatcc aataaccaacgaaaacctattgaatatatggtTTATTATATATCTatagg caaaaaccaaaaaaaattaattgtgTCAATAGCCGAACGTTTCACAtaaa cactcccataatcgaacgttcgaatgtttttcttttttgatgattGTCCT AATTACTTTtagtcataaaatttgtttatgaaatcgacaatagatttatt ttaataaatttctttgataaacaacaagagcgacaaaaaaatcaaacttt gaaagcaaaatttgaaaaaagaaatctaCCGTGGTATAACAGTcttggta tatcaggaattattcaatggctgtttttgcgtacaggtatataataaatc tatatattaatagcggtattCTGTATGTCGTTTTGCTGTCTGTCTGTTAT ACTTTCAttttcgcacgcaatgtttttgttcttccaaaagataactttta gttcttgctccacaaattaatttaacgatattcgcgccgttttataaaga ctttgttttgattgatagattagactttttcttttttttctttcttttct tttgttttatgttttcgaatgtaattaacgaccttatttgatttgagaca ttcgaattcttttcaaaacaaaagaaaccttttaaacagaatctgttaaa gaaaaaaacaaatataaaataaaacacaagaatcacatgacaggtttgtt agaacaacagcaacattaaaaatacattcaagagacggtaaaaactaaaa ttctttcttcgtaaaaagggacgtttaaacatgtatgtcgataattattt tgtaaaaagcaacataaaattgcgctatcacgcttttttgtctgcgtatc ctagctgccttccggggggcctatggttgcgagctgactttcggccctgt ccctcggacccttagcagaataaagaggagaagaaacaaggggaATTGTG Tggattttaattcactttttggaactcatttgaccaaatttctatctttc tggggacaaaaagttgaaatttttcctatttttccaattcttagtgggac tgaagtttgattttccgatttttcaaactgccatgtttcaaaaaaggcac cctttaaggccggcacatacccatacccttctcttgcctaagtaccccct cccccgggctgccttttttcgacgaatcgcgtgtcatgtctactatttca ctccgcttatcttgacgtcaaggttttcctaaacatcaagaactacggca aatataacgcgagcgaagcgagaaaaaaaatataatcgcagagccgtctc ggacgtcgctggtcgacggtatggtgtaatttgggaatgccctttctgtt ttctgatcatttttgccacaaaaatctttttcaaaatatggttaaaagat acgtcacccgggagggatagagtcaaactttgaagagaattcttcccttt aattttgatttcatcgtgacACCataccttcccaacatctcaaaggactt taaatgcgttcagcaaatagctaaaccggcgtgcgacgccgggtaccggc tagtaaaTATATAATACGATAAAGATACATCAAATGGAAATAAGAATCCA TAATGCATTTAAGTTGGGAATCTCCATAAGGTCATCATTAAATACTAACC AGTTTTCACTAATATGATGGGATTGTGTTTACAATAAAACAAGCGCGACA CtgattaaaaaatggaaaatactttttatacaaaaaaatactGCATGAAT AAAAACGCCTTGATTTAGTAATAGGAGCAGAATAAAGTTAATACTTCAAG ACATCCACCTTACTAGAAGAAATAATTTCCGGAAGTCGCAATTTTCTTTC ATCTAGTTTTNCTCCCTACTAGAAGAAATAATTTCCGGAAGTCGCAAGAT CCAATTTTCTTTCATctagtttttttgaaaacagaAGATTTTTAGCCTGG TTACAGAAATATCAACCATAATTTTTGTCTCTACGTTTGAGCATAAGATT AGTTTCGTATCGAGCAACTGaaaaatgtctttttcttttaatcCATCAAT TTCGCACAACGAAAAGATcattttcattgtcttttatgGAGCGATGACGT TGATCGGTAGTTTTGGAAACATCATTTCTATCGTCTGTTTGCGAAGGAAG AACCAAactcaaaagaagaaattggaTTTCATTCTCTTATCCCTGAGTAT TAGCGATGTTTTGATGTCTTCAGTTGTTTTCCCAATGACCGctttgaatg tttactggccTGGTAAAGAAGAATACCCAATTGATCCCATTTTGACGAGA AtaagaagttttttaaaaatagctTTGACTTCTTCNCGATGTTTTGATGT CTGCAGTTGTTTTCCCAATGACCGctttgaatgtttactggccTGGTAAA GAAGAATACCCAATTGATCCCATTTTGACGAGAAtaagaagttttttaaa aatagctTTGACTTCTTCATCTTCCCTTACGATTATACAACTCGCTATCA TCAAGTACANTCCGACAAAGCAGTGTGTGGAACAACCATGCAGTCAAATA AATGGATGTTGAACTAATAACTGTCGAACAACTAAGCGATCACTTGTTGG ACAGTGCAACAGCTCAACATTTTTGAGATTTGTCGAACAAATGTACCGTA GAGGAAAATTTGTCAGAATTAATAACCTcagtttgacaacaaaaatttcT GTAACTTTAATTTACATAGAAgagaattattattattattattaaattaC AAGATTGTGTGGCANGCTTCGAATTATGATTGTACTTTCATGGCTGTTAT GCTTTGGTTTTGCGTCTGCAAATCTTTTTACAGAGAAAGAATTTCCATAT TTCACACAGCTTGTCGTCATAACAACCTTGATTACTCTTCCGTTATTTTA TTATCTGATATACAGAGTGTACAAACAGTCTCGCAGTCGTTTAAGTCAAG AACAAGATCGTACGTCAAATGATCCCTCTATCTTAAAAAGATCGACACAT GCAGAGCATAGTAacgcaaatttagaaatttcaatcTCTGAGAGGATAGT CTCCCTCCGTATTGAAGAATCTCTTCCCAAAGAGAGTTCTTCAAGCAACA CATCTAATGTTGAAGCATCGCATGACCAGCCCACGNTTCTgcaatttttt cacaaattaaatttgtgcACGTCAGATGTTACATTTCTCATGTCAGACTG AAATACTTAATTTTGTTCTTAAATTACTACGGTTTAAAGGTGCTCTTCCA CACAAAATAGAATATACATACATGCATACACATCAAAAGTTTTGCATCAT TTTTTTCTGCCAATTTTACTCAATAAAATCATGGGCCGCAGCTTCACTTT AAAAGTGGTAGGGCCATGgtttagtgtctaaggaggtgCGACCATGGTTG GCACNACAAAAAAGATCTTATTGTTTATTGGCTCATATTTCTTTTGTCTT CTCCCAGGTGTTATTGcaaatcgcttatatagagctgGAGTAATTAAAGA TGGTTTTATGGCGCATTTGGTAGTGATGGTTTTCTATGGAAATTCATGCA TAAATCCTTTTTTGTACATCGTTAGTGATCGGGAGATAAGAACTCTTGCT AAACGACTTTTCACGAAAAATAATTGAAGGTATATTTAAGGTATatgcag tggcgttgtgggaaaatttttctggaggggcccaagtcaattttttaatg gcgccccccccccaattttccaaagtggcgcCCCCGTCCACCagtttcta aatttttactAATTCACtagccccttcaaaaaagctccgctggggggccg TGACCAGTCGCCCGACAAAACAGTGTGTGGAACAACCATGCAGTCAAATA AATGGATGTTGAACTAATAACTGTCGAACAACTAAGCGATCACTTGTTGG ACAGTGCAACAGctcaacatttttgaagatttgtCGAACAAATGTACCGT AGAGGAAAATTTGTCAGAATTATTAACCTcagtttgacaacaaaaatttc TGTAACTTTAATTTACATAGAAgagaattattattattattattaaatta CAAGATtgtgtggcaagaaaactctAAAAAAAGGTCAGAATTTACAATAA TTCTCTTCTCACAACAAAAATGCtgcattttttctaaaattatgaatacG TGtacccaaaaacattttttctgtaaaCATGTAAACATAATTCTGAATTT TTTATCAGAGCTATCTCATCACACCACTTAAATTCTgcaattttttcaca aattaaatttgtgcATGTCAGATGTTACATTTCTCATGTCAGACTGAAAT ACTTAATTTTGTTCTTAAATTACTACGGTTTAAAGGTGCTCTTCCACACA AAATAGAATATACATACATGCATACACATCAAAAGTTTTGCATCATTTTT TTCTGCCAATTTTACTCAATAAAATCATGGGCCGCAGCTTCACTTTAAAA GTGGTAGGGCCATGgtttagtgtctaaggaggtgCGACCATGGTTGGcac cgacgggagaaattttggAAAACTAGCCCTTCTAGACTGCCTAAAACAgg tctttttcaaggtttttacgcagaatttagctgaatcagtaaattttctt cttactttgaaaaaaaagtggtCGGGCGAAGGCCCGGGTGCAACCCCCCC CCATCCCCCGCTGCCGCGGAAAATATACtacataataataatataaatct catgaaaattaaacatattttgattttgaaattctaaTGTACGAGCAATG CACCTTAACATTGAATGGTATGTAAGGTTATCAGCAAATGcaaatttttc ctttaaaatattatttcataCTTCACTCACAAACAGTGAATAGTTTAAAC ATTCTAAGGGGGTTCACTATCTTTAAAATCTAATCAGGAAAAGAGTTTGT TTACATGATGTCAATAAgttcaataataataataatcaaaaactgcagca tcaaaacaatatagggaaaactgaataatccttgtacacttttgataatt gtagaaaactgaagctaCATTGCAAATATTTACCTATCTAAGAATgtata aaataacaaaaacaaagaagattCTTGagtgaatgaatatttttgaaaat ttctttcacagggatgatgatctaagattgaaaaATCaatcctgtgaaaa tggtaactataccacatttctacaagaagttgattttttcttcttcattt ttcattttcatttttctttttttttcaaaactttttgcttGATAATTATC CACTCacaattatctttttaaaaagcacaaaactgctatctaattcgaat tctatcaaaagttacaaaagTTACAGtcttttgtctccgctgcaaattat tttgagacagactttattaaactctttttaattaaaacgaggctcaaaaa tgaaGAACAATAAACAATTAAGAATCTTATAGACCGATTTCTCAGCAAAT TATGGTCAAATTAGTAAAGAACAACATGATAAATGGGAATagaataagaa aaattttaggcttaaaatgtcaaaaataaaaacagctaTACCTCATCAAA AttctactggttcttataaaaagagtgcAAGTGACAAGGAATCACATTGT GCAATGACTGAATGACAAACAGCAGTAAGATTAGCAGTTAGACTGGTATA CATTTTTCCCGCATCAAaaccaggttgctaaggctcgAGGGCTCATATTT GCCATTATTTCACCATCTCTTAAAGAAAAGGCTTTTTAAATAATATAAGT ATGGCAAACGAAAGCCCTTGACCCGATAAGCATAAATTGTATAAATATCA GGGTGGccaaagcaattttttcagaaaatgagctagaatgctcaGCAACC CCAGGGCTGATTGAAAATTGGTGTATCTTCTAAAAATGTGTAGTTAGTTA GCCTGTTGTTAGCCTAGGAGATTAAGGTAGGGGATTAAGGTGCAAGAGTG TCACCTTGAAGTACTCCAGCCAAGATGAAAAATTCTTCTGTTTCTCCATC AGGAGATTGAACTTTTGCTCTTGTGTTCTTGTAAAGAAGTTTGATTGCCT GCACGAGCTCGTTTGGTATGCCATATGCTTTTAATATACTGAACATTCTG ACTCTATGTATGCTATCAAAGGCCTTCCGAAAGTCTAGGAAAAGTAGTAC TGCTGGTAGATTGTTAGACTTCACACCTTCAATAAGTCGTCTCAATGCAA GGATCTGAGACGATGTCGATCTACCTGTTCTTAATCCGTTTTGATTCGGG CGTAGATGGGGGTCAAGAATTGGTTGGATACGATTAAGGATCATACGGTT TACCAGTTTGGCGACAATAGCATTTAACGATATACCACGGTAGTTTCCAC CTTTGCTGAGATTGCCTTTCTTTGGTACTGGGATAATGTTACTGATTGAC CATTGATCAGGTTTATTAGCATTCATGAGTANCGCCTCTCTTTGGTACTG GGATAATGTTACTGATTGATCAGGTTTATTACCATTCATGAGTAGATCGT TCGCAAAGTCTAGAAGAGGTTGTTCAATATTGCAGAGCTTTATTACTTCA GGAGGGATGTTGTCGGGTCCTGACGCTTTCCCGAGAGTTATTCTTGATCT GGCTTTAACAAGCTCATCCTGTGTAAATGCTCCTGTTTTGAAAGGTAGAT CGCTGAGAATGGTTTTGATTTCGCTTTGATCGTTATTTATAATAGGCTCA CGTCCAAGCAGATCTTTAAAGTACTTATTCCAATTATTGACACGTTCCTC TTTATTTTTGCCTTCAAGTATGCCTGATTTCTCATTCTTACGTCCGGAGA TGCTGTTTATTGATTTCCATGCTTCACGGTGCTTTTTAGAAGGGTCCATC TCTTCAAGACGACGGATCCCGTTGGCAAGCTCGTCTCCCATCACTGCTTC GTAAGCTGTTTGAAGTGCCGCTTTATTTCTCTCTGAAGTTTGCATTCATT GTCTGGAGTTTGAGATTCCTGGAAGATTTTGAAAGCGTCTTGAACATCTT TTCTTGCCTGGACTACTCTTGGGTTAGAAGATGTTTCATTTTTGTGTTTA TTCCTTTTTCTGGGTATGAGGCTTTTGGTTGCCTCATCATTGGCTTGGAT GAAGAAGTCATATCGCTGGGTGGCATCAATATTGTCATTATCATCACACA GGACAGCAAATCTATTTTGCAAGGAAATGGAAAATTGTCTTTGTAagtct ttactttttttcattaGTCTTGATCTTGAGTTTTGCTCTTAGAATACGGT GATCAGAGCCGATGCTTGCGAATGAGTTGTAGGTGGAAACGTCTTTCACG TAGTTAGCCCATTTTCTATTGACAAGGATATAGTCTACTTGCGATTTTGT ATTTGACATGTCAGAAATcatagtgggcacccccccCTGTATTCTGGGGG GGTtgaggattttcagatttttaaaaataggtgggggttgggttgatgag aaatttcaggtgggggtaaccctatgtaggtgggggtaacatttttcagg tgggggttgcttgtcaagttttttctttctctattACAGAACAAATATTT CACTTTGGACACAGCTGCCTAGAAGAAAGTATGGTAGATAGGATAGAAAT AAGCTAGGGTAGAAAATATacaaataaaattagaaatccaAACCTAAAAG AAAACTAAAACTAATTTTAACGAGTGAGTGTTCAAACAAAGCACATCTCT TTATATCCATTATCTATGACATATGTTTCCTAAAGGAAAAACGGATaaac tgaattttcaggtgggggttcgaagattttacaaatttaggtGGGGGTAG CTGAAAAAGGTGGGGGTTGGGCTGATATgagatttcaggtgggggtaacc ctatgtaggtgggggtgacctttttcaggtggggcTTGGAGGGGTGTTGC CCACTATGGAAATATATGTCCATAGTCTACTTtgctttttctgaaatttg atgtTTGTGATCTGCATTTTGCATTCCTGGGAAAGATTGAGTAGCAGTTG ACcgttattgtttgttttttcatgaTAAGTAAACTTGCCGTCATCTTTAC CGATGTGTCCGTTAAGCTCGTGGTCCACTTAGCTTTTTTGGTCGTAGAAA AAAATTGCGCGtaagagaaaatcaaaacaaaacaattgtACATGATAAAA ATAACACACAATCAGTATGTTTACCTTCTCGCTGATTGGCTACttcaaaa agaacaatagaaaagacGCACAGCTTTGCGcacaaagttgaaatttttca actttcaatcaaaaaagttCACGCCGTTCATTGCGACAAGCCTTGAAggc ttactctcgggtacctaatagccgggggggggcgctaattaatttttcga aaattttccacccaggacattcttattccaaccccccccccccgtttatt aatttttatgaatattttttctgaaagtaccctcttttgccctaattctg ccgTATTAGCCttattttcgaacattttccacccaggacattcttatccc accccccccccccgtttattaatttttatgaatattttttctgaaagtac cctcttttgccctaattctgccgTATTAGCCttattttcgaacattttcc acccaggacattcttatcccaccccccccccccgtttattaatttttatg aatattttttctgaaagtaccctcttttgccctaattctgccgTATTAGC Cttattttcgaacattttccacccaggacattcttatcccaccccccccc cccgtttattaatttttatgaatattttttctgaaagtaccctcttttgc cctaattctgccgTATTAGCCttattttcgaacattttccacccaggaca ttcttatcccaccccccccccccgtttattaatttttatgaatatttttt ctgaaagtaccctcttttgccctaattctgccgTATTAGCCttattttcg aacattttccacccaggacattcttattccacccccccccccgcttatta aatttttagattttttccaacccccctgcttattccaaaccccccggcta ttaggtacccgagagtaatttatttaatttatgcaataatcgAGCCGTGC ACATCGTGCGGCGACCAAAAAAACTAAGTGGACCACGAACTTACGTGGAC CACGAGTTTTAAAGTCACCAAGCACAAGTAAAATTTTATGCTTTGGTACA CTATTGATAGTGTCTGTCAACTCATCGAAGTGGTCAATGGCATCTTGGTA CCCTCTTGTGGTGCATAGTTAACGATGACTTTGGTTGTAGGGTTGCCATT AAACGTTGCTATGAGGATACGTTTGTTCACATACTTTACACTGGAAAGGA CATTCTCAGCAGCTTTGTTTACGAGTAGACCTACTCCACCGTTAGCCGCA TTTTGGGTATTCCTCCAGGCCGATTGAGTGATCAGTACACATCCAGGCAA TTTGGTGTAGTTTATCGTCGTTTTCTCTGTATCAGGGTGGACAATTTTGT GATGGACGATTCCGAGGATCGAggtgttcgagttaagaaaaaTTTTGGCA AGTTCAAGTCGTTTGAATTGATGACGTATTGTTCTTACATTGAAAGTCGC AATGTAGCTATAAGTGtattggttaaaaagaggtTTTGAGCTTTGATGAT CTCGTCATCCGATGCAGCTCGTCCGAAAGGATTTGGAGGTACATCATCAT CGTTCCCATTTCTGGTACAGTCATTAATCAAAAAGCTTGAATTTGTAGGG GCTTGAACCCTAGTGCTGTTAAGTCGTGAATTCATTTTGTCTGTCGAATT GCTAAATACACATAAGGGGCGCCACTCCACTTACGGTTGCAGTGCCTTTT CTTTAAAGGTTGAATCTCCTCAGCGGTGATCAGTTGTGATTCATACGCCG AGTAGAAAGTTGTACAAATCAATGATATCGGTTTATCGATAGAAGCATTT GTTCAAGACACCCTCCCGCATTTCAAAGGTGTGAGTTACATTCCGTCAGG CCAACCTTTGACCTGTTCGGCTAGGTTGAACCTACCAGGAGACCTTGAGT TTTAAGAGCCgagaaattttcttaaaatgttcttattttcaccattttgc gaGTATTTTTGTGTATCTTCCCTAACAAAGTAGGTGTCTTAGAGTCGaga aagcctttaaatgttcttataaccTGCTTATGATATTTTAGTCAtcgatt gttcttataaaaacgtgaaCAAATTTAAGTGACATGAAGCTTCTCATAAA AATATTACAATTTTGATAATGAAAATTTCCCGACCACCCAACCGAGAGTT TCGAATAGAAAAAACGAGTTGAAAAGTTCGAAAGTAGCATAAgcctgata cataccttatactCAGTGACTAAATGGAATGagtatttttttatctgtaa tgtTGGAAACGAAAAATACATTTCTTGATGAGTTATGCTAAATAATaact tgttgtttttgtatgaaaaaattCACGCATGCGATGTAAAAGGCTTCCTG ATTTGTCTCGATCAATTCAAATTACATATTGAAACACATTGTGGTTTTGA TTGAATCAGTAAGAAAACCTTGTTCACATGTTCTCAATCTCATGAATTAT TCAACaagacaatattttttttttttttacttctcttttatcaccattaA CATTATTGGTATATATAAAGCTAAAAATATAATAACAACAACTTTTcgtt ttaaaaatatgtacaaagataAAAATNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTC CTATTAATATTTCTATTAATAATCTCCCTCATTTCGTTCCTGCATTCAGC CATGTTCCAGTTAGCAATCAACAAATTTAGTTTGCTAACAAGTTCTGTAT CCAACTGATCTCCCGTATTAACTTTAAACGATTTATGTCTGTTAAGGACC AAGTTACATATATCAATATCTTCACGATTGCATATGTTAAGAATTCCTGG AATTATTGAGTATTGACGGTCAGGTGTCGTTAACAGGTTGAGAAGGTATG CAGATGTTTGATGATTCTTCATTAGCATTGTTAGAAGATTTAGTTTCCTG TTTTCGATGTACGGAATGATGTCTGCAACTCCAAAAAGTTTGTTGAGGTC ATTAGAGCCATGTTTTGAATAACCTAACATGTTTTTGAAGGCCGAGCGAC ATTGTCGGTTTAGATACTCAAGAAACGATTTAGAAGTGTTAGTGATTTCC ATTCCATAGAGAACTTTTGGAAGGACGATTGATTTGAAGATGTTTGCTAT GATGTTGGGATGCATTTTCCTGACTCCACTAGAGATGAGAGAAGATGTGA CGGCCCATAGTTCTTGGATACGATTTTCCTGGTGTTTAGCGAGAGTGATC TTCTTCGATTTAGTGTCCCATAAAAAACCCAGatgttttaaggttttttg GGGAGATATTGATTTGTCATTCATTGAGATACTGGGATTGTCTATTGGGC AATTACCAGATACaataaattgtgtttttgtatcATTGAACTTTAAGCCA ATATTACCGCCTTTTTCCTGACAAAGAGATATCATTTTCTGGAGATGTTT TAGATTAGGACTCAGGAGGATCAGGTCATCAGCGAAGGCGATAATTGATG TGTTGATGTTAGGGTTTAAGAAGGTTCCAACGTTAAGATTAGTTATCTCC TGAAGGATATCCTCGGTGTAGATGTTATATAGGTATGGGGACAGGATTGA CCCCTGTCTGACTCCTTGAGATAGAGAGAATGGCTTGGAAATATTACTGT TGTATTTGATTTTTGCTTCTCCATGACTGTAAAGTTTTATAAGAAATTGT AGCACCGTATTTGGAAGTATGTTTTTCAATTTGAGTTTGTTAAAGAGTTC AAGCCAATTGCACGAATCGAAGGCTTTCTCTGCATCCAGACTACATATGT ATACAGGGGTATTTTGGGTATTATATTTTTGAATAGTTTCATTGATTAAG AATTCAGCATGTAGTGTAGATCCGTCTGATGAGAAACCGTACTGGTGGTC TGCGTGATGCTTTAATTGTGGGCATTTCTGTAAAATTACTTGTTCGATTA ATTTGGTTAATATTGGGATTAAGCTGATGCCTCTGTAGTTGTTCGGGTCG CTGATTGGTTTCCGGTGGGATTTGATGATAGGGACCAGGTGGGATGTGGC CAGTGATTCAGGAAAGTGTTTCGAGGTTAGAATTCGGTTTATGGTTAGTG AAAGAAATGAGAGATTCTGGTCGGAAGGGTGTGTAAAACCGTGGATAAAA TGTTCAGCTTTGATACCAAAAGGGTCGTATGCCTTGTCTTTGTTTAGATT GTTTATAGCAGTTAGTAAGTCATTTTCGTTTACTAAAAAGTCGATTTCAT CCATTTCTTGTAGATCAGACAATAGACTATCGAGGAGGTCGTTTGTACGA GTATTGTTGATCTGTGCTGTCCTTGGTGTATTGAGCAGTGTATCGATTGT AATATTGTAATATTGTTAAAGATGTAATATTGTTAAAGCTCCGtttacat tattttttttcCTGTGGCACCAATGAGATATTATGAGTTGTAaaggtact cttaggtgccaaataaacgacCCCctctgcttgttaatttttcgattttt tgccaACCCCCCGGGACCTTATTAGgatccccccgtttattaatttttga aaaaatgcccagctaccaaaaggaaagttccttgttttactctaaaaagc ctaaatttagtctattttgaccctttttagggtttttaaagATCTATTTT CCAACCCACCGGTAATTAGCCCCccctcccccgtttatttaatttgaaaa atgtttcccacgtttttcttttttagacctTTAGTTTTTTCGCGTTATTG TTCTCGTTATGTTTCTATTCCTTTAGATTTTTGAGTTATTGTTTGTTCCT TCACATTTTTTGATTCGAGTTTTAAAATtgataatgacgtcattacTCAG TGAAAGTAACTCAGGGTTGCGAATTTTAATGCATtctaacctgtagattg ccaatttcgatcttaacctaagaataccgtgagaatacctaaaaatttat attttgggatgattttcgccaaaaagttaagaatatccatgatgaaacga aaaaacaccattcttataaaaaaagcgtgcacTCTACAGGTCGAACCCAA AGAGTTATTACTTTTGGAACccagtgtttttttataagaacatttaggct gtcTCAACAAGTTTTTTGGtcccaagcaaagatttggtaaaaaataagaa cactaCAAGGACAGCCAAACTGAAAATTGACGAGTTCAACACCCGGGGGG GGtgtacccttgccgaccgatgggggtgctccgctgaggttcgaaaaatg gaccctacgtgggactcaaaAATTTAGCCGAAATTAAggaaaaaaagtga ccctgaatggtaCTGAattggactgaaattccaaaattttcaaagaaagg caccctacgagagactgatttttctattttggtgtttttgcgactcTACC TTGGACtggtggaggttaaaaaagaaAGGTAGCCTGACCCCgtaacccta gtaccccctccccgggGCTCaacaaaattagtttcaatcttCTATACATA GCTGTCCATaacagtttttttctcaacttGGAGATTACAGctaattttgt ttgatttgaagtgCTACGTAGAAAAAGGTTTGtagaaaaagttaattttg taATGTGTATGGCCTTTTCAAATTGATAGATTTGattattcaaaaattta tttttggaaaaggtGCGGTCAATCCCAGAGGGCTTAGGATCGGGCAGTGA CTTTAGGCGCCACCGAGCCATCACGACTGACCAAGGTCGCTAGCGTTCTG ACGAGAGAAATTCTGGATAACCAATCCCGAACGGACCACGGTTTAAGATT GCTAATTCTATTCTATTGCTTGAAACACTTTTAATATGTATTCTGCTTGT GGTTTAAAGTCTGAAGGGAAATACTGTTATTTTATCGCCCAtaatatatt tttagttttcccaCTTCTCATGCAGTTGTTttagaaattgtttgaataat tAAACACCAAGTGGGGATTTCCCTTTTCTCGTTTACTTTTGAATGTTGAT TGTTCCTATGCAAACATCTCTGTAATCTCCGGGCAGATTCTGATATTCCG TGCACGGTACGTTTTCATTCTAAAGACCATGGCTCTGTTAGAGAATCTGT CCGGATTAACACACCGCTTTGATCTCTTTCATCCAAAtttgggatgaata ttaaatgagttTTTGAGCGATTGCAAAACAATTGcaacaaaatcaaatgt ttGCCAGGACAAAGGACTCCCGTACACTTTGTCCCGTCCCCCCCGGGCTC GGGGGAGTACTTATGCCGCCCTTAAGGACCCAGTTTCAGAAGCATTCTCG AAAAAAGGACACCGTGagtaataaaatcttttaaaggaTTTGAATCCATT CAAAGTTAGCAAAGAAGTTATTATAGAGGAACATTTTTTCATGGGAATAA GATATCTTATTATCGAtgtactttttttctatgtttaAGCTCACCCCATT ACCATAACAAAACATAAAGAACATAAAAAGTGCTTTTAAGAACATCTAAG CTGACTTATACGTTTGAAAAACATAAGAAAATTAAATAGACATTGCTAGC CTGAAAATTGATGAGATCAACAAAAAATTGCCCAAAATCTTCTCAACTCG tacatttaagaacatttttagacttaaaattcataaagttAAGATTATCT GTAGGCTTTAAAGATTCCGACGTTTTTATAAATCAAGTTTTTTAAAGGTT GTCTAATATTTGTGAAGCTTccagatgttcttaaccttttaaGTTTTGAG ccagaaatgttcttaaaatgttcttatttttttactattttatgagtatt tttgtgtatcTCCCTAGAAAATTGGGTGTTTTTAGAGTCGTTATTCAGTG ACAGACATGTTACGCTTGtcgtaaaaatatttcaattttatttatgaACA TTACCCGACCACCCAACCAAAGTTTCGAGAAAAAAGCGAGTTGAAAGTTC GATAGTAGCATAGgcctgatacataccttatgcTCAGTGACTAAATGGAA TGAGTATTTTTATCTGTAATGTTGGAAGCGAAAAATTCATTCTTGACGAG TAACGCTAAATAATAACTTGTTGTTTTTATTCACGCATGCGATGTAAAAA GCTTCCTGAAATTTGTCTCGATCAATTTAAATTACATATTCAAACATAAT GTGGTTTTGATTGAATCAGTAAGAAAACCTTGTTCACATGTACTCATTCA TGAATTATTTAACAAGACAGTATTGTTAAAGCTCCGTTTACATTACGAGA TTTATCCAAGTGTTTTTTTGAGAACATTTATGCTGACTTATACGTTTGAa acaaataagaaatttaaatagACATGGCCAGCTTGAAAATTAATGAGATC GACAAAAAGTTCTTCTCAACTCTCAAATGTACAACCAATTTTAATGTAca ttttaaagaacatttttaggcttaaaatttaTAATGGAAAAATTGTCTGT AGGCTTCAATGATTTCGGATGTTTTTTCAAAACAGGTTTTTTAAGATCGT CAAAAGTTTGTGAAGCCTGCGGatgctcttaaaatgttcttatatctTTA CCTTATGAGTATTTTTTGTGTATCTCCCtaaaaaatttggtgttttcGGA GTcgttattaaaggttttatttttacataagtgttcacGTTTTATATcag gcacatatttcatatcaggacaatgtctgcctattgttatattatgctga tataagcaaaaaatatactctttttgaccaatcttgctccacatccgtgt cagttcaatgtgaaaaagcttgtaaatcaaaattgatgagtgaGCAAACG atttcactcttatttaaaaacaaaacctttaactcaGTGACAAACATGTC ACACTCGTCNatcactcttatttaaaaacaaagcctTTAACTCAGTGACA AACACGTCACACTTGtcgtaaaaaatatttcaattttattgatGTAAATT TCCCGACCACCCAACCAAAGTTTCGAGAGAAAAAACGAGTTGAAAAGTTC GAAAGTAGCATAAgcctgatacataccttatactCAGTGACTAAATTAAT TAGAGTATTTTTTATCTGTAACATTGGACAAGAGAAGTTCATTTCATGAT GAGTTACGCTAAATAATAGCTTgttgtttttatatgaaaaaatattcacG CATGCGATGTAAAAAGCTTCCTGATTTGTCTTGATTAATTCAAATTACAT ATTCAAACATATTGTGGTTTTGATTGAATCAGTAAGAAAACCTTGTTCAC ATGTACTCATTCATGAATTATTCAAAAAGACAGAATTGTTAAAGCTCCGT TTACATTATTCATTCTCTTGTGGTACCAATGAGATATAAGTTGTAAAGGT ACTGAAAGGTCGATGCTCGGAAATCCCGAATTATTCTCATATAAAAacaa gttatgacgtcattctcaatttttatttcatttcccAACAAGTTTCTTGG TCCCAAGGAAAGATTtggtaaaaaataagaacactaCAAGGACAGAAAAT TGACGAGCTCAACACCGGGGGTGTaggactcgttttttcaaaaattttgc tgaaatttgggaaaaagtgaccctgaatgagactgaaattccaaaatgtt ctcaaattttctactttctccccaaattttcctaaaaaggcaccctacga gggactgatttttctattttgatgtttttgcgaccctagtCCTTGGACTC GTGGAGGCTAAAAAAGGTACAGCTAATTCTGTTTCATTTGAAGTGCTATG TAGAAAAAGGTAATTATGTAATTTGTATGGCCTTTCCAAGCTGATAGATT tagattattttaaaaatatatttttggaaaaggtgCGGTCAATCCCAGAG GGCTTAGGATCGGGCAGTGACTTTAGGCGCCACCGAGCCATCACGACTGA CCAAGGTCGCTAGCGTTCTAACGAGAGAAATTCCGGAGAACCAATCCCGA ACGGACCACGGATATTAAATTGTTAATTCAATTCTATTGCTTGAAACACT TTTAATATGTATTCTCCTTGTGGTTTAAAGTCGTCTGAGGGGAAATACCG TTATTTTATCGTCCATAATAGATGTTTAGTTTGTTTCAGACCATTTGGTT TTCCCCACTTCTCATTCAGTTGTTTTAGAAATTGTCTGAATGATTAAACA CCAAGTGGGGATTTCCCTTTTCTCGTTTACTTTTGAATGTTCATATGCAA ACATCTCAGTAATCTCCGGGTAGATTCTGATACTCCGCGCACGGCACGTT TTCACTCTAAAGGCCATGGCTCCCGTAAGAAATTCTGCCCGGATTAGCGC ACCGCTTTTAtgtttttcatccagatttgggatgaatattaaatgagctt ttgagcgcaCTGATTGTCTGAAGCAAAACAATTAAAACtcgaaaaaataa tcaaaaaccaATACCATAGAGGCATGTTTCTCAGGACAAAGGACTCCCTG GGACCGGGTAGAGGGTTACTTAAGCAAATGGAGGGCACGGCTATGTGCCG CCCATTGGCCCAGTTGCAGAAGTATTCTCGAAAAAGGACACactgtttat taaattttttaaaggaTTTGAATTCATTCAAAGTTAGCAAAGAAGTTATT ATGACGGATCATTTGTTCATGGGAATAAGATATCTACTTTTTTTTCTAGG TTTCAGCTCACCCCATTACCAATATATGTTTCATTCACCTATCGCATAAT CAACAGCATCTTCATGATGGACTGGTGGCTTTCCCTTTCACTGTCTGTTT GGTGGTCGGTGAATTTCTATTACTCAAATGTAAGTCTtgtatgtttatat tttttaggCCGGAATCGGTTTTTTCAACACAGTTGAACAGTCGTTTTTCG TACTCTAAAGTCGGGGAAATAAGGGAGAAATAATAATCTGGAAAAAGCCG TGAGATTAGTTTGGAAAAAACTATGCTAAAATAACGAAACAAAGTGTCAT ATTCGACGTATTTGCAGTATCTGACACATCCTACAGCCTAGCATAGCCTT TTCCTATCCCACAACGCGAAGCTGGTTTATAACGTTTTAcgtcttttgtt ttttaattgaattgaCATCAGTTCCTTGAAACATAATACAATGACTTCAA AAGTGATACCAATCTCCCCCGACgattatgtgtttttttttttgcgcagt ttaaaataaattataaactTGGTTTTCGGGAAGGCACTGGCTAGGAGGGT ATATTTGTAAAAAGTTACAGACGGGACAGTCTCAAACAAGAAAGTCATTT CCGTTTGGTACAGGTAAAACTTAGTCTAAACTTTTGTAGTATGTTACACT ATTTTCTACACAAAATGATACGGGAAGACCGGCATCGCTTTAGATTTTAG AAGTTTTACCGATCTCCAAACTGGCAAGGTCGTTTTTCCGTTGATTTAGC TAATTTTTGTTTCGTCTCGTTGTTCGATGTTGTTTTCAACATCTGTTCGC ACGGTTGTAAAAAGTTCGGATATTTTTCAAGGCGAAAATTAATAATTGAC GATCTTTTCATATCGGGAATGTTTTATCATGTGTCACATTTAAAAATATC GGGAAAGGTAAcgattgaaattgaaagtgaatgAAATATTTACTTTACAG TagatttattcaattttttatgtctgttttttttttctaacgtGCGAATT CATCTCAATCATATCGTGATTCCCAGTGAAAAAAGTATAATATTTGACAC ATTAACATTTAATTCGAATTGTCAAGCCTTGAAAATAGTTTTATTCTTAA AACGCGTCGTCAGTGCCGaattttgcgaaaatccgtTCTCGCCAAAAATG AGGTAATgcataacaaaaaataaaataatggtTTATGAGGTAggttattt tcatttgaaatttgTCACGCCAACTGGGTAAGACTACCGCCAACTGGGTA AATTTAAAGTGATTTTCAAACCGTTATTGATAAAGAACTTAATCaaaggg aaaaaaataaataactgtTTTGTACTCCCTTTGGTAGTAACTATTTGAAT GCGAAAAGAAATCCCAGCAAATATACTGCTGATATAAATAAATGGGAATC TTTAAAACTCACACCAACTGGGTAACCCGCTCCTACTGGCTATGAAAAGC TTTccattttaatttgaaatttaggAGAGGGTTATTGATGTCGCTTAAAA TGGAAATGAATGTGCTACACTTGGTGtctctttttttatcttctactata ccttaagggaagagattttggcggaaagaaattttggcgaatttggcaaa TTGCCTAAAAATAATGTCgacaaattcgccaaaatttctctccgtcaaat ttaattttatagTTCAGGCCAAAcccaaaataaattctcgccaaatttaa ttttctttcaatttagtctctatttctcctaaaaccctttttttcctctt ttttcagttaaaatattGACGAAAAATGGAttgttcgccaaaattaattc tcgccaaatttagaaattttattaaatcgccaaaatgAATTAcgccaaat tgcaccaaaattggcgaattggctcattcgccaaaatttcttttcttaag gTAATTAAAAGAAGGAAGGGAGGGGAAAgaatcattttcttttgttttta ggaTATTCTATTTGCGAGtactttttgaaaacattttgtgAAATTAATAT TGATCAATTACTTGTAGGTGCTAATGTCTAATGATATGGTTTTGATGTAA TTTTGAGGTTTTTTGGGttgttaattaatttttttatttgcttaATGTAT CTTCTCAATCATCTTGAGTGCTTTTTCATTACAGGGACCACCATCTTTGA AATGAAatagtttttataagaaccaactAAATTTAGCTTCGGCTTCTCTT GTATTCTCGAAATCTTTAACTTAAGTctcgaatgttcttaaaatgttctt aaaatactCTGTTTCTTTACTAATTGCTTTGGTGTTTTCTGGAATACGAG ACTAGGattattctaaattttgttCTCAGgttcaaaacaaattatataac tattgttcttatttaaaatcttttttatcaaaaagcaacTCCTTTTTGGT TGAGACTTCCTTCCGTGTTCACACTTTTCACAATCAAAAATAACATACAG TTTCCTCCGTTCCcatccattcagacgtacataTTACATATAAGCAACAT TACATAAAAATTCACCAAACTAAGAAGTGATAAGCAGAATCACTGTACGT ATGTGGAAGCCATGAAAATTGAGTAAATCAGGAGAACCTAGTTGGCAGAC AAGCATTTAACCCGTCTTTTGACTTGTTCATTTCAACAACATTATACAAA CATCTAATCAAGTTTCCTTCGTTGGTAATTGACCGACCAATTAATGACGA TGTGCAGTTATCAACATAccaatttatttttcatatctatttttcttcaa atctcTTCTATTTACACCGTTCCGCAAATATTCACCAAGGTTGTTGGTGG TGAAAACGTCAGGATTGAAGGTATTGATGCAATTTATGAAAGATCAGTAT CCAGTCCAACTGAATGTTCCCTAATATGTCAACGCCATAAATGTGTTTTC GCCCAAACCGTACCTCAAGAGAAACAGCCAGGTCTTAAATGTTCGTTATT CAGCAATATTGAAGATGTCTCGGCTGTATTGGTGCATCATAAAAGCGCCA AGATTGTAAAGTTGAATGAACAGCTTTCTTGCAGCAACGAAGATCAAGAT CCGATTCTTCCACTAGCACCATCACCGCCACTAAGCAGTTTACCGGAATG TCTTGATTGGTATGAGAATGGATCTGAAGACGATGGTGTGTATAACATAA CCATCGGTGGAAAATCAACTCCAGTCTATTGTATAATGTAAGATCAACAA AGTTTCGGAGCAGGTAGGTTCCTCTTGAATTTTTACCATATATCTACTAA TTGGAATCTCAAATATGGATTTGTTTAACTGGTTCACAGTCCCGATAGAA AGATGACGTCGAAAATCAAGGTTGTTTGGATCACAAAAGTCCTACAAACA AACTTCCAATCCTTTCCCTGTCTACAATAACAACGATATTAACAAAGAAG GAAACGGAAAAAGCTTTCTCTTTGCTCACAGCTTGTAGGTACTGTAGAGA GCAGAATTAAACTTCAAAGTCTTATGAATCGCATCATTAGAAAAGACTTA ACGGGGAAATAAAATTTCCGTGGTTTAAGAAGATGGGCGTTTTTTAAGAA CAGATATTCGCAGGTTGACACCtactttttaatgaatttcttttcttcaa tatcttaggaaattcatgattttttaattttcaatatttctgcGAAGCTA ACTTTTACGGTAGAAACCCAAACTGCACCGCGAAAATTGGTTCCATTAAG TTATCTTTAATGATACCGATTTTTCAGTGTAATTTGCTCTATTGTTTTGT TTAGGATGGACAGTTTTCCAGCGCCGTAAAGACGGGTTTGTCGATTTCTA CAGATCATGGTTGGACTACAAGGTTGGATTTGGTAATATCCATGGTAACC ACTGGCTTGGTTTGGAGAAGATTCATCAATTCACCAAATCCAAACCAACT GTCGAAGTTCTCATCTTTGCTAAACGATTTATTGGCGATACAAGATTTGA ACATTTTGAaggtacagttgacgctctctaattcgatcttcaaggggatt ttgaattttcatcgaataagggagcttatcgaataagagagcgtcgttta tgagagtttcttgttgacggggactttaaatatcatcgaataagggagcc tatcgaatagtagaacgtcgaattagagagcgtcgactGTAATGTAAATT GTTTGCTAAATGCGTTTGAATTTTCCACTGGTGGTAACAAATTTCTTTGC GTTCCTTTGCGGGGTTTTCCATCATGTATtccttctttttgatttttaac tcATTTTATTAACAGAAACCCGACAAACTCAACTAAAGGCCCGTCACTTG CCactaatttttaatttcaaactaACTTTGCTTCAACTattgttaaaggt tttatttttacataagtgtccccgtttcatatcagacacaatcaggacag tgtcttcctattgttatattatgctgatataagcaaaaaatgttgttctt ttcctctttctgaccaatcttgctccacatccgtgtcaattcaacgtgaa aaagcttgtaaattaaaattgataactaagcaaacgatatcactcttatt taaaaacaaaacccttaactttgtttttaccttttttatcaTCAAGGTTT TTCAGTGGATGGCGAAATCACAAAGTACAGAATAACAAGTGGTAGAAAAA CAGGTGTAAATTACGGGAGAGATTGGACAGCTTTGAATGGGATGAGATTC AGCACATTCGATTCAGATAATGATAATTTTGGAGATAGTAATTGTGCCCA AAATTACCCTTCAGGTAAATTGAAAGACCACTAATTCATTTACTGTTATC TACTCTTAGgctccaaataaacgggccccacCGCTTGTTAACTTTTCGCC CCTTATTTCGCtctaaaaagcctgattttaacctatatttaccttatttt ttggTTTTCAGAAGTACGATTTCCAACctcccggcaattaggtcccctcc cgtttatttggaacctaagagtacttcgGTAATACTCTCAGCTCAGATGC CTGATAAACGGGGAGAGGGGTTTGAATAATCAGGGGGGGAGCTAATTTTC GAGGAGGTTGGTAATTGTACACATAAATGCCCCCAAAATAAGGTAGTTAT TAGCAATTTACAGCGCTtgttttaaaaaccttttttggttGTGTAAGAGA ACGATGGACAGATCAGGCCTTATAAGAAGAACAAGCACTCGCTATCCTAG GGTCGAGAAACTACTGCGCTTACCCGACTCTGTCAACTCTTGACGCATAG AGCTTCCGGTGCATAATAACtataaacgctttttttataagaatggtgta aatccatttcatcatggatattctcaacttttttgggaaaatcatcctga aatattcttacagcattcttaggttaggatcctaattcagactagattta acatttagtacatacgtctcaagcataaaatagcatttttgtgaaaggag tgagccttacatGCTGGTAaatggcaatttataattgaaaattctctaaa aatgacagacattcttagcttgagtagaaAAATTCCATTAaaggtgatat tcttagcatattcttaatatataatttttggccattttcatcatggagat tcttataaaaaagtgtatccttataaaaaaacacgtgtaCTCTAAGTTAG CTTGATGGGATTTGAAGAGGGTTACAAACATAAGACCAACTTTGGAACGT TTATTTTTCATAGGTTGGTGGATGAACAGCTGTTTTCCAATCAATCTGAA TGGTCGTTACCGATCGAACGGAGGTGTACCATCATCGTCTCAAGGGATCA TTTGGGAAGAATTTGCAGGTCCTGTTGAATCTCTCAAAGAAACGCTAATC ATGATGAGAAGTAAAAAAGAAGAATCGCTTGAATCGTTTGAATCAATTTC AATCGATTGATGAATCGATTGAATCGTTTTCAATCGATGATTGATCATTA TTATTACACTTGAGTgtatcttaaaatattttattatgtATTTGTTATTT ATGTATTTATGTAAGCAAGTTCCTTGATGTAAGTGAGCCGTGATTAGATA AGATATCCTATCTAGGTCACATGAAATTCATTACCATAGAATTTCAGCGT TTGACCAATCAGAAACGTCGCGGATAACAATAGCAATAACTTTTTTTACT TGGAAAAagcttaaagcactccatctTACCCTTCGAGCTTTACAGAAATT TGTGATTTGTACTCTTATCTTCACAAACGCACAATGGCAAACTTCTATTG ACTAGAGTTGTTGAAGGTTTTGTTTTACTATATTAGTGTTCCattttcat atcagacacatatttcatattgggacagtgtctacctattgttatattgt actgatataaaaaaaaaatttcttttcttctttctgaccaatcttgctat CTTGCCAATtcgaaaaagcttgtaaattgaaattgacgagtaagcaaaca atttcactcttatttaaaaacgaaACCTTTAAGATAAATTCGTGTTATAT ATAGTAATATAGGTGTTATGTGATAATGCAATAAGTGTATGTTACAATAT AATGTTAGTTCGTACAATGGCTTTTAGTTTTCCTTACCATAcattatttc ttaaattcaGTCGTCCACTCGTCTAAAAGTTATTATAACtgtgaaaatta aaataacTGCGCTTCAGCAATTCAAACTgaatttatgtatttgcactttt gaagacggtagagtgactgaagcgttTTGGAATAACCCACAGTTCTGACT CGCAATATCGAGGACGGGAAAGGTGCTGATtaaccgtcgtcctcagttgt tcaggatctagtcaaattagaaccttaccgtctccgtcgcagaaaagcAC ACATACTTAAACTcgggaaaataaataaaaaatgaccaaattaCACGCGA AGCTGTACGATGACGAGCCAAAACTCAAACATGCTCTCGCCTCGCCTATA AAGCATTGAATTTCGATGTTTCCCATTAGGGAAGATAATTCAACCTGGGC AATCCTGCTTAATTATCAAATATGCTTTGAAGCTGTTCAAACAATCGGGA ATGTCTAATCCAATCTAGAAGCACTTAAAGAGGACAAAATAGGTTAAAAT GAAACCTTTTCGGGAGTTTCTCCCGATTCGGAACCATAGTTTTGCCTGTT CGAGAAGTTCCTCCCGATTTGGAAGAATCTTTTCGACTGAAGGACTCGTC CAATTGTGATTGTAAATAGTTTTGATTTGGAAAGTCTTGGAAATTATACC AGTACTTCAACACAGTTTGCACTTAGATCTTTGCTAAAACTAGATATGTT ACCTTGaattttaactttaattttctatttcgcGATACtttttcgatttg ttcttttatttttaccGGACCCGACTCACCCTAAAAATAAAgtgtatcca gatataattggcaatGGAAACAAGAAttcctgtaacttttgattgtcaaa tataattgtgaaatttttttttgcttcttttagagaatcaaaagtgctat atttgaatgtatttttagttgaaaaattcgcgatttttagttgaaaaatt cgcgattgtaaaaattgagcttctacttatgctacaacgttcatttttaG TAGTTTTCTCTTTCCCATTACGAATTAGTGCTTCTAGGATGCTTTAATTT GTGACATTTGACAAAAGGACACTTGTACTTTTCGAGGAGCTTGACCCGTA TAACGTTAGACTAGTATAGtcgttgaatgaaaaaaattacaccGGAAAAT TTTACTAGAGTGGTAAAATCGGGAAACCGTATCTAGAACGAtattgatat tctcaaatttcaaagttattttcCTTCTCTCTCGCGCGCTAATTCTCGTG TGAACGTTTTTCCGATTATACCTAGCCAGTATCCGATTTTGTTGCGCGCG GTAAATAACAGACTTGTTTACAAGTCTAGTATAACGTGCATGTCTTTTTT AGTTGGTACTGTACACTAACTAAATTTTTTAGTTTATATGATCTTTAACA GTACTACACGTCATATTTTCAAGAGTTCGGATACGGTCGTGGCCTATACT ATAAAACGATAACCAGAAATTCTGAATTGAGTTATGGTTTTGATACCTTA AAAAGCTTATAGTGTAGAAGGGTCTCGACCCCCTTAACCCCATATTTATA TTTGTATAGTATATTTCTTCGATACTCGAAGAGCTGTGCattttttctga tagtggattgtttttataaagaaaagtgtctaatagcttttttatttttt ttcaagtctttATAATAGTGTTCATAGTTTCTCCTTATAGAATAAATATG TTTTCATTAtaccatttttattttgtccagttatgtcttatgtgtttcat tgtatCAATGgggtttcaatgttcattgattagtttttgatggcataccg gataagtgggatgggggaacctgggaacctaaagtgggaaactaaatgaa cacctgaaaagtgggactGGGGAACNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNatttaggttcccactttag gttcccaggttcccccatcccacttatccggtatgccgtttttgataacc aggtaggtccataaaagttttaaatgaaaatttccgGTATTCCGGAAAAC GTGATCTACTGCATTCAATTATCATCTTCTTGTTCTTCTCTTTAATTTTT TCAGGTGTAATACAACTAAAGAAACTTCGAAATGATTGCAGTATATTTCT GGTCCCAAAagctgtcaaaaatttgaccaaaacctTCTACAGGATGAGTG AGTTAATCCAGGCTATTTCTCTATTGGACTTTTGCNCGATCTACTGCATT CAATTATCATCTTcttgttcttctttttatatttttcaggtGTAATACAA CTAAAGAAACTTCGAAATGATTGCAGTGTATTTCTGGTCCCAAAagctgt caaaaatttgaccaaaacctTCTACAGGATGAGTGAGTTAATCCAGGCTA TTTCTCTATTGgacttttgcagaaaaaaatttaacccCCACTGTTGatag gatattgatttttcgtaTTGAACCACTTGGATATCCTTCTTTATTATTAA AGACCCCTTGATATCCAGTCTTAAAAGATATGCTCAACcgcctggatatc ctctcttataaagatgcttatcCCCTAGATATGGTTTTTACGGGGGgagg ggcacggactatttctggaaaagcccatttccaTCTCAACCAGTTAATTT TAGTTAAGGCTCGACTGCTCTTATTTTCTTTTCTCGCTATTAGCCTTTAC TTATTCACAAGTTAACTTATAGGATAGTATTGAGCTTTTTTGGGCCTCAT ACTCTATTTTTACTGATTTGACCCTAAGTTTGCGCAAAGTCAAGCAATTC AAGACTTGGGATTGTTCTTgaattgttctcataaaaaagatgTATAGCCA TTCCCCTGCCTCTCCAAGTTATCGGGTTTTGGCAATGTTAATTTTTGTTC CAGGATAAAAAGATATgtacatgcttttttttataagaatacactttata ggAATGtctatgatgaaaatggccaaaaaattttatGATGCTAAATATAT CACTATCATAGAACTTGGCtgctcaagctaagaatgccattttatgcaTG AGACGTATAttctaaatgttaaatctgaagtctgaattaggatcctaacc taagaatgctgtaagaatattttaggatgattatcccagttaagaatatc catgatgaaatggatttacaccaatcttataaaaaaaagcgtgtatcgtA AATAAATGTGTGTAGGTTAAAAACTTCGATATTCCTATATTTGAGGGGTT GTTTTTTTAGAAACTGGCTAAGCTTGTCTGGAATATCAACCACGCACTTA CACATTTTTTGTGTTCCATATGGATTTTTATTTCACCTTTGCTCTGAAAA AGACATTCTCCTTTTAAAAAATGAGGGATTTTAAAACCAGAAGGTTCCCA GTTccaatccccgctccttccaatgttctgtTCATTTCccagatagccga gccggctgacGTGGAAAACAATTGAGTCAAAGATTATTTGGGCTATCTGc aatcagcgccgaaatatattgggaattttgggtattttaacgtttttcag aatttaaaggtcgggcgggaattgcagtttcagtagttccactttgcttc attggatttttcgatttgagaggggttaagtggcttccaggctacattcc cagccttattggaacattttttagcttttagatcctgagatacTAAGGTC CTAGGACTTAAGTCTTATGCTGAAACTCTATCTTCCAAACTGTACTTCAa taagcacttaaaaatcacttgcggttttaaagtttggagggaattcccct tttgtgccaaatatttcgagCAAGATTGTAGATTACTTGGATATCTTTTG TGTTTTTCAGTTATCTATGGATTAGGAGTGCTGGTGGCATTTACGTTACT GGTGTTCATCATGTATTACGAATTCAATATGAGAGAGGAATGGGAGAAGA AGCATTCCAAGTATATCAGGTAGGTAGCTAATTATTGATGACATTGTTGc aaccttttcgaccgtagtcgcgcggtcggGCGCGTGTCACACGATttttt aattatccccctaaactcgatccaatccttttttgacacatttttctatt gcctataggtgcgaaaaaaggactgagacggttttagtgggataaagcgg acaaaaaaatgcccgcgcggcaattggtggctaaggtcgaaaaggtgtat aaacACCGGGTGTGTTTATGTATTCGTTCCCTGGTAAACATTAATTGTCT GATCAgctaaaacaaaaacatgatCCTCACTAATCGCaagtgattttcca aaattatttttctctttagAAAGGGAATCAATGTCTTCTGATAGCTCTTG AATATCTGATTTCATAGAATAACATTCTACTGTGATACTTCGTTCAATGG CAATAAGAAAtgcaaaaacataaattttccATAGGACTAACATATTGTTA CTGGtacttaaggcttggggacacgagaagtttttttcgcgttggtgcaa tgcaatatGCTCCATctcaccaacctgaaacgctttctcgtgtctccacc ccatttttctttctaccaataaaagtgagaTCGACAACATAAcatttaat aacatttgtgtgtctctcacttttgtccctgggacacttgcattgcacca acgcgaaaaaacttcgcgtgtccccaagcctttactcAAACAAATCATAT ATAAACAATTGGAAACACATAATTTAATTGCTTTCAGTACTCGTAGATTA AGCTTTCAAGGAAGAAAATTTGCAGATGAAGCTTTTGTTTATCATTTTAA GAGACCGCAAGAAGCACaattataactttttaaaaacacaGTTTCCTTGT GAATGTTCACAAGATTTGAGAATCTTCTCCAATAATCAATTCGTGATAGA GACTGTAAACCCCTCACAACTGGAAAAGGGAGTAGAATGGCTAAATTTTG TGTGTTGGTTTACAGTTTTCTGAAGGTAACCATCCGGGGTTATGTTTGCG AGAAGACGGGTCCGAaccaaaaaatcgaaaatcgacccttagagagagga AGAATTACCGTTTTGGGACACTTAAAGAgacttttctcaaaacttttttc aattttagctcgatttttatccaaattttggaaaatcacgaTCCTctgag agaaaaaattttgaatttcgtgaTTTCGGAACCTTACacgatttttttat aatgtttttttgtacccctttgagagatttTCGAGggtggctcgcacata cccggcaacCATATCGCTAATGCCAAGCCACCAAGCTTACCCTAGTCTTC ATATTGAGAAAAATAGAATATTCCTGAGATTCTCTGAGCTGATATATTGA CTCTCATCGTTATGACGAAAACAATGATTATTTTTCACACTACTTTTAGG TGCAGACTTGAAACTGTAAGCCTTCCAACATCTCTTTCCAAAGAATGTAT TCCGCCTGACAAATCAAGATTGCTTTGTCTTCATTGCTATATTTTGTTGT TACTCCTCATGTCACTTCTTACGAGCTCGTGGACATGGACATTTGGAACA CTAAAGATCTGGAAGAAAGCTTGGAAAAGGTGAGTGATGCTGATTTTGAT TTTACACTTATTCGTATAAACCCTCTTGCCTGTTTtcttactgttttttt tttgccttaacTCTCTAATACTTCAAACCAACCCCCCTGCTGTGCTTATA ATTGGACATTTTTCAAGCGAATCAGAGGTTTGTTAGTTAGAAATTCCACC CGTTAAAAGCGTAAAAATGTTTTGGAAAACTTTTAGagaagaaaatcttt tgtttgaaTTCTGTCTGAGACTTCTTGAAATCTCAATTTTCTATTAGACA TTTGGAAACAGATAAAGCTAAAGAACGTTTGCAATTTCAAAGGGCGTGGT ACCGACGTATTAACAGCAAGAAAATACAGTGAGTTTTTTTCCTGTTTACT TTACTCTGATTTCTACGGAACTAGAAGGAGTTAACGAATTTTGTATATTG ATGTTATGATATGCTGTTTTTGGGGTGGAAAAAGGAAAATTGTGTCGAAT TTCGTGGTCTTCGGACTCTTTTGGCCACCCCAGAAATAAAGTTGACTCTC TGATTACATCTTCAAGGAACCAAAAattaattcgaattacagagagtaga CCAATGctttagttcgaattaaagaaagatttgagtaacagagattcgaa ttagagagagctgaCTGTATTGTCAGTTTAGCGCTGTTGGACAAAATTCA ACAAACAAAAACGACtcgattttttacttttaggcCGTTTCTACCACCAA TCAACCCTCAAAACCCATTGgaggaaaacaaaatcaaattcaTGCAACCT GACAAAAGGCTTTCGTTGCCCGACAATTTATTCGTCTCCACTCACCAAGG TGATAAAAAGAACCGACGACATTCCGACGACATTCGATCAGTTGTCGAAC TATTTTCCATACGTCGAAACACCATGTGTAGCCTGAATTCCGTCATCTCG AACGAGGTCAGTCTAAAGCCAGTTCATTCTATACAATCTTTTGGGCATCT GTCGATCGCTCATAATATACCCTCAAACAGAGGCGCTCCCACAAATCTAA CAGTCATTCAAGTCTATCAAAACCCGACAAATACCGACGAACTACAACGT CAGTTTCTAAATAAACCACAAACGACGAATTTGACGAGTGACGAAATTCG GCATATACGAGACAGGCTTTATACACCACTGACAACTGCACACAAAGATA GCATAATAGCGGACTGTTTACCGTACAACCGGACGGACTTAGAGCCGGAC TTAATCTCAAGTGCAGTTGAATTGAGACAAAGTGTTAGAAATCATGAATT TTATAACTCGATTGAATTGATTGAGTCATTAAGTATCCATAGTACGAAAA TTTGAGATAGTGCACCCCTGTATAGAATTGTAATATGAAGATATCTAATC CACAGATCCAGAACTATACTCCGAACTTACTCAATAGATTAACAATTTCG CTACAGAGGACCTGGTCAATGCAGTAGCTTCAGGCGGGGGAGGGGGTATT TAACTCCCTTTTTAGAAAGTGATCTGTTTCTAAAACTGACTATTTTCGTT TCTCTTTATCTGAACAAATTCTTTGAGTTTTTAGTTCTAAG

Coding sequence (CDS) from alignment at sc0000001:1115592..1154382+

>TCONS_00000044 ID=TCONS_00000044|Name=TCONS_00000044|organism=Clytia hemisphaerica|type=CDS|length=22560bp|location=Sequence derived from alignment at sc0000001:1115592..1154382+ (Clytia hemisphaerica)
AGAAAAAACCTAAGGTTAAAAAAAAGATACAATTTCCACATGATGCATTC
ATTATGGATCATTATCGCAGCATCAATATCTATGTGTTCTGCATCTGAAT
GTAGCTTGACAGATTTTGAACTGTACCAACAGACTTGTATGAACAACACT
TTATATAGCACCTTCAATGAGACAAAGATGTTGGAAGTTATCGAAAATTG
TTTTCCTTGGATTTCACACAATTTTCCACAATGTTGGCAAGCTGTTCACA
GCAATATTACAACGAGTAAATGTCAACAAACTTGCCAGTATTTTCAAAAC
CATTGTCCAATGTTAGCGTTGTTTGATTCAACAAAATGTTTCAGTAGATG
TGTTGTTGGAGCAGAAAATAGGCAGCAGaaatatgaaaatcttttatccC
TAAACTGCTCACAGAATACTGTCGCCAAAACTTGTGCTGGAAATTTTGTT
TCAAGCTCACATTCATCGGAATGGGCGATCCAGTGgaattatcaaaatca
aaaacaagatAACGAAATAGTGAATACTACATCTGGTTGTGCTCTTTCTT
GTGATAATCAGATTCAAGTATTTCGATCAGGCCAATTGCAAGTTGATGGA
CCAATCATATGTTTTTCATTGTTGGGAATAATTGCTTCATCCTTCACCGT
GTTAAGCTTTCTGATTGACTGGAAAAGTCAAAACCGATATCCAGCCCTTA
TTCTGTTCATAACGAGCATCTGTTTCATGATGTGTTTTCTTGGTTGGATT
ATTCAATTCTTTGGTGTTGGCAGAAAGATATCTTGTGATCCAACCAATCT
TCGTAGAAACAAAGAACCAAGGCATGGAGATTCATTTTGGTGTATCCTAT
CTTTCATATTGATTTACTTCTCCGGTTTATCAACCAGTTGTTGGTTCGTC
ATTCTGAATTACTCTTGGTACATCTCCTTCCGCACGATGGGATCTATCAA
AACACTGATACAAagcaaaattaaatatttccatTTCTTTGCATGGGGTA
TCAGTGGATCGTTCACGTTAATGGCTCTTCTACTGCAAGCTGTTTCAGCT
CACCCCATTACCAATATATGTTTCATTCACCTATCGCATAATCAACAGCA
TCTTCATGATGGACTGGTGGCTTTCCCTTTCACTGTCTGTTTGGTGGTCG
GTGAATTTCTATTACTCAAATGTGTAATACAACTAAAGAAACTTCGAAAT
GATTGCAGTATATTTCTGGTCCCAAAagctgtcaaaaatttgaccaaaac
ctTCTACAGGATGATTATCTATGGATTAGGAGTGCTGGTGGCATTTACGT
TACTGGTGTTCATCATGTATTACGAATTCAATATGAGAGAGGAATGGGAG
AAGAAGCATTCCAAGTATATCAGGTGCAGACTTGAAACTGTAAGCCTTCC
AACATCTCTTTCCAAAGAATGTATTCCGCCTGACAAATCAAGATTGCTTT
GTCTTCATTGCTATATTTTGTTGTTACTCCTCATGTCACTTCTTACGAGC
TCGTGGACATGGACATTTGGAACACTAAAGATCTGGAAGAAAGCTTGGAA
AAGACATTTGGAAACAGATAAAGCTAAAGAACGTTTGCAATTTCAAAGGG
CGTGGTACCGACGTATTAACAGCAAGAAAATACAgcCGTTTCTACCACCA
ATCAACCCTCAAAACCCATTGgaggaaaacaaaatcaaattcaTGCAACC
TGACAAAAGGCTTTCGTTGCCCGACAATTTATTCGTCTCCACTCACCAAG
GTGATAAAAAGAACCGACGACATTCCGACGACATTCGATCAGTTGTCGAA
CTATTTTCCATACGTCGAAACACCATGTGTAGCCTGAATTCCGTCATCTC
GAACGAGGTCAGTCTAAAGCCAGTTCATTCTATACAATCTTTTGGGCATC
TGTCGATCGCTCATAATATACCCTCAAACAGAGGCGCTCCCACAAATCTA
ACAGTCATTCAAGTCTATCAAAACCCGACAAATACCGACGAACTACAACG
TCAGTTTCTAAATAAACCACAAACGACGAATTTGACGAGTGACGAAATTC
GGCATATACGAGACAGGCTTTATACACCACTGACAACTGCACACAAAGAT
AGCATAATAGCGGACTGTTTACCGTACAACCGGACGGACTTAGAGCCGGA
CTTAATCTCAAGTGCAGTTGAATTGAGACAAAGTGTTAGAAATCATGAAT
TTTATAACTCGATTGAATTGATTGAGTCATTAAGTATCCATAGTACGAAA
ATTTGAAGAAAAAACCTAAGGTTAAAAAAAAGATACAATTTCCACATGAT
GCATTCATTATGGATCATTATCGCAGCATCAATATCTATGTGTTCTGCAT
CTGAATGTAGCTTGACAGATTTTGAACTGTACCAACAGACTTGTATGAAC
AACACTTTATATAGCACCTTCAATGAGACAAAGATGTTGGAAGTTATCGA
AAATTGTTTTCCTTGGATTTCACACAATTTTCCACAATGTTGGCAAGCTG
TTCACAGCAATATTACAACGAGTAAATGTCAACAAACTTGCCAGTATTTT
CAAAACCATTGTCCAATGTTAGCGTTGTTTGATTCAACAAAATGTTTCAG
TAGATGTGTTGTTGGAGCAGAAAATAGGCAGCAGaaatatgaaaatcttt
tatccCTAAACTGCTCACAGAATACTGTCGCCAAAACTTGTGCTGGAAAT
TTTGTTTCAAGCTCACATTCATCGGAATGGGCGATCCAGTGgaattatca
aaatcaaaaacaagatAACGAAATAGTGAATACTACATCTGGTTGTGCTC
TTTCTTGTGATAATCAGATTCAAGTATTTCGATCAGGCCAATTGCAAGTT
GATGGACCAATCATATGTTTTTCATTGTTGGGAATAATTGCTTCATCCTT
CACCGTGTTAAGCTTTCTGATTGACTGGAAAAGTCAAAACCGATATCCAG
CCCTTATTCTGTTCATAACGAGCATCTGTTTCATGATGTGTTTTCTTGGT
TGGATTATTCAATTCTTTGGTGTTGGCAGAAAGATATCTTGTGATCCAAC
CAATCTTCGTAGAAACAAAGAACCAAGGCATGGAGATTCATTTTGGTGTA
TCCTATCTTTCATATTGATTTACTTCTCCGGTTTATCAACCAGTTGTTGG
TTCGTCATTCTGAATTACTCTTGGTACATCTCCTTCCGCACGATGGGATC
TATCAAAACACTGATACAAagcaaaattaaatatttccatTTCTTTGCAT
GGGGTATCAGTGGATCGTTCACGTTAATGGCTCTTCTACTGCAAGCTGTT
TCAGCTCACCCCATTACCAATATATGTTTCATTCACCTATCGCATAATCA
ACAGCATCTTCATGATGGACTGGTGGCTTTCCCTTTCACTGTCTGTTTGG
TGGTCGGTGAATTTCTATTACTCAAATGTGTAATACAACTAAAGAAACTT
CGAAATGATTGCAGTATATTTCTGGTCCCAAAagctgtcaaaaatttgac
caaaacctTCTACAGGATGATTATCTATGGATTAGGAGTGCTGGTGGCAT
TTACGTTACTGGTGTTCATCATGTATTACGAATTCAATATGAGAGAGGAA
TGGGAGAAGAAGCATTCCAAGTATATCAGGTGCAGACTTGAAACTGTAAG
CCTTCCAACATCTCTTTCCAAAGAATGTATTCCGCCTGACAAATCAAGAT
TGCTTTGTCTTCATTGCTATATTTTGTTGTTACTCCTCATGTCACTTCTT
ACGAGCTCGTGGACATGGACATTTGGAACACTAAAGATCTGGAAGAAAGC
TTGGAAAAGACATTTGGAAACAGATAAAGCTAAAGAACGTTTGCAATTTC
AAAGGGCGTGGTACCGACGTATTAACAGCAAGAAAATACAgcCGTTTCTA
CCACCAATCAACCCTCAAAACCCATTGgaggaaaacaaaatcaaattcaT
GCAACCTGACAAAAGGCTTTCGTTGCCCGACAATTTATTCGTCTCCACTC
ACCAAGGTGATAAAAAGAACCGACGACATTCCGACGACATTCGATCAGTT
GTCGAACTATTTTCCATACGTCGAAACACCATGTGTAGCCTGAATTCCGT
CATCTCGAACGAGGTCAGTCTAAAGCCAGTTCATTCTATACAATCTTTTG
GGCATCTGTCGATCGCTCATAATATACCCTCAAACAGAGGCGCTCCCACA
AATCTAACAGTCATTCAAGTCTATCAAAACCCGACAAATACCGACGAACT
ACAACGTCAGTTTCTAAATAAACCACAAACGACGAATTTGACGAGTGACG
AAATTCGGCATATACGAGACAGGCTTTATACACCACTGACAACTGCACAC
AAAGATAGCATAATAGCGGACTGTTTACCGTACAACCGGACGGACTTAGA
GCCGGACTTAATCTCAAGTGCAGTTGAATTGAGACAAAGTGTTAGAAATC
ATGAATTTTATAACTCGATTGAATTGATTGAGTCATTAAGTATCCATAGT
ACGAAAATTTGAAGAAAAAACCTAAGGTTAAAAAAAAGATACAATTTCCA
CATGATGCATTCATTATGGATCATTATCGCAGCATCAATATCTATGTGTT
CTGCATCTGAATGTAGCTTGACAGATTTTGAACTGTACCAACAGACTTGT
ATGAACAACACTTTATATAGCACCTTCAATGAGACAAAGATGTTGGAAGT
TATCGAAAATTGTTTTCCTTGGATTTCACACAATTTTCCACAATGTTGGC
AAGCTGTTCACAGCAATATTACAACGAGTAAATGTCAACAAACTTGCCAG
TATTTTCAAAACCATTGTCCAATGTTAGCGTTGTTTGATTCAACAAAATG
TTTCAGTAGATGTGTTGTTGGAGCAGAAAATAGGCAGCAGaaatatgaaa
atcttttatccCTAAACTGCTCACAGAATACTGTCGCCAAAACTTGTGCT
GGAAATTTTGTTTCAAGCTCACATTCATCGGAATGGGCGATCCAGTGgaa
ttatcaaaatcaaaaacaagatAACGAAATAGTGAATACTACATCTGGTT
GTGCTCTTTCTTGTGATAATCAGATTCAAGTATTTCGATCAGGCCAATTG
CAAGTTGATGGACCAATCATATGTTTTTCATTGTTGGGAATAATTGCTTC
ATCCTTCACCGTGTTAAGCTTTCTGATTGACTGGAAAAGTCAAAACCGAT
ATCCAGCCCTTATTCTGTTCATAACGAGCATCTGTTTCATGATGTGTTTT
CTTGGTTGGATTATTCAATTCTTTGGTGTTGGCAGAAAGATATCTTGTGA
TCCAACCAATCTTCGTAGAAACAAAGAACCAAGGCATGGAGATTCATTTT
GGTGTATCCTATCTTTCATATTGATTTACTTCTCCGGTTTATCAACCAGT
TGTTGGTTCGTCATTCTGAATTACTCTTGGTACATCTCCTTCCGCACGAT
GGGATCTATCAAAACACTGATACAAagcaaaattaaatatttccatTTCT
TTGCATGGGGTATCAGTGGATCGTTCACGTTAATGGCTCTTCTACTGCAA
GCTGTTTCAGCTCACCCCATTACCAATATATGTTTCATTCACCTATCGCA
TAATCAACAGCATCTTCATGATGGACTGGTGGCTTTCCCTTTCACTGTCT
GTTTGGTGGTCGGTGAATTTCTATTACTCAAATGTGTAATACAACTAAAG
AAACTTCGAAATGATTGCAGTATATTTCTGGTCCCAAAagctgtcaaaaa
tttgaccaaaacctTCTACAGGATGATTATCTATGGATTAGGAGTGCTGG
TGGCATTTACGTTACTGGTGTTCATCATGTATTACGAATTCAATATGAGA
GAGGAATGGGAGAAGAAGCATTCCAAGTATATCAGGTGCAGACTTGAAAC
TGTAAGCCTTCCAACATCTCTTTCCAAAGAATGTATTCCGCCTGACAAAT
CAAGATTGCTTTGTCTTCATTGCTATATTTTGTTGTTACTCCTCATGTCA
CTTCTTACGAGCTCGTGGACATGGACATTTGGAACACTAAAGATCTGGAA
GAAAGCTTGGAAAAGACATTTGGAAACAGATAAAGCTAAAGAACGTTTGC
AATTTCAAAGGGCGTGGTACCGACGTATTAACAGCAAGAAAATACAgcCG
TTTCTACCACCAATCAACCCTCAAAACCCATTGgaggaaaacaaaatcaa
attcaTGCAACCTGACAAAAGGCTTTCGTTGCCCGACAATTTATTCGTCT
CCACTCACCAAGGTGATAAAAAGAACCGACGACATTCCGACGACATTCGA
TCAGTTGTCGAACTATTTTCCATACGTCGAAACACCATGTGTAGCCTGAA
TTCCGTCATCTCGAACGAGGTCAGTCTAAAGCCAGTTCATTCTATACAAT
CTTTTGGGCATCTGTCGATCGCTCATAATATACCCTCAAACAGAGGCGCT
CCCACAAATCTAACAGTCATTCAAGTCTATCAAAACCCGACAAATACCGA
CGAACTACAACGTCAGTTTCTAAATAAACCACAAACGACGAATTTGACGA
GTGACGAAATTCGGCATATACGAGACAGGCTTTATACACCACTGACAACT
GCACACAAAGATAGCATAATAGCGGACTGTTTACCGTACAACCGGACGGA
CTTAGAGCCGGACTTAATCTCAAGTGCAGTTGAATTGAGACAAAGTGTTA
GAAATCATGAATTTTATAACTCGATTGAATTGATTGAGTCATTAAGTATC
CATAGTACGAAAATTTGAAGAAAAAACCTAAGGTTAAAAAAAAGATACAA
TTTCCACATGATGCATTCATTATGGATCATTATCGCAGCATCAATATCTA
TGTGTTCTGCATCTGAATGTAGCTTGACAGATTTTGAACTGTACCAACAG
ACTTGTATGAACAACACTTTATATAGCACCTTCAATGAGACAAAGATGTT
GGAAGTTATCGAAAATTGTTTTCCTTGGATTTCACACAATTTTCCACAAT
GTTGGCAAGCTGTTCACAGCAATATTACAACGAGTAAATGTCAACAAACT
TGCCAGTATTTTCAAAACCATTGTCCAATGTTAGCGTTGTTTGATTCAAC
AAAATGTTTCAGTAGATGTGTTGTTGGAGCAGAAAATAGGCAGCAGaaat
atgaaaatcttttatccCTAAACTGCTCACAGAATACTGTCGCCAAAACT
TGTGCTGGAAATTTTGTTTCAAGCTCACATTCATCGGAATGGGCGATCCA
GTGgaattatcaaaatcaaaaacaagatAACGAAATAGTGAATACTACAT
CTGGTTGTGCTCTTTCTTGTGATAATCAGATTCAAGTATTTCGATCAGGC
CAATTGCAAGTTGATGGACCAATCATATGTTTTTCATTGTTGGGAATAAT
TGCTTCATCCTTCACCGTGTTAAGCTTTCTGATTGACTGGAAAAGTCAAA
ACCGATATCCAGCCCTTATTCTGTTCATAACGAGCATCTGTTTCATGATG
TGTTTTCTTGGTTGGATTATTCAATTCTTTGGTGTTGGCAGAAAGATATC
TTGTGATCCAACCAATCTTCGTAGAAACAAAGAACCAAGGCATGGAGATT
CATTTTGGTGTATCCTATCTTTCATATTGATTTACTTCTCCGGTTTATCA
ACCAGTTGTTGGTTCGTCATTCTGAATTACTCTTGGTACATCTCCTTCCG
CACGATGGGATCTATCAAAACACTGATACAAagcaaaattaaatatttcc
atTTCTTTGCATGGGGTATCAGTGGATCGTTCACGTTAATGGCTCTTCTA
CTGCAAGCTGTTTCAGCTCACCCCATTACCAATATATGTTTCATTCACCT
ATCGCATAATCAACAGCATCTTCATGATGGACTGGTGGCTTTCCCTTTCA
CTGTCTGTTTGGTGGTCGGTGAATTTCTATTACTCAAATGTGTAATACAA
CTAAAGAAACTTCGAAATGATTGCAGTATATTTCTGGTCCCAAAagctgt
caaaaatttgaccaaaacctTCTACAGGATGATTATCTATGGATTAGGAG
TGCTGGTGGCATTTACGTTACTGGTGTTCATCATGTATTACGAATTCAAT
ATGAGAGAGGAATGGGAGAAGAAGCATTCCAAGTATATCAGGTGCAGACT
TGAAACTGTAAGCCTTCCAACATCTCTTTCCAAAGAATGTATTCCGCCTG
ACAAATCAAGATTGCTTTGTCTTCATTGCTATATTTTGTTGTTACTCCTC
ATGTCACTTCTTACGAGCTCGTGGACATGGACATTTGGAACACTAAAGAT
CTGGAAGAAAGCTTGGAAAAGACATTTGGAAACAGATAAAGCTAAAGAAC
GTTTGCAATTTCAAAGGGCGTGGTACCGACGTATTAACAGCAAGAAAATA
CAgcCGTTTCTACCACCAATCAACCCTCAAAACCCATTGgaggaaaacaa
aatcaaattcaTGCAACCTGACAAAAGGCTTTCGTTGCCCGACAATTTAT
TCGTCTCCACTCACCAAGGTGATAAAAAGAACCGACGACATTCCGACGAC
ATTCGATCAGTTGTCGAACTATTTTCCATACGTCGAAACACCATGTGTAG
CCTGAATTCCGTCATCTCGAACGAGGTCAGTCTAAAGCCAGTTCATTCTA
TACAATCTTTTGGGCATCTGTCGATCGCTCATAATATACCCTCAAACAGA
GGCGCTCCCACAAATCTAACAGTCATTCAAGTCTATCAAAACCCGACAAA
TACCGACGAACTACAACGTCAGTTTCTAAATAAACCACAAACGACGAATT
TGACGAGTGACGAAATTCGGCATATACGAGACAGGCTTTATACACCACTG
ACAACTGCACACAAAGATAGCATAATAGCGGACTGTTTACCGTACAACCG
GACGGACTTAGAGCCGGACTTAATCTCAAGTGCAGTTGAATTGAGACAAA
GTGTTAGAAATCATGAATTTTATAACTCGATTGAATTGATTGAGTCATTA
AGTATCCATAGTACGAAAATTTGAAGAAAAAACCTAAGGTTAAAAAAAAG
ATACAATTTCCACATGATGCATTCATTATGGATCATTATCGCAGCATCAA
TATCTATGTGTTCTGCATCTGAATGTAGCTTGACAGATTTTGAACTGTAC
CAACAGACTTGTATGAACAACACTTTATATAGCACCTTCAATGAGACAAA
GATGTTGGAAGTTATCGAAAATTGTTTTCCTTGGATTTCACACAATTTTC
CACAATGTTGGCAAGCTGTTCACAGCAATATTACAACGAGTAAATGTCAA
CAAACTTGCCAGTATTTTCAAAACCATTGTCCAATGTTAGCGTTGTTTGA
TTCAACAAAATGTTTCAGTAGATGTGTTGTTGGAGCAGAAAATAGGCAGC
AGaaatatgaaaatcttttatccCTAAACTGCTCACAGAATACTGTCGCC
AAAACTTGTGCTGGAAATTTTGTTTCAAGCTCACATTCATCGGAATGGGC
GATCCAGTGgaattatcaaaatcaaaaacaagatAACGAAATAGTGAATA
CTACATCTGGTTGTGCTCTTTCTTGTGATAATCAGATTCAAGTATTTCGA
TCAGGCCAATTGCAAGTTGATGGACCAATCATATGTTTTTCATTGTTGGG
AATAATTGCTTCATCCTTCACCGTGTTAAGCTTTCTGATTGACTGGAAAA
GTCAAAACCGATATCCAGCCCTTATTCTGTTCATAACGAGCATCTGTTTC
ATGATGTGTTTTCTTGGTTGGATTATTCAATTCTTTGGTGTTGGCAGAAA
GATATCTTGTGATCCAACCAATCTTCGTAGAAACAAAGAACCAAGGCATG
GAGATTCATTTTGGTGTATCCTATCTTTCATATTGATTTACTTCTCCGGT
TTATCAACCAGTTGTTGGTTCGTCATTCTGAATTACTCTTGGTACATCTC
CTTCCGCACGATGGGATCTATCAAAACACTGATACAAagcaaaattaaat
atttccatTTCTTTGCATGGGGTATCAGTGGATCGTTCACGTTAATGGCT
CTTCTACTGCAAGCTGTTTCAGCTCACCCCATTACCAATATATGTTTCAT
TCACCTATCGCATAATCAACAGCATCTTCATGATGGACTGGTGGCTTTCC
CTTTCACTGTCTGTTTGGTGGTCGGTGAATTTCTATTACTCAAATGTGTA
ATACAACTAAAGAAACTTCGAAATGATTGCAGTATATTTCTGGTCCCAAA
agctgtcaaaaatttgaccaaaacctTCTACAGGATGATTATCTATGGAT
TAGGAGTGCTGGTGGCATTTACGTTACTGGTGTTCATCATGTATTACGAA
TTCAATATGAGAGAGGAATGGGAGAAGAAGCATTCCAAGTATATCAGGTG
CAGACTTGAAACTGTAAGCCTTCCAACATCTCTTTCCAAAGAATGTATTC
CGCCTGACAAATCAAGATTGCTTTGTCTTCATTGCTATATTTTGTTGTTA
CTCCTCATGTCACTTCTTACGAGCTCGTGGACATGGACATTTGGAACACT
AAAGATCTGGAAGAAAGCTTGGAAAAGACATTTGGAAACAGATAAAGCTA
AAGAACGTTTGCAATTTCAAAGGGCGTGGTACCGACGTATTAACAGCAAG
AAAATACAgcCGTTTCTACCACCAATCAACCCTCAAAACCCATTGgagga
aaacaaaatcaaattcaTGCAACCTGACAAAAGGCTTTCGTTGCCCGACA
ATTTATTCGTCTCCACTCACCAAGGTGATAAAAAGAACCGACGACATTCC
GACGACATTCGATCAGTTGTCGAACTATTTTCCATACGTCGAAACACCAT
GTGTAGCCTGAATTCCGTCATCTCGAACGAGGTCAGTCTAAAGCCAGTTC
ATTCTATACAATCTTTTGGGCATCTGTCGATCGCTCATAATATACCCTCA
AACAGAGGCGCTCCCACAAATCTAACAGTCATTCAAGTCTATCAAAACCC
GACAAATACCGACGAACTACAACGTCAGTTTCTAAATAAACCACAAACGA
CGAATTTGACGAGTGACGAAATTCGGCATATACGAGACAGGCTTTATACA
CCACTGACAACTGCACACAAAGATAGCATAATAGCGGACTGTTTACCGTA
CAACCGGACGGACTTAGAGCCGGACTTAATCTCAAGTGCAGTTGAATTGA
GACAAAGTGTTAGAAATCATGAATTTTATAACTCGATTGAATTGATTGAG
TCATTAAGTATCCATAGTACGAAAATTTGAAGAAAAAACCTAAGGTTAAA
AAAAAGATACAATTTCCACATGATGCATTCATTATGGATCATTATCGCAG
CATCAATATCTATGTGTTCTGCATCTGAATGTAGCTTGACAGATTTTGAA
CTGTACCAACAGACTTGTATGAACAACACTTTATATAGCACCTTCAATGA
GACAAAGATGTTGGAAGTTATCGAAAATTGTTTTCCTTGGATTTCACACA
ATTTTCCACAATGTTGGCAAGCTGTTCACAGCAATATTACAACGAGTAAA
TGTCAACAAACTTGCCAGTATTTTCAAAACCATTGTCCAATGTTAGCGTT
GTTTGATTCAACAAAATGTTTCAGTAGATGTGTTGTTGGAGCAGAAAATA
GGCAGCAGaaatatgaaaatcttttatccCTAAACTGCTCACAGAATACT
GTCGCCAAAACTTGTGCTGGAAATTTTGTTTCAAGCTCACATTCATCGGA
ATGGGCGATCCAGTGgaattatcaaaatcaaaaacaagatAACGAAATAG
TGAATACTACATCTGGTTGTGCTCTTTCTTGTGATAATCAGATTCAAGTA
TTTCGATCAGGCCAATTGCAAGTTGATGGACCAATCATATGTTTTTCATT
GTTGGGAATAATTGCTTCATCCTTCACCGTGTTAAGCTTTCTGATTGACT
GGAAAAGTCAAAACCGATATCCAGCCCTTATTCTGTTCATAACGAGCATC
TGTTTCATGATGTGTTTTCTTGGTTGGATTATTCAATTCTTTGGTGTTGG
CAGAAAGATATCTTGTGATCCAACCAATCTTCGTAGAAACAAAGAACCAA
GGCATGGAGATTCATTTTGGTGTATCCTATCTTTCATATTGATTTACTTC
TCCGGTTTATCAACCAGTTGTTGGTTCGTCATTCTGAATTACTCTTGGTA
CATCTCCTTCCGCACGATGGGATCTATCAAAACACTGATACAAagcaaaa
ttaaatatttccatTTCTTTGCATGGGGTATCAGTGGATCGTTCACGTTA
ATGGCTCTTCTACTGCAAGCTGTTTCAGCTCACCCCATTACCAATATATG
TTTCATTCACCTATCGCATAATCAACAGCATCTTCATGATGGACTGGTGG
CTTTCCCTTTCACTGTCTGTTTGGTGGTCGGTGAATTTCTATTACTCAAA
TGTGTAATACAACTAAAGAAACTTCGAAATGATTGCAGTATATTTCTGGT
CCCAAAagctgtcaaaaatttgaccaaaacctTCTACAGGATGATTATCT
ATGGATTAGGAGTGCTGGTGGCATTTACGTTACTGGTGTTCATCATGTAT
TACGAATTCAATATGAGAGAGGAATGGGAGAAGAAGCATTCCAAGTATAT
CAGGTGCAGACTTGAAACTGTAAGCCTTCCAACATCTCTTTCCAAAGAAT
GTATTCCGCCTGACAAATCAAGATTGCTTTGTCTTCATTGCTATATTTTG
TTGTTACTCCTCATGTCACTTCTTACGAGCTCGTGGACATGGACATTTGG
AACACTAAAGATCTGGAAGAAAGCTTGGAAAAGACATTTGGAAACAGATA
AAGCTAAAGAACGTTTGCAATTTCAAAGGGCGTGGTACCGACGTATTAAC
AGCAAGAAAATACAgcCGTTTCTACCACCAATCAACCCTCAAAACCCATT
GgaggaaaacaaaatcaaattcaTGCAACCTGACAAAAGGCTTTCGTTGC
CCGACAATTTATTCGTCTCCACTCACCAAGGTGATAAAAAGAACCGACGA
CATTCCGACGACATTCGATCAGTTGTCGAACTATTTTCCATACGTCGAAA
CACCATGTGTAGCCTGAATTCCGTCATCTCGAACGAGGTCAGTCTAAAGC
CAGTTCATTCTATACAATCTTTTGGGCATCTGTCGATCGCTCATAATATA
CCCTCAAACAGAGGCGCTCCCACAAATCTAACAGTCATTCAAGTCTATCA
AAACCCGACAAATACCGACGAACTACAACGTCAGTTTCTAAATAAACCAC
AAACGACGAATTTGACGAGTGACGAAATTCGGCATATACGAGACAGGCTT
TATACACCACTGACAACTGCACACAAAGATAGCATAATAGCGGACTGTTT
ACCGTACAACCGGACGGACTTAGAGCCGGACTTAATCTCAAGTGCAGTTG
AATTGAGACAAAGTGTTAGAAATCATGAATTTTATAACTCGATTGAATTG
ATTGAGTCATTAAGTATCCATAGTACGAAAATTTGAAGAAAAAACCTAAG
GTTAAAAAAAAGATACAATTTCCACATGATGCATTCATTATGGATCATTA
TCGCAGCATCAATATCTATGTGTTCTGCATCTGAATGTAGCTTGACAGAT
TTTGAACTGTACCAACAGACTTGTATGAACAACACTTTATATAGCACCTT
CAATGAGACAAAGATGTTGGAAGTTATCGAAAATTGTTTTCCTTGGATTT
CACACAATTTTCCACAATGTTGGCAAGCTGTTCACAGCAATATTACAACG
AGTAAATGTCAACAAACTTGCCAGTATTTTCAAAACCATTGTCCAATGTT
AGCGTTGTTTGATTCAACAAAATGTTTCAGTAGATGTGTTGTTGGAGCAG
AAAATAGGCAGCAGaaatatgaaaatcttttatccCTAAACTGCTCACAG
AATACTGTCGCCAAAACTTGTGCTGGAAATTTTGTTTCAAGCTCACATTC
ATCGGAATGGGCGATCCAGTGgaattatcaaaatcaaaaacaagatAACG
AAATAGTGAATACTACATCTGGTTGTGCTCTTTCTTGTGATAATCAGATT
CAAGTATTTCGATCAGGCCAATTGCAAGTTGATGGACCAATCATATGTTT
TTCATTGTTGGGAATAATTGCTTCATCCTTCACCGTGTTAAGCTTTCTGA
TTGACTGGAAAAGTCAAAACCGATATCCAGCCCTTATTCTGTTCATAACG
AGCATCTGTTTCATGATGTGTTTTCTTGGTTGGATTATTCAATTCTTTGG
TGTTGGCAGAAAGATATCTTGTGATCCAACCAATCTTCGTAGAAACAAAG
AACCAAGGCATGGAGATTCATTTTGGTGTATCCTATCTTTCATATTGATT
TACTTCTCCGGTTTATCAACCAGTTGTTGGTTCGTCATTCTGAATTACTC
TTGGTACATCTCCTTCCGCACGATGGGATCTATCAAAACACTGATACAAa
gcaaaattaaatatttccatTTCTTTGCATGGGGTATCAGTGGATCGTTC
ACGTTAATGGCTCTTCTACTGCAAGCTGTTTCAGCTCACCCCATTACCAA
TATATGTTTCATTCACCTATCGCATAATCAACAGCATCTTCATGATGGAC
TGGTGGCTTTCCCTTTCACTGTCTGTTTGGTGGTCGGTGAATTTCTATTA
CTCAAATGTGTAATACAACTAAAGAAACTTCGAAATGATTGCAGTATATT
TCTGGTCCCAAAagctgtcaaaaatttgaccaaaacctTCTACAGGATGA
TTATCTATGGATTAGGAGTGCTGGTGGCATTTACGTTACTGGTGTTCATC
ATGTATTACGAATTCAATATGAGAGAGGAATGGGAGAAGAAGCATTCCAA
GTATATCAGGTGCAGACTTGAAACTGTAAGCCTTCCAACATCTCTTTCCA
AAGAATGTATTCCGCCTGACAAATCAAGATTGCTTTGTCTTCATTGCTAT
ATTTTGTTGTTACTCCTCATGTCACTTCTTACGAGCTCGTGGACATGGAC
ATTTGGAACACTAAAGATCTGGAAGAAAGCTTGGAAAAGACATTTGGAAA
CAGATAAAGCTAAAGAACGTTTGCAATTTCAAAGGGCGTGGTACCGACGT
ATTAACAGCAAGAAAATACAgcCGTTTCTACCACCAATCAACCCTCAAAA
CCCATTGgaggaaaacaaaatcaaattcaTGCAACCTGACAAAAGGCTTT
CGTTGCCCGACAATTTATTCGTCTCCACTCACCAAGGTGATAAAAAGAAC
CGACGACATTCCGACGACATTCGATCAGTTGTCGAACTATTTTCCATACG
TCGAAACACCATGTGTAGCCTGAATTCCGTCATCTCGAACGAGGTCAGTC
TAAAGCCAGTTCATTCTATACAATCTTTTGGGCATCTGTCGATCGCTCAT
AATATACCCTCAAACAGAGGCGCTCCCACAAATCTAACAGTCATTCAAGT
CTATCAAAACCCGACAAATACCGACGAACTACAACGTCAGTTTCTAAATA
AACCACAAACGACGAATTTGACGAGTGACGAAATTCGGCATATACGAGAC
AGGCTTTATACACCACTGACAACTGCACACAAAGATAGCATAATAGCGGA
CTGTTTACCGTACAACCGGACGGACTTAGAGCCGGACTTAATCTCAAGTG
CAGTTGAATTGAGACAAAGTGTTAGAAATCATGAATTTTATAACTCGATT
GAATTGATTGAGTCATTAAGTATCCATAGTACGAAAATTTGAAGAAAAAA
CCTAAGGTTAAAAAAAAGATACAATTTCCACATGATGCATTCATTATGGA
TCATTATCGCAGCATCAATATCTATGTGTTCTGCATCTGAATGTAGCTTG
ACAGATTTTGAACTGTACCAACAGACTTGTATGAACAACACTTTATATAG
CACCTTCAATGAGACAAAGATGTTGGAAGTTATCGAAAATTGTTTTCCTT
GGATTTCACACAATTTTCCACAATGTTGGCAAGCTGTTCACAGCAATATT
ACAACGAGTAAATGTCAACAAACTTGCCAGTATTTTCAAAACCATTGTCC
AATGTTAGCGTTGTTTGATTCAACAAAATGTTTCAGTAGATGTGTTGTTG
GAGCAGAAAATAGGCAGCAGaaatatgaaaatcttttatccCTAAACTGC
TCACAGAATACTGTCGCCAAAACTTGTGCTGGAAATTTTGTTTCAAGCTC
ACATTCATCGGAATGGGCGATCCAGTGgaattatcaaaatcaaaaacaag
atAACGAAATAGTGAATACTACATCTGGTTGTGCTCTTTCTTGTGATAAT
CAGATTCAAGTATTTCGATCAGGCCAATTGCAAGTTGATGGACCAATCAT
ATGTTTTTCATTGTTGGGAATAATTGCTTCATCCTTCACCGTGTTAAGCT
TTCTGATTGACTGGAAAAGTCAAAACCGATATCCAGCCCTTATTCTGTTC
ATAACGAGCATCTGTTTCATGATGTGTTTTCTTGGTTGGATTATTCAATT
CTTTGGTGTTGGCAGAAAGATATCTTGTGATCCAACCAATCTTCGTAGAA
ACAAAGAACCAAGGCATGGAGATTCATTTTGGTGTATCCTATCTTTCATA
TTGATTTACTTCTCCGGTTTATCAACCAGTTGTTGGTTCGTCATTCTGAA
TTACTCTTGGTACATCTCCTTCCGCACGATGGGATCTATCAAAACACTGA
TACAAagcaaaattaaatatttccatTTCTTTGCATGGGGTATCAGTGGA
TCGTTCACGTTAATGGCTCTTCTACTGCAAGCTGTTTCAGCTCACCCCAT
TACCAATATATGTTTCATTCACCTATCGCATAATCAACAGCATCTTCATG
ATGGACTGGTGGCTTTCCCTTTCACTGTCTGTTTGGTGGTCGGTGAATTT
CTATTACTCAAATGTGTAATACAACTAAAGAAACTTCGAAATGATTGCAG
TATATTTCTGGTCCCAAAagctgtcaaaaatttgaccaaaacctTCTACA
GGATGATTATCTATGGATTAGGAGTGCTGGTGGCATTTACGTTACTGGTG
TTCATCATGTATTACGAATTCAATATGAGAGAGGAATGGGAGAAGAAGCA
TTCCAAGTATATCAGGTGCAGACTTGAAACTGTAAGCCTTCCAACATCTC
TTTCCAAAGAATGTATTCCGCCTGACAAATCAAGATTGCTTTGTCTTCAT
TGCTATATTTTGTTGTTACTCCTCATGTCACTTCTTACGAGCTCGTGGAC
ATGGACATTTGGAACACTAAAGATCTGGAAGAAAGCTTGGAAAAGACATT
TGGAAACAGATAAAGCTAAAGAACGTTTGCAATTTCAAAGGGCGTGGTAC
CGACGTATTAACAGCAAGAAAATACAgcCGTTTCTACCACCAATCAACCC
TCAAAACCCATTGgaggaaaacaaaatcaaattcaTGCAACCTGACAAAA
GGCTTTCGTTGCCCGACAATTTATTCGTCTCCACTCACCAAGGTGATAAA
AAGAACCGACGACATTCCGACGACATTCGATCAGTTGTCGAACTATTTTC
CATACGTCGAAACACCATGTGTAGCCTGAATTCCGTCATCTCGAACGAGG
TCAGTCTAAAGCCAGTTCATTCTATACAATCTTTTGGGCATCTGTCGATC
GCTCATAATATACCCTCAAACAGAGGCGCTCCCACAAATCTAACAGTCAT
TCAAGTCTATCAAAACCCGACAAATACCGACGAACTACAACGTCAGTTTC
TAAATAAACCACAAACGACGAATTTGACGAGTGACGAAATTCGGCATATA
CGAGACAGGCTTTATACACCACTGACAACTGCACACAAAGATAGCATAAT
AGCGGACTGTTTACCGTACAACCGGACGGACTTAGAGCCGGACTTAATCT
CAAGTGCAGTTGAATTGAGACAAAGTGTTAGAAATCATGAATTTTATAAC
TCGATTGAATTGATTGAGTCATTAAGTATCCATAGTACGAAAATTTGAAG
AAAAAACCTAAGGTTAAAAAAAAGATACAATTTCCACATGATGCATTCAT
TATGGATCATTATCGCAGCATCAATATCTATGTGTTCTGCATCTGAATGT
AGCTTGACAGATTTTGAACTGTACCAACAGACTTGTATGAACAACACTTT
ATATAGCACCTTCAATGAGACAAAGATGTTGGAAGTTATCGAAAATTGTT
TTCCTTGGATTTCACACAATTTTCCACAATGTTGGCAAGCTGTTCACAGC
AATATTACAACGAGTAAATGTCAACAAACTTGCCAGTATTTTCAAAACCA
TTGTCCAATGTTAGCGTTGTTTGATTCAACAAAATGTTTCAGTAGATGTG
TTGTTGGAGCAGAAAATAGGCAGCAGaaatatgaaaatcttttatccCTA
AACTGCTCACAGAATACTGTCGCCAAAACTTGTGCTGGAAATTTTGTTTC
AAGCTCACATTCATCGGAATGGGCGATCCAGTGgaattatcaaaatcaaa
aacaagatAACGAAATAGTGAATACTACATCTGGTTGTGCTCTTTCTTGT
GATAATCAGATTCAAGTATTTCGATCAGGCCAATTGCAAGTTGATGGACC
AATCATATGTTTTTCATTGTTGGGAATAATTGCTTCATCCTTCACCGTGT
TAAGCTTTCTGATTGACTGGAAAAGTCAAAACCGATATCCAGCCCTTATT
CTGTTCATAACGAGCATCTGTTTCATGATGTGTTTTCTTGGTTGGATTAT
TCAATTCTTTGGTGTTGGCAGAAAGATATCTTGTGATCCAACCAATCTTC
GTAGAAACAAAGAACCAAGGCATGGAGATTCATTTTGGTGTATCCTATCT
TTCATATTGATTTACTTCTCCGGTTTATCAACCAGTTGTTGGTTCGTCAT
TCTGAATTACTCTTGGTACATCTCCTTCCGCACGATGGGATCTATCAAAA
CACTGATACAAagcaaaattaaatatttccatTTCTTTGCATGGGGTATC
AGTGGATCGTTCACGTTAATGGCTCTTCTACTGCAAGCTGTTTCAGCTCA
CCCCATTACCAATATATGTTTCATTCACCTATCGCATAATCAACAGCATC
TTCATGATGGACTGGTGGCTTTCCCTTTCACTGTCTGTTTGGTGGTCGGT
GAATTTCTATTACTCAAATGTGTAATACAACTAAAGAAACTTCGAAATGA
TTGCAGTATATTTCTGGTCCCAAAagctgtcaaaaatttgaccaaaacct
TCTACAGGATGATTATCTATGGATTAGGAGTGCTGGTGGCATTTACGTTA
CTGGTGTTCATCATGTATTACGAATTCAATATGAGAGAGGAATGGGAGAA
GAAGCATTCCAAGTATATCAGGTGCAGACTTGAAACTGTAAGCCTTCCAA
CATCTCTTTCCAAAGAATGTATTCCGCCTGACAAATCAAGATTGCTTTGT
CTTCATTGCTATATTTTGTTGTTACTCCTCATGTCACTTCTTACGAGCTC
GTGGACATGGACATTTGGAACACTAAAGATCTGGAAGAAAGCTTGGAAAA
GACATTTGGAAACAGATAAAGCTAAAGAACGTTTGCAATTTCAAAGGGCG
TGGTACCGACGTATTAACAGCAAGAAAATACAgcCGTTTCTACCACCAAT
CAACCCTCAAAACCCATTGgaggaaaacaaaatcaaattcaTGCAACCTG
ACAAAAGGCTTTCGTTGCCCGACAATTTATTCGTCTCCACTCACCAAGGT
GATAAAAAGAACCGACGACATTCCGACGACATTCGATCAGTTGTCGAACT
ATTTTCCATACGTCGAAACACCATGTGTAGCCTGAATTCCGTCATCTCGA
ACGAGGTCAGTCTAAAGCCAGTTCATTCTATACAATCTTTTGGGCATCTG
TCGATCGCTCATAATATACCCTCAAACAGAGGCGCTCCCACAAATCTAAC
AGTCATTCAAGTCTATCAAAACCCGACAAATACCGACGAACTACAACGTC
AGTTTCTAAATAAACCACAAACGACGAATTTGACGAGTGACGAAATTCGG
CATATACGAGACAGGCTTTATACACCACTGACAACTGCACACAAAGATAG
CATAATAGCGGACTGTTTACCGTACAACCGGACGGACTTAGAGCCGGACT
TAATCTCAAGTGCAGTTGAATTGAGACAAAGTGTTAGAAATCATGAATTT
TATAACTCGATTGAATTGATTGAGTCATTAAGTATCCATAGTACGAAAAT
TTGAAGAAAAAACCTAAGGTTAAAAAAAAGATACAATTTCCACATGATGC
ATTCATTATGGATCATTATCGCAGCATCAATATCTATGTGTTCTGCATCT
GAATGTAGCTTGACAGATTTTGAACTGTACCAACAGACTTGTATGAACAA
CACTTTATATAGCACCTTCAATGAGACAAAGATGTTGGAAGTTATCGAAA
ATTGTTTTCCTTGGATTTCACACAATTTTCCACAATGTTGGCAAGCTGTT
CACAGCAATATTACAACGAGTAAATGTCAACAAACTTGCCAGTATTTTCA
AAACCATTGTCCAATGTTAGCGTTGTTTGATTCAACAAAATGTTTCAGTA
GATGTGTTGTTGGAGCAGAAAATAGGCAGCAGaaatatgaaaatctttta
tccCTAAACTGCTCACAGAATACTGTCGCCAAAACTTGTGCTGGAAATTT
TGTTTCAAGCTCACATTCATCGGAATGGGCGATCCAGTGgaattatcaaa
atcaaaaacaagatAACGAAATAGTGAATACTACATCTGGTTGTGCTCTT
TCTTGTGATAATCAGATTCAAGTATTTCGATCAGGCCAATTGCAAGTTGA
TGGACCAATCATATGTTTTTCATTGTTGGGAATAATTGCTTCATCCTTCA
CCGTGTTAAGCTTTCTGATTGACTGGAAAAGTCAAAACCGATATCCAGCC
CTTATTCTGTTCATAACGAGCATCTGTTTCATGATGTGTTTTCTTGGTTG
GATTATTCAATTCTTTGGTGTTGGCAGAAAGATATCTTGTGATCCAACCA
ATCTTCGTAGAAACAAAGAACCAAGGCATGGAGATTCATTTTGGTGTATC
CTATCTTTCATATTGATTTACTTCTCCGGTTTATCAACCAGTTGTTGGTT
CGTCATTCTGAATTACTCTTGGTACATCTCCTTCCGCACGATGGGATCTA
TCAAAACACTGATACAAagcaaaattaaatatttccatTTCTTTGCATGG
GGTATCAGTGGATCGTTCACGTTAATGGCTCTTCTACTGCAAGCTGTTTC
AGCTCACCCCATTACCAATATATGTTTCATTCACCTATCGCATAATCAAC
AGCATCTTCATGATGGACTGGTGGCTTTCCCTTTCACTGTCTGTTTGGTG
GTCGGTGAATTTCTATTACTCAAATGTGTAATACAACTAAAGAAACTTCG
AAATGATTGCAGTATATTTCTGGTCCCAAAagctgtcaaaaatttgacca
aaacctTCTACAGGATGATTATCTATGGATTAGGAGTGCTGGTGGCATTT
ACGTTACTGGTGTTCATCATGTATTACGAATTCAATATGAGAGAGGAATG
GGAGAAGAAGCATTCCAAGTATATCAGGTGCAGACTTGAAACTGTAAGCC
TTCCAACATCTCTTTCCAAAGAATGTATTCCGCCTGACAAATCAAGATTG
CTTTGTCTTCATTGCTATATTTTGTTGTTACTCCTCATGTCACTTCTTAC
GAGCTCGTGGACATGGACATTTGGAACACTAAAGATCTGGAAGAAAGCTT
GGAAAAGACATTTGGAAACAGATAAAGCTAAAGAACGTTTGCAATTTCAA
AGGGCGTGGTACCGACGTATTAACAGCAAGAAAATACAgcCGTTTCTACC
ACCAATCAACCCTCAAAACCCATTGgaggaaaacaaaatcaaattcaTGC
AACCTGACAAAAGGCTTTCGTTGCCCGACAATTTATTCGTCTCCACTCAC
CAAGGTGATAAAAAGAACCGACGACATTCCGACGACATTCGATCAGTTGT
CGAACTATTTTCCATACGTCGAAACACCATGTGTAGCCTGAATTCCGTCA
TCTCGAACGAGGTCAGTCTAAAGCCAGTTCATTCTATACAATCTTTTGGG
CATCTGTCGATCGCTCATAATATACCCTCAAACAGAGGCGCTCCCACAAA
TCTAACAGTCATTCAAGTCTATCAAAACCCGACAAATACCGACGAACTAC
AACGTCAGTTTCTAAATAAACCACAAACGACGAATTTGACGAGTGACGAA
ATTCGGCATATACGAGACAGGCTTTATACACCACTGACAACTGCACACAA
AGATAGCATAATAGCGGACTGTTTACCGTACAACCGGACGGACTTAGAGC
CGGACTTAATCTCAAGTGCAGTTGAATTGAGACAAAGTGTTAGAAATCAT
GAATTTTATAACTCGATTGAATTGATTGAGTCATTAAGTATCCATAGTAC
GAAAATTTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000028XLOC_000028Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000044-proteinTCONS_00000044-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000044-exon-sc0000001-1491911889:1115592..1116007TCONS_00000044-exon-sc0000001-1491911889:1115592..1116007Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1510915933:1115592..1116007TCONS_00000044-exon-sc0000001-1510915933:1115592..1116007Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1575043694:1115592..1116007TCONS_00000044-exon-sc0000001-1575043694:1115592..1116007Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1491911889:1116553..1116789TCONS_00000044-exon-sc0000001-1491911889:1116553..1116789Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1510915933:1116553..1116789TCONS_00000044-exon-sc0000001-1510915933:1116553..1116789Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1575043694:1116553..1116789TCONS_00000044-exon-sc0000001-1575043694:1116553..1116789Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1491911889:1117161..1117330TCONS_00000044-exon-sc0000001-1491911889:1117161..1117330Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1510915933:1117161..1117330TCONS_00000044-exon-sc0000001-1510915933:1117161..1117330Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1575043694:1117161..1117330TCONS_00000044-exon-sc0000001-1575043694:1117161..1117330Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1491911889:1118408..1118627TCONS_00000044-exon-sc0000001-1491911889:1118408..1118627Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1510915933:1118408..1118627TCONS_00000044-exon-sc0000001-1510915933:1118408..1118627Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1575043694:1118408..1118627TCONS_00000044-exon-sc0000001-1575043694:1118408..1118627Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1491911889:1138291..1138420TCONS_00000044-exon-sc0000001-1491911889:1138291..1138420Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1510915933:1138291..1138420TCONS_00000044-exon-sc0000001-1510915933:1138291..1138420Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1575043694:1138291..1138420TCONS_00000044-exon-sc0000001-1575043694:1138291..1138420Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1491911889:1149346..1149438TCONS_00000044-exon-sc0000001-1491911889:1149346..1149438Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1510915933:1149346..1149438TCONS_00000044-exon-sc0000001-1510915933:1149346..1149438Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1575043694:1149346..1149438TCONS_00000044-exon-sc0000001-1575043694:1149346..1149438Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1491911889:1151102..1151210TCONS_00000044-exon-sc0000001-1491911889:1151102..1151210Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1510915933:1151102..1151210TCONS_00000044-exon-sc0000001-1510915933:1151102..1151210Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1575043694:1151102..1151210TCONS_00000044-exon-sc0000001-1575043694:1151102..1151210Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1491911889:1152641..1152820TCONS_00000044-exon-sc0000001-1491911889:1152641..1152820Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1510915933:1152641..1152820TCONS_00000044-exon-sc0000001-1510915933:1152641..1152820Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1575043694:1152641..1152820TCONS_00000044-exon-sc0000001-1575043694:1152641..1152820Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1491911889:1153089..1153169TCONS_00000044-exon-sc0000001-1491911889:1153089..1153169Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1510915933:1153089..1153169TCONS_00000044-exon-sc0000001-1510915933:1153089..1153169Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1575043694:1153089..1153169TCONS_00000044-exon-sc0000001-1575043694:1153089..1153169Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1491911889:1153525..1154382TCONS_00000044-exon-sc0000001-1491911889:1153525..1154382Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1510915933:1153525..1154382TCONS_00000044-exon-sc0000001-1510915933:1153525..1154382Clytia hemisphaericaexon
TCONS_00000044-exon-sc0000001-1575043694:1153525..1154382TCONS_00000044-exon-sc0000001-1575043694:1153525..1154382Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1115592..1154382 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0 0 4.92926e-07 0 0 8.63204e-07 0 0 0 0.157725 0 0 0 2.85622e-06 9.14995e-07 0 0 0 0 1.02715e-08 3.52454e-06 0 0.454846 9.63934e-06 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000539Frizzled
IPR017981GPCR_2-like
Vocabulary: Biological Process
TermDefinition
GO:0007166cell surface receptor signaling pathway
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007166 cell surface receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0016020 membrane
molecular_function GO:0004888 transmembrane signaling receptor activity
Blast
BLAST of TCONS_00000044 vs. Swiss-Prot (Human)
Match: SMO (Smoothened homolog OS=Homo sapiens GN=SMO PE=1 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 5.447e-45
Identity = 106/408 (25.98%), Postives = 191/408 (46.81%), Query Frame = 3
Query:  219 HNFPQCWQAVHSNITTSKCQQTCQYFQNHCPMLALFDSTKCFSRCVVGAENRQQKYENLLSLNCSQNTVAKTCAGNFVSSSHSSEWAIQWNYQNQKQDNEIVNTTSGCALSCDNQIQVFRSGQLQ-VDGPIICFSLLGIIASSFTVLSFLIDWKSQNRYPALILFITSICFMMCFLGWIIQFF-GVGRKISCDPTNLRRNKEPRHGDSFWCILSFILIYFSGLSTSCWFVILNYSWYISFRTMGSIKTLIQSKIKYFHFFAWGISGSFTLMALLLQAVSAHPITNICFIHLSHNQQHLHDGLVAFPFTVCLVVGEFLLLKCVIQLKKLRNDCSIFLVPKAVKNLTKTFYRMIIYGLGVLVAFTLLVF-IMYYEFNMREEWEKKHSKYIRCRLE-TVSLPTSLSKECIP 1430
             N P+CW AV   +  +     C+  +   P   L  +T+    C +    R++ + + L   C+ +   + C     +   +S    +                 GC + C N +  F   + Q +   I  F  +  + + FT+ +F+ DW++ NRYPA+ILF  + CF +  +GW+ QF  G  R+I C      R  EP   ++  C++ F+++Y++ ++   WFV+L Y+W+ SF+ +G+    +  K  YFH   W +    T+  L +  V    ++ ICF+   +       G V  P  + L+VG + L++ V+ L  ++++    L  KA   + +T  R+ I+G  +   F L+ F   +Y+F  + EWE+    Y+ C+   T+ LPT   K+ IP
Sbjct:  113 RNAPRCW-AVIQPLLCAVYMPKCENDRVELPSRTLCQATR--GPCAI--VERERGWPDFL--RCTPDRFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPL--FTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFV--GYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGF-LAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPT---KQPIP 505          
The following BLAST results are available for this feature:
BLAST of TCONS_00000044 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SMO5.447e-4525.98Smoothened homolog OS=Homo sapiens GN=SMO PE=1 SV=... [more]
back to top