Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000038 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000038
Unique NameTCONS_00000038
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2103

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000038 ID=TCONS_00000038|Name=TCONS_00000038|organism=Clytia hemisphaerica|type=transcript|length=2103bp
CAAACGGTTGATAATTATTTTAGTGTCAATATCTCACATGTCCCTTTCAT
GTTTACTTGGTCGCATGCCTCCATATCAATTTTCTCTTCACTTTCAAACT
TCCCGTTAAACCGCCCCGCGTGCTGTTACGCCCTCTTTGACATGCTCAAA
CTATAGGCGGGATTTGAAGAGACTTGCTCAAactgaaaaaacaacaacaa
caaagatggccgCCAAGAGAAGTGAAAATTTTTGAGTGAAaactaaaata
ataatttttttgtatcaTATTATACAGTCATCAAACAGATAGAAGAGGTT
GAAAATTGACTATGGGAAGTTTATTGAGTCTTATCGGCATTGGTTCAGCT
GCAAGCTGTTTGCCCTCTATTGGAGGTTGTGCAGCAAGTCAGaTTGCTTG
TTGTTGTGGGTCTGCTGCTTGCAGTTTATGTTGTAAAGCATGTCCATCTT
GTCAAAATTCAACTGCTTCAAGGATTGGTTACACACTGGTACTCCTGCTT
GGATTTATTCTATCATGTGTCATGTTGTCACCAAACATCCGTCAGAAATT
GAATAAAGTACCTCACTTATGTCCAACATTTGATTGTGACCAGGTTGTTG
GTTATGTGGCGGTTTATCGTGTTTGCTTTGCAATGTTTGCTTTTTTCTTC
ATAATGGCTTTGATCACGTTTAAAATTCGTAACAGCAAAGATCCAAGAGC
TAGTATACACAATGGgttTTGGGCAATCAAACTACTCGTTTTCATTGCAC
TACTGGTCGGTGCTTTTTACATTCCAAAAGGTGACTTCTCTAGGGTTTGG
ATGTATATTGGTATGATTGGTGGCTTCTTGTTTATCTTGATCCAATTGGT
TCTGTTGATTGATTTCGCTTATAGCTGGTCACAGAAATGGATTGGCAAGT
ATGAGGAAACTGACAACAAGATTTGGTTCATTGGACTGGCTGTATGTACT
GGAGGGTTGTATGCAATCGCGTTGGCCATCACTATTTGTGGTTTCATTTT
CTATACTAAGACTTCAGGATGTGGATTGAACAAattctttttgagtttca
actTCATCATTGCCGTTCTTCTGTCACTCATTTCCATTCATCCTCGTGTC
CAAGAATCACAACCAACGTCAGGGCTGCTTCAAGCGTCCATCATTTCTGC
ATACAGCATGTATTTGACATTGTCCGCCATGTCTAATGAACCTGGCACAG
ATTGCAATCCAGGTAGTTCCTTCTTGCAAAGTGATTCTTTCGCACCTGGT
TTCGACACACAAACAGTGTTGGCAGCCATCTTTCTTTTTTGCACGGTCGT
CTATTCGTGTGTGAGAACCAGTGCCAAAAGTTCTTCACTTTCCATCCAAT
CAGATGATGCAGACATCGAAGAAGTTTTGCTAATCGAAAATAATGGACAG
GGTGATGACGATGTGGAATACAAAGGACAAAAAGTTTACGATAACGAGAG
TACAGAAGTTGCATACAATTATTCANTATTACTCAGGACGTGGAATACAA
AGGACAAAAAGTTTACGATAACGAGAGTACAGAAGTTGCATACAATtatt
cattctttcatttcactTATGCATTGGCCTCACTCTATATCATGATGATG
TTGACCAACTGGTACAGCCCTGAAGGTGCAAACTTCAAAACCTTAACCAG
CAGCATGGCTACAGTTTGGGTCAAGATGGCGTCAAGTTGGGCGTGTTTCG
TCCTCTTTGGGTGGACTCTTGTCGCGCCTATGCTTTTTCCCGATCGAGAG
TTCCACTAAAGTTCGCTTTCCAGTACAAAAACCTTGTTTGTATATAAGTG
TACTTTTGAATTTTGTATTTAGATCCTTCTATTTAGGATCAATTCTGTAA
CTATttagtttatttgtttttggtAAAGTTTAACCCATTGtataattttt
agttttggtttcttttgtaAAATCTTTGTTGTAAGatatattgttttgtt
ttgtttaaaaagaaacttcCGATATGTTCGATTAAGACCAGAATATACCT
TTTCGTTTTTTTACATGGTAGCCAACTCTTGCCAGGGACGGTTGGGATCA
CAGATTTCTGTGTCCAAAGGGCCAAGCAAACGAACTTTATGCTGAATTGA
ACT
Run BLAST on NCBI

transcript from alignment at sc0000001:1005161..1016571+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000038 ID=TCONS_00000038|Name=TCONS_00000038|organism=Clytia hemisphaerica|type=transcript|length=11411bp|location=Sequence derived from alignment at sc0000001:1005161..1016571+ (Clytia hemisphaerica)
CAAACGGTTGATAATTATTTTAGTGTCAATATCTCACATGTCCCTTTCAT GTTTACTTGGTCGCATGCCTCCATATCAATTTTCTCTTCACTTTCAAACT TCCCGTTAAACCGCCCCGCGTGCTGTTACGCCCTCTTTGACATGCTCAAA CTATAGGCGGGATTTGAAGAGACTTGCTCAAactgaaaaaacaacaacaa caaagatggccgCCAAGAGAAGTGAAAATTTTTGAGTGAAaactaaaata ataatttttttgtatcaTATTATACAGTCATCAAACAGATAGAAGAGGTT GAAAATTGACTATGGGAAGTTTATTGAGTCTTATCGGCATTGGTTCAGCT GCAAGCTGTTTGCCCTCTATTGGAGGTTGTGCAGCAAGTCAGGTTATAAT TGATAATTCTTTTCTTACTTGAAAATAATACAGTACAGAAGGGAGTAAAG AACACTTTgatttagttttttattttataatggctttaaaataaatttga attttcccAAATGGCGTTAGTGGCTTGTTTGCATAAGAAAATTCAAATGG TAAAATCAAACTCAACAGTGAAGTAGGTATTAAAGtgggaaagaaagaaa aaataaaaggcTAGATCTATTGCCAGACGGTAGGGTGTCTATCGAACAAA Tcaaacgccgaatcaatcgaacgcaatcgaatattacccaggatttactg ttcgattgcttcgattacgtttgattgtattcgattacgttcaattgatt caattttcaattcaagtattagattttatttgctttggtaTGGTACGCca acgctaaaaagctctaacagagtgatccaatttgataatcacaatcaaac tcatcgaacataatcgtaatcaaacattaatccaatgtaattgacaatca atcgaacaaatcgaacatagtcaactatcaatcgaacattactcgaacgc aatcgaacacaattgaatattacccaggaatcggccgttcgattaagata ttcgattacgttcgacaattgaatcgcaattattcgatatcgttcgatta tgttcgattggttcgattgaaatttttgttcgaagttgtacgattgacac cgtctggctattgcaaaaaattttatttttccaatagCTGCACCTTTCCc ataattcaaacttctcagaaatggcccgggaaaatgtgcactccaccgtt gtgtataaaattgtttgggaggtagtAAACGAACGTGTTTTTGCCTGCAA GGggaagggaaagtgggttttcgtgcagcttctaacttttgataacaatc ttcttttggcaaaagattttcagggtggtataatatcatgaatagattga gcATACCATAGCTGTCAACGGAgcgggagagctccaagtcggaaaaattt tctcgataatccaatttttccgaatcggaaaatcaggaaatcgaGGTAAT TTTCCTGCGAAATCcgattttatcagatttttttttccggAAATAGGGAA ATTTTACGCATGAATTTTCCAAATTCaggaaattttgccattccGCTCTT TCAAATTCTGAATTTTNCTTTTCCCGGAAATGGGGGAAATAGGGAAATTT TACGTCTCAATTTTCCAAATTCaggaaattttgccattccgctctttcaa attctgaatttttttcaagaaatcgGAAACAttttggaaatgcgggagat gcgggagaaaatcctgaaaatgcgggagatttggcTGATTTTTTTTCCCG CGGGAGAAAGCGCCGTTGGCATGCGGGAGTCTCCCGCCcaatgcgggaga gttgacagctatggcatactaaaatttgaggggattttgttcgacagatc ttaagaaaagctcaaaaaaccaattttccctaaggaaacgcaggcaaaaa cgggtttgtttacctccaaaGCCCAAATGCACAAGTGTTACGCATAAGCC AAATTGCGTaatacgaacaacctctaaattgccgagtacaagagaaaaaa aaatcgaaattcaaaatggcggctaAGCCCACCCTGATAACTACCGTgaa aggaccctgccgacgcactggacttaacgaacaccggacacgcaaaagtc tggtgtaaaaatgcagtccggtgcgtccggtgcttcttaattttttgttt tataaatgTCTGGCGTTCAAAATTCcatgtatgcaacaccggactgacac cagacttatttcgtccggtgtagcgaaaggatactttttgccaccggaca gtccggtgcgtcggcagggtcctaccGTGAATGGttctaaatccgacagc cctgcctaaatccgaccccccaaataaatatatgaaaaaaattctatgtt tacaaacattccctctccaagttgaacaataaactattgcaaggactctt gaaacaaaacatctgaTCTAAaaagatgactataatgtcaagatgtcaat caatgtgataaaaaaagtgtgagttgtaaaaataattacctctattattc tgaatccgttgcttgtgtttaaaacgttaacagtttatgtaataaaaaat tatgttttgtataagaaacaattattttaatttgatccaattggttcagt gtatcaaatctttcagtttagttgacactttggtatcttcattgtgtCAC AGCGAaccgaaaggtttgtttttattttagtttgtatctttgaaagaccc catcagatttaggcagggctgtcagatttaggaccactaacggtatcaaa aatcttcatttttcaatcagctacacaataaatcaatgaaataatttgaa ataaaaagtaaacaaaccttgaacctttcatgaatccaaatggATAAAAG tgttcatctaaagtgaagattacatttcaaaataaaacgatttccaaacc aacctaaagtcagtgtctgccaactaaaaattcctctgcggggtcactgg caaggagttacgacttcagactttatttagattccaattcttgtataggc tgcaactacactgccaaatgatctgtattacaaatacttccaaatgggtc cataagttaagaaaataaaattatcatctagcacgggggttttgtttata aaaacaaacttcaaaataaattttttaatgaacttgttacttaaaatatc actgactcccataatttatttatgatataacacccctttcttaaataaat ggcctcttaaagtattttatgtttgctGCAACGTGcaagaagagagaaaa atttaatttgatctttttctagctatttcccgcgtgttagtgtagacaca actttaatccggggaaatgaagcgttttcattagtctaaaatcacggatg gtcacgtgaccagaatttttatccagggaaatgctgtggcggcaatgttt tgctttagtgagattgaccgttttgttgttttgatttgagcgggcgaaat ttctgtacaaaccaaaatatggcttcgttggaataccgatTGAGACACTT TAGTTTGTATCTTCCAAAGACCCtatcggaattaggcagggctgtcagat ttagaACCACTCACGGTAATTTTTCAAGCGTAACAAGAATGATTTGAGCA GGGGGTCTGGTGGAATCCCCTTAGAAAATTTTGTCTGAAAAATGACCTTT AGAGATTGGCTAAACAGTTATGTTGATTCAAAATCTATTCCTCATTTTAT CAGATGCGATATCAAGTATTTATCTAAGCCTTCTagtcatcaaattttga tggGATAAACTAAAAAACTTAGCTCCTTATTACTATAGGAGAATTTTCCT AATTAGGTTTTCTTATTTAGATATTTCTCCAAAAAACTCTCTACATGTAA TAACCAGAAATGTCATCCTTGGGATATAACTCTTCAGGAAAATTTATATA AGTTTAATCATAAAAAGCATCAATTATATAGTATATCCCTCCCAAATTgt ttgttttactttattctacTACATATATCATATTTTTTGGGAGAAAacca atattttttaattttgtagaTTGCTTGTTGTTGTGGGTCTGCTGCTTGCA GTTTATGTTGTAAAGCATGTCCATCTTGTCAAAATTCAACTGCTTCAAGG ATTGGTTACACACTGGTACTCCTGCTTGGATTTATTCTATCATGTGTCAT GTTGTCACCAAACATCCGTCAGAAATTGAATAAAGTACCTCACTTATGTC CAACATTTGATTGTGACCAGGTTGTTGGTTATGTGGCGGTTTATCGTGTT TGCTTTGCAATGTTTGCTTTTTTCTTCATAATGGCTTTGATCACGTTTAA AATTCGTAACAGCAAAGATCCAAGAGCTAGTATACACAATGGGTAAGACG ATTAACTAACATATTTAGGATTGGATATTTTCTGTAATGAAAACGTGTCT TGTTTTATTGGCAACTAATCTGCCATGTTGTTTCCATTCACTTTTAGATT GACAGCCTTAGCATTTGAGTATTTAAACAATTCATTGAGAATCAACAGAA AACAACATTTGCAGAATTTACTTGTTTAGTTGTCAAAATTGGCTATACTT CCACAAGAACTTTACAATAGATTAGTCTATCAGAGCGTGTGTAGGAATTT TATTTGTATTATTCTATAAAATGGTAGAATAATTCCCCTGTTCTCAATAG CATAGCCAAGAGGGGCGtgaaatttgtgtaggagagcagattttatgcca ttataattatcttttaatactatgaatagataattacagtgtcattaaag tctgctctcctacacaaattttgcgcccctcttagCTATGCTACTGGTTC TTAATAATGGCTTTTTAGAACTGATAAAGGATCAGCATTCAACAAATAGA TAAATGTAAATCAACACATTGCATAATATTTTagattaaaagtttttttc ctaCTATGTTtcgttttttcaatttcaggttTTGGGCAATCAAACTACTC GTTTTCATTGCACTACTGGTCGGTGCTTTTTACATTCCAAAAGGTGACTT CTCTAGGGGTAAGAATCTTTTGTGAAGTTAACAACAAAGATATCATGGCA ATTACACCGATATTTTGAGTCTACACATACTTTTGTGCTTTTAACCTCTA ACCAGCGTCTCAACGAAGAAAATTTTGCTCCCTTttagatcgaattagag agagagagttaATCGTatcatttctttcttaaaaaattataaatgtaATA TACATATCTTTAAAACATTGTTTATTATGCAAGTTCAGTTTCCATTAGAA AAAGAATATATTAGAATGTTACAAGAACTTATTGTAAACTTATCCGGAGT TACATAAGTTTTCTACTTACTTTCATTATAAttgttaatttttaaaattc tagTTTGGATGTATATTGGTATGATTGGTGGCTTCTTGTTTATCTTGATC CAATTGGTTCTGTTGATTGATTTCGCTTATAGCTGGTCACAGAAATGGTA TGtactcattgagtttaaagcccgaagggctagagttcaatctctaacct ttctcaggcaagaaaaagtgaagccttaaaaaatgcgccgcttttttgac gacagattgaatctagcaattcctttgtttacgattgatatttttacgaa atttagcggtaaattttagtttcaatctgtcatttgtgtaaaaaccaggc gagccgctcaaggccgcgcaactttggtaggatttgttggcttcaaatcc taccaaggagattgacttctagcccttcgggcttatacttcatggTATGT ACTCGTTCTCTCTTACCAACATAAAAATTGCACACGATCGCTATGGAGCC GAGCTGAACATTTGACCTTGTTTCGCTTGGATCTTATTGTTATCGAGACT ATTTTAATTGGACAAGTTTGCACTGCGATTAAATTTCGAGGTTGCGCTCT TCCGCAAAGATTCTAAGAATTTGCGGGAACTTGATTTCGCGGTTGGCACT ATAGGGAAATAATATTTTTACGATATTGTGCCTTTTTACCACAATTTATG CGTGTTTGTTGTCGAGATACGTATTACTAGCGCTTTTTTCATGCCAGTAA AGTATTAAATATAAAAGGCTTCAGAAGCTGAACTTTTGAATTTaccatga aaaaaatattgtgtTTCATTAAGGATTGGCAAGTATGAGGAAACTGACAA CAAGATTTGGTTCATTGGTACGTAATTTCATTTTATTGTTGAGCCTTTAA AAAAGTTGGATAAAGTATTTAAAAGTAGAAGCATATAACTATGCCATCAT GATTTAACAAGGTTTTGTTCGAATTTTCTTGAGATTAGCAATtatatttg tatattttttaaacatcCATCACTATCCGATTATGTACCGACTGTCTGAC TGTATTTTCCTTCCTGTGATGTATTGTAAAGGATAAACTCCGACGTCAAA TTAGAATTGTTACTATGTCGTCAAGAAATAAGCTTCGTGCTGAGGAAGTT TCCTTCCCGCAGTAATATGAAACTGAACTTGATTCattaaaagaatatat tttttggatACATAACGATCGGGTCAGAGAATATCTTCTTTTCAGGAGAA GCTTTAAGAATTCCacttttcactttcatttcGTTATTTTAGGACTGGCT GTATGTACTGGAGGGTTGTATGCAATCGCGTTGGCCATCACTATTTGTGG TTTCATTTTCTATACTAAGGTAGGAAGTTTatacttttctttaaaaacgT GGTCAGTTTTAACTTTGTACCTTTTTCGGCCCTTTTTAGGTCGGCCCATA TTTGCGGCAGTTAAAGGAAAAGGAGTCTTAGAACAACTCGTTGAGATGTC TCTCGAAacatacacacttttttaataTGAAACCCCAATTTTCAGCTCAG GGCTGAGGTtacttagcattctagctcattttctaaaagaattttctttg accacccctgatgTTATACAATACTTCTGCTTATTGGGCCAATGTGCTAT TGTTATAATTGAACATTCTCAGagtatctaaaaagcttttacttaaGAAG Atattaaaaaaggtttttttacccctgaaagaatgaaaaacacttcttta gaccccttttaccccctggaaatgttcttcCAACCCctatgtatggatat aaaatggaatgacccaTTAGGCGTCTtgctaacgtccatataatgttaAC TAACTCTTTTTACTCTCTATTCCCTCAGACTTCAGGATGTGGATTGAACA AattctttttgagtttcaactTCATCATTGCCGTTCTTCTGTCACTCATT TCCATTCATCCTCGTGTCCAAGAATCACAACCAACGTCAGGGCTGCTTCA AGCGTCCATCATTTCTGCATACAGCATGTATTTGACATTGTCCGCCATGT CTAATGAACCTGGCACAGATTGCAATCCAGGTAACAATTagttctagttt agacggcccacatttcgccctgcctattctaatggTGAATTAAGGTaagc ataaagtgggctgtctgaAGTCAATGCATtaccctcttttgacgtcaatg caatgtcttctttcaacctttttgAAACAAATAATTAAACTGCCCACTTT GTGCCCGCTTTGTGCCTACTCTTACAATTAGAATATGCAGGGCGAAAGTT GAGCCGTCAATACTAGAGCTTACCGCTGTTTAAAAACCTTTCCCGGTGTC ACGTGATGTATGCCCAATTCAAACAAGATTTATTTCTAGTTTAGTGCGAA AATGAGACGGTtgcgaaaatttcaaatttaaagtatTTTGTTTGACAGTA AAGTTTCTTGAACATAAAAACGAGGCATTGTGTAGAAAACGATCGAAAAT TTATGGAAAATAAAAGTGGAATATCTTTTGATCTAAGTAGACCAAATTAT ATAATTTCAAATCCCAGAGGGGGGTTGCACTCAATGTAAGCGACCTACTG TCGTCCGGCCCTTAAAAGAGAGAAAGTTGTACTGTAAGAtggaaaaatta ataaaatacgAAATCTTTGGGTGAAATTGGGGAAACTTCAAGAAAATTTA GCGGAGAATTTGAATAGCACTTTAAGGGCACgttttttgccaaatatttt ctttactGTAAGGGTCCAACAAAAGGTCAAAGGTCCTCCTCCCCGGGTTT CGAATGTCTCTCGAGTCGTCATTGTCGCCATGTTCACATATCATACATAG GCATTCGACGTCCTTCAACTCTGGTAAACTCGAATCCTTTCCCTTGTAAT GTTTCAAGGTCATGAAGTGGATTTTGTTCTACAGTTCGAGATTCTTTTTC TAGTGGCTTCCAACATCcttcaaattttatttaatgCCACCTTTAGCCGG GTGGTTATGTAATTATACTTTCTAGCATTTAAAAACGTTATACAAAATTT TGGTGTTAGGGTTTTATGTTACCCCGAGGGAAGATTTTCTCTGTGGTGTT AGCCTCGCTGTATTAAATGAGAACCAGTTTTTACTAATTCAAACTCTCTT TTCTACATGTGGTTTCTTCTTGCAAGTCATTCCCCTTCGCACCTGGTTTC GACACGAAAAACAGTGTTGGCAGCTATCTTTCTCTTTTCCCCGGCTTAAT CGTGTGTGACAACCAGTCCTTACTAATTCAAACTCCTTTTCTACAGGTAG TTCCTTCTTGCAAAGTGATTCTTTCGCACCTGGTTTCGACACACAAACAG TGTTGGCAGCCATCTTTCTTTTTTGCACGGTCGTCTATTCGTGTGTGAGA ACCAGTGCCAAAAGTTCTTCACTTTCCATCCAATCAGATGATGCAGACAT CGAAGAAGTTTTGCTAATCGAAAATAATGGACAGGGTGATGACGTAAGTT TAATAATTAAAGGAACAAAGTTCgggaatgggcttttccagaaaaaaaac cgtatTCCCCTGTTAAGGAAGTCCATCCCTGTGGCTggaaccccctggaa ttccagtcaatttcaggtttaaacccctctggaattctgaattttagtag gatttaaaaagctaccctacatggaattccagttatttttgacaaatttt tgtatctccctatggaattccgccacatatcaaaccttacccccttggaa cggaaatggacctgcTCAACagggtatacgttttttttctggaaaagtcc aattGCGTTTTATATTTTTAACCAACTGAATTAAAGTATCGCGAGTCTCG TTTTCAAAGTACCACGTATTGTTGCCAAGATATTTAACCGTCATTAAACA TGATTAATCTTTTTTGAGGGATTGTGATTTTGTAGCAGAATCTAGAATAT CTTTCGGAATACTTATCTAATAGTTGTCTAAATTACCGTAGCTACCTTTA ACAATCCAAAATTCCGCTTAACAATCGAATCACTTTCTATGCCACTGATT GGTTTGTTTGGCtcaatgaatttgaaatttgatcaatcaattgatttgat ttttgagctgacttttggattgttaaagGTATAAGCTACAGTAATTTAAC GACATTTACATATATATTCCGAAAGatattcttgagaaaaaattattatt ttccgGTTTTCCAGTCTTTTCTAGATTTTGTTCCCATTTAATTGTGTAAT GAATTTTAATATCatctttttatgttttcacGGATTGATTATATCAGTTT TTGAAAGGTTTAAACAGTAATTTGTTAGCCgtctttttttcatcattaCT CAGGATGTGGAATACAAAGGACAAAAAGTTTACGATAACGAGAGTACAGA AGTTGCATACAATTATTCANTATTACTCAGGACGTGGAATACAAAGGACA AAAAGTTTACGATAACGAGAGTACAGAAGTTGCATACAATtattcattct ttcatttcactTATGCATTGGCCTCACTCTATATCATGATGATGTTGACC AACTGGTACAGGTGAGTTTGACCACTCATTGAAACATTTTATTTAACTGG TCACTCTCAGCGTTAAGGCCAGTCTctacttgcgcgcgcttcgatcgcac tttttcgagcaaagcttccacactattagtcaaaagaaaaatgaagcaac tacATTGGTGCGATCTGGATCATTTCGAGCGCCcactacatttttatgac gttatcttttttccaagcaaaaaggattgaagccaaaaagtgcgattgaa gcgcgcgcaagtggagaccagtCTTTATAAAGAGAGGGTGGAAACATCAG ATGTCATTCTGCAAATTACTgaataaattttcgcgaatttccatgttaaa cattttcaaagacaCTAACTTTCACGAAAGAGGCCAAGACTGGTGGGATT CacgaaagttttcttttcgcTAAAATTTGCACTCTTAAAGTATTTGATCC TGTTAGATTAGGAATCCGTAAAGATTTTTGTGCTTTTTTTggacttaaag gttttgtttttaaataagggtGATATATGTAGTTTGCTTACTCGTTAGTT TCaacttacaagctttttcacacccctgtctcacagcctcggtggaacct ttttcctcaatggggataaaaatttcttttgaaattccaatggggataga aattcttttgttttaaggttaaataatccagtggggatggtttggagtgc aatttttaacattaaatttcgaatggggatgaaatgaaagtaaatttccc agtggggtaaTTTCCTAccggggaagaaatttttgccaaattttccagtg gggctggggtcccagcgggtctgtgacacaggggtgttttttcacattga ttattggtcagaaagaggaaaagaaaaatttcttgtttattcaatacaat ataacaatagggagagaccgtcctaatatgaaatatatgtctgatatggt gatatgaaacggaaaaacatttaaaatcgTTCCGTGCGCTGTTTTTTTCA GTGCTTTCCGATCACAGCTTTTTAATTCCCTTAGATAATGACTCTttata aaattcttttgtttctgtGTTTTAGCCCTGAAGGTGCAAACTTCAAAACC TTAACCAGCAGCATGGCTACAGTTTGGGTCAAGATGGCGTCAAGTTGGGC GTGTTTCGTCCTCTTTGGGTGGACTCTTGTCGCGCCTATGCTTTTTCCCG ATCGAGAGTTCCACTAAAGTTCGCTTTCCAGTACAAAAACCTTGTTTGTA TATAAGTGTACTTTTGAATTTTGTATTTAGATCCTTCTATTTAGGATCAA TTCTGTAACTATttagtttatttgtttttggtAAAGTTTAACCCATTGta taatttttagttttggtttcttttgtaAAATCTTTGTTGTAAGatatatt gttttgttttgtttaaaaagaaacttcCGATATGTTCGATTAAGACCAGA ATATACCTTTTCGTTTTTTTACATGGTAGCCAACTCTTGCCAGGGACGGT TGGGATCACAGATTTCTGTGTCCAAAGGGCCAAGCAAACGAACTTTATGC TGAATTGAACT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000024XLOC_000024Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000038-exon-sc0000001-1491911889:1005161..1005552TCONS_00000038-exon-sc0000001-1491911889:1005161..1005552Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1510915933:1005161..1005552TCONS_00000038-exon-sc0000001-1510915933:1005161..1005552Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1575043694:1005161..1005552TCONS_00000038-exon-sc0000001-1575043694:1005161..1005552Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1491911889:1009180..1009502TCONS_00000038-exon-sc0000001-1491911889:1009180..1009502Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1510915933:1009180..1009502TCONS_00000038-exon-sc0000001-1510915933:1009180..1009502Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1575043694:1009180..1009502TCONS_00000038-exon-sc0000001-1575043694:1009180..1009502Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1491911889:1010089..1010168TCONS_00000038-exon-sc0000001-1491911889:1010089..1010168Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1510915933:1010089..1010168TCONS_00000038-exon-sc0000001-1510915933:1010089..1010168Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1575043694:1010089..1010168TCONS_00000038-exon-sc0000001-1575043694:1010089..1010168Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1491911889:1010514..1010607TCONS_00000038-exon-sc0000001-1491911889:1010514..1010607Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1510915933:1010514..1010607TCONS_00000038-exon-sc0000001-1510915933:1010514..1010607Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1575043694:1010514..1010607TCONS_00000038-exon-sc0000001-1575043694:1010514..1010607Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1491911889:1011284..1011327TCONS_00000038-exon-sc0000001-1491911889:1011284..1011327Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1510915933:1011284..1011327TCONS_00000038-exon-sc0000001-1510915933:1011284..1011327Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1575043694:1011284..1011327TCONS_00000038-exon-sc0000001-1575043694:1011284..1011327Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1491911889:1011753..1011829TCONS_00000038-exon-sc0000001-1491911889:1011753..1011829Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1510915933:1011753..1011829TCONS_00000038-exon-sc0000001-1510915933:1011753..1011829Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1575043694:1011753..1011829TCONS_00000038-exon-sc0000001-1575043694:1011753..1011829Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1491911889:1012339..1012540TCONS_00000038-exon-sc0000001-1491911889:1012339..1012540Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1510915933:1012339..1012540TCONS_00000038-exon-sc0000001-1510915933:1012339..1012540Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1575043694:1012339..1012540TCONS_00000038-exon-sc0000001-1575043694:1012339..1012540Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1491911889:1013757..1013953TCONS_00000038-exon-sc0000001-1491911889:1013757..1013953Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1510915933:1013757..1013953TCONS_00000038-exon-sc0000001-1510915933:1013757..1013953Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1575043694:1013757..1013953TCONS_00000038-exon-sc0000001-1575043694:1013757..1013953Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1491911889:1014814..1015021TCONS_00000038-exon-sc0000001-1491911889:1014814..1015021Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1510915933:1014814..1015021TCONS_00000038-exon-sc0000001-1510915933:1014814..1015021Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1575043694:1014814..1015021TCONS_00000038-exon-sc0000001-1575043694:1014814..1015021Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1491911889:1016086..1016571TCONS_00000038-exon-sc0000001-1491911889:1016086..1016571Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1510915933:1016086..1016571TCONS_00000038-exon-sc0000001-1510915933:1016086..1016571Clytia hemisphaericaexon
TCONS_00000038-exon-sc0000001-1575043694:1016086..1016571TCONS_00000038-exon-sc0000001-1575043694:1016086..1016571Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1005161..1016571 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
50.4023 52.0518 41.0187 42.1967 12.5957 12.2748 18.3816 14.2615 33.9361 20.5501 29.4397 28.1495 26.6937 25.9841 12.5872 8.4356 12.4398 17.9532 23.3756 21.8657 21.2475 17.6981 18.1053 16.9125 74.3315 62.9468 18.148 11.5857 8.38175 14.4652
Blast
BLAST of TCONS_00000038 vs. Swiss-Prot (Human)
Match: SERC3 (Serine incorporator 3 OS=Homo sapiens GN=SERINC3 PE=2 SV=2)

HSP 1 Score: 230.335 bits (586), Expect = 7.155e-67
Identity = 162/405 (40.00%), Postives = 226/405 (55.80%), Query Frame = 3
Query:  453 QNSTASRIGYTLVLLLGFILSCVMLSPNIRQKLNKVPHLC------------PTFDCDQVVGYVAVYRVCXXXXXXXXXXXLITFKIRNSKDPRASIHNGFWAIKLLVFIALLVGAFYIPKGDFSRVWMYXXXXXXXXXXXXXXXXXXXXAYSWSQKWIGKYEETDNKIWFIGLAVCTGGLYAIALAITICGFIFYTKTSGCGLNKFFLSFNFIIAVLLSLISIHPRVQESQPTSGLLQASIISAYSMYLTLSAMSNEPGTDCNPG-SSF---LQSDSFAPGFDTQTVLAA-------------------IFLFCTVVYSCVRTSAKSSSLSIQSDDADIEEVLLIENNGQGDDDVEYKGQ--KVYDNESTEVAYNYSXL--------------LRTWNTKDKKF 1514
            +NST +R+ Y  +LLL  ++S +M    +   L K+P  C               DCD +VGY AVYR+ FAM  FFF+ +L+ FK++ SKD RA++HNGFW  K+   I ++VG+FYIP G FS VW  +GMIG  LFILIQLVLL+DFA+SW++ W+ + EE + ++W+  L   T   Y +++      + +YTK  GC  NKFF+S N I+ V+ S+ISIHP++QE QP SGLLQ+S+I+ Y+MYLT SAMSNEP   CNP   SF   + + + APG  T  V                      +F+ C ++YS +RTS  S    +    +D   V+L +    G  D E  GQ  +  DNE   V Y+YS                L +W + D KF
Sbjct:   33 KNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLC-LLYSSIRTSTNSQVDKLTLSGSD--SVILGDTTTSGASD-EEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIMMTLTSWYSPDAKF 433          

HSP 2 Score: 97.4413 bits (241), Expect = 3.433e-21
Identity = 47/89 (52.81%), Postives = 61/89 (68.54%), Query Frame = 2
Query: 1493 EYKGQ--KVYDNESTEVAYNYSFFHFTYALASLYIMMMLTNWYSPEGANFKTLTSSMATVWVKMASSWACFVLFGWTLVAPMLFPDREF 1753
            E  GQ  +  DNE   V Y+YS FH    LASLYIMM LT+WYSP+ A F+++TS    VWVK++SSW C +L+ WTLVAP++   R+F
Sbjct:  385 EEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIMMTLTSWYSPD-AKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDF 472          
The following BLAST results are available for this feature:
BLAST of TCONS_00000038 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SERC37.155e-6740.00Serine incorporator 3 OS=Homo sapiens GN=SERINC3 P... [more]
back to top