Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000029 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000029
Unique NameTCONS_00000029
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length770

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000029 ID=TCONS_00000029|Name=TCONS_00000029|organism=Clytia hemisphaerica|type=transcript|length=770bp
ATAAAACTGGCTGGGTAATGTCGACAATTATCGGTCTGtaaattaaaagt
tgttttctaaatattagaaaacgaaagtccATTCTTGACCATTATGAAAT
CTATCAAGAGaagaaaaagtcagaaaaacgcAGTCGCATTAAAGATTTTC
AACTTTAAAAGATTTCATCTGGCATATTTGTTCATATTTTCTATACCTAT
CAACGATGGTGAACGTTCAGAAAGGTGTTTTGATACAATGtgaTCCAACT
GTCAAACAATTTCTTCTCCACATGGACGAAACAAGATCATTGGGTGAAAA
ATTCATTCTCGAAGACATGGATGCAACACATCTTTTTGTATCAGCCAAAG
TTATCAAGACGCTTGAAGCGAAATTATGGGAATTAATGGACAAGTTATCA
TTCCCAGTCGGGGATGGTCAGTAAAAGTTATCatgatttttgaatgtttt
taacaAGAAATATTCACTTGTACGTGTTGGTTGGAATCGAAGAAAAACAA
CTATGTCAACTCCTGTTGTGAATAAACTTTTGTCGAAGCGAATATACGAA
TTGTCGCTAAACCTTTACCACAAAACTATCGATTCTGACCCAAGCATTCC
AGATACAAATTTTGGGTTAACATTTGAAGATTTGAATGAAGACATTTTGT
GGTTAAATTCGACATTTAAATTGATATAGCATAGATCTTATATGGGGGTA
TTTCAAATATAGCTACGTCATAGTCTCAAGTTAAAAGCTTAAACTACTTC
TCTCTACTTTTCTAGTGAAT
Run BLAST on NCBI

transcript from alignment at sc0000001:766554..770771+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000029 ID=TCONS_00000029|Name=TCONS_00000029|organism=Clytia hemisphaerica|type=transcript|length=4218bp|location=Sequence derived from alignment at sc0000001:766554..770771+ (Clytia hemisphaerica)
ATAAAACTGGCTGGGTAATGTCGACAATTATCGGTCTGtaaattaaaagt tgttttctaaatattagaaaacgaaagtccATTCTTGACCATTATGAAAT CTATCAAGAGaagaaaaagtcagaaaaacgcAGTCGCATTAAAGATTTTC AACTTTAAAAGATTTCATCTGGCATATTTGTTCATATTTTCTATACCTAT CAACGATGGTGAACGTTCAGAAAGGTGTTTTGATACAATGGTAAGACACC TCTTCTCGAAATAGATCTTTTGCTTTTATCAGAATGTCGTGGGTGTTCAG TCAGGGAAATTTTTCTATCTTATattccagacccccgcgctcgataggat cgatcatcggagcggctcgatgacggatcgatatgtgatcgatggattac ttatcgatccggataggaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNgatctcctatccggatcgataagtaatccatcgatcacatat cgatccgtcatcgagccgttccgatgatcgatcctatcgagcgcgggggt ctggtatATTAAAATTTTGCGTCGCACCACGATTAACTGCAATTACATAC TTATTGTTGACATGAtatttcaatagacctttttgcctttccatctGCCA TACCGTAACtaggtctaatgtcaacatccctcctctaatttcgacaccct ttttatcagagctgaaattgatataaaggttgaaactgtttttctttgct tgatGGTCAGAGAGGGATTATTCTTTTTCAATAAGTGACTCAAGCTTTCA TATATTATTCCTctctctaaaaaagggtgtcggaattagacgagggatgt cgatattagaccaacttacggtattgaattgtatgcaaaaatgaTGGGGG CTGAATTGCCGTGGCGAGATTGCATTAAAAATATGGCAAAACCTATCAGT CTAGCAAACCGAGCAAAAAGTTAattcttctttcagaaaaaatactATAA TTTGTTAATACCtctattcttgcagcttcccaacatccaagctctcaaac attaGAAGGCAAATGAAATTACTTCGATTTCCCATAGAAATTATGCaatg aaaaatccgggggtcaataaaccaaccagacggtactaatcgataaactt gattatcaaagaaattgataaacttgattatcgaagtaatcgataataat cgaagtaatcgaacaaccatttatcgattaacaatcaaatttgagtacca aaatttgaaaaaaattgtgagtcttcgatcactttcttaacaacccttcg aGGAATCGATTACTGTTTgtgagtactttgattgttattgattgttttcg ataactttgacaacttcgataaccaattgattGCTTCGAAACCAATTACT Atgatatatctttaagaaaaaccaaaaaaactgacctaaaaccaaagcaa agaagaCCCGCCATAAAGATTGACCTCCTTAATTCCCAACCATATTGCGC CCACCATTTTGTGCGCCTTCGCCCTGGCAGTCTAGCAGAATGTTAattct tctttcagaaaaaagactataatttgtttacctttattcttgcagctttc catcatccaagctctcaaacatcacaagcggaatgaaattactttcaatt tcccgtagaaattatgcgatgaaaaatccgggggtcaaagaataaaaact ttcttttcagcACTAGTTATCTTTGCTTATAacgaattattacttttcaa tatattttttaaatataatttctGCTTACAAAAATACTTAACATTGtact gaaagtttgaaaaagttgattctACTTAGTTCTTGTtgaatttaagcgag tttctattttgcaatttttctacagagacaaataaagattttttctattg ttcttgcttGATTGCCTCTACTGTAAGGGTAAGTTCCGTAGGAATGAGGC TATCGAGACATAATGTGACGAATTTGCAGGAAAACTAAATTTAACATTTC TCTAGGCTGACTATGCGAAAGAAAGTatatattaatataaaacttacatg catattGCATATAATTGGCAtaattaaagtgtaatcttgtagatgAAAGA TTAAAAtagcttctcttgaaaactagaGATAATTGAATTCACTCATCTCA CAGAACAAGGGCtgcttagaacaagcacttgacttcaaaaaaccataaca ttagacataaactcaagctgaaaaatcaccagcgaaggtaaaaaaaatcC TTAATCAGCTGACATTGAATTATTGCatatgttttgaatattttccaact aaatccgcCTACCACGACTTTTTTGTTGCTGtattttgcatacaattcaa ggcGAAAGGTCTATCTCACTCTTCTTGAAAATCTTCGCTTTTGAAATCTG CACTTTTTTGTATATTATTCAAGATAAAGGGAGGACTTTATTTAAttaat aattataataataatcCCCAAATTTATTTCCTCAAAATAAATATATTATA TAAATATGAAATACTGCACCATGAAAAGGaaagagaaagttttttttcaa aacattataTTCAAATAGCAGTTGTACAGCAATTAGAATTTTGGAACCAT GGTTATTATCTTTGAATGGAATCAATGTTAgagtttttggaatttttgaa agGTTCTTTTAATAGCCATGTCATgtctgttccaaaaaaaatctGCACAT TTTGATACaatcttaaaagaaaaaagtaacaCCTTATAACGTAATAAAAT TAcctgaaataaattttgagtggatgattttacctttcagaaaattcgGA AAATAAGAAGGAAACATTCAGAATTTTTTCTGCTGGGCAAAATTTTTGCT GTTCTGAACTTCACTGATTTCAGATATGTATTcagaatttttatcatttt cttggaaatttcAGCCCTCCGAAATAGGCTTTAAGTGCCAAAAGATTGCA AAATGTAcccaaaaaaactttcataaagttccaaaatattgcaaatcaac aaaaaagattaaaatcttaactcaattttatttttattcctaTATTTTAT CAATCCTGGGTTAACTGTTTGTGAGCTGACGGTTATGTCtgagccaaagt tcgaaaattgaCTTTGCTTTTTGCCCCTTTTCTAAGTATTTTACGATCCT GTGATGGCCCCAATTTTCAGTAATAATTTTCCAACATTGCTCTTTTTCTT TTGAGAATTTATCAGTATCACCCTGTGAGGAAGttgctttttgatatttt gttcttCAGGTCTCGAGAGGATCAACCGTTTCTACCCCCTAGAGATGTTT CTATTAGTGTAAAAAAGGGATCTTCATGGCTCGCACACAAATAACCCCTA GATCTTTCGCTCAACTGTTCTTCtcctttttctttcagtgaTCCAACTGT CAAACAATTTCTTCTCCACATGGACGAAACAAGATCATTGGGTGAAAAAT TCATTCTCGAAGACATGGATGCAACACATCTTTTTGTATCAGCCAAAGTT ATCAAGACGCTTGAAGCGAAATTATGGGAATTAATGGACAAGTTATCATT CCCAGTCGGGGATGGTCAGTAAAAGTTATCatgatttttgaatgttttta acaAGAAATATTCACTTGTACGTGTTGGTTGGAATCGAAGAAAAACAACT ATGTCAACTCCTGTTGTGAATAAACTTTTGTCGAAGCGAATATACGAATT GTCGCTAAACCTTTACCACAAAACTATCGATTCTGACCCAAGCATTCCAG ATACAAATTTTGGGTTAACATTTGAAGATTTGAATGAAGACATTTTGTGG TTAAATTCGACATTTAAATTGATATAGCATAGATCTTATATGGGGGTATT TCAAATATAGCTACGTCATAGTCTCAAGTTAAAAGCTTAAACTACTTCTC TCTACTTTTCTAGTGAAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000018XLOC_000018Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000029-exon-sc0000001-1491911889:766554..766793TCONS_00000029-exon-sc0000001-1491911889:766554..766793Clytia hemisphaericaexon
TCONS_00000029-exon-sc0000001-1510915933:766554..766793TCONS_00000029-exon-sc0000001-1510915933:766554..766793Clytia hemisphaericaexon
TCONS_00000029-exon-sc0000001-1575043694:766554..766793TCONS_00000029-exon-sc0000001-1575043694:766554..766793Clytia hemisphaericaexon
TCONS_00000029-exon-sc0000001-1491911889:770242..770771TCONS_00000029-exon-sc0000001-1491911889:770242..770771Clytia hemisphaericaexon
TCONS_00000029-exon-sc0000001-1510915933:770242..770771TCONS_00000029-exon-sc0000001-1510915933:770242..770771Clytia hemisphaericaexon
TCONS_00000029-exon-sc0000001-1575043694:770242..770771TCONS_00000029-exon-sc0000001-1575043694:770242..770771Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:766554..770771 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
23.0757 20.3915 18.2405 18.1395 18.8558 13.4844 15.0495 15.0712 12.3669 9.6437 7.8345 7.8618 5.82345 4.42238 7.83785 6.39617 13.4893 14.9005 3.98738 7.99019 11.5801 11.093 17.6498 15.5148 7.94409 11.1499 18.556 14.2005 14.9436 14.3041
Blast
BLAST of TCONS_00000029 vs. Swiss-Prot (Human)
Match: TF2H5 (General transcription factor IIH subunit 5 OS=Homo sapiens GN=GTF2H5 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.554e-21
Identity = 37/68 (54.41%), Postives = 57/68 (83.82%), Query Frame = 2
Query:  206 MVNVQKGVLIQCDPTVKQFLLHMDETRSLGEKFILEDMDATHLFVSAKVIKTLEAKLWELMDKLSFPV 409
            MVNV KGVLI+CDP +KQFLL++DE+ +LG+KFI++D+D TH+FV A+++  L+ ++ ELMD+ +F +
Sbjct:    1 MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSL 68          
The following BLAST results are available for this feature:
BLAST of TCONS_00000029 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TF2H51.554e-2154.41General transcription factor IIH subunit 5 OS=Homo... [more]
back to top