TCONS_00000017 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000017
Unique NameTCONS_00000017
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1129

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000017 ID=TCONS_00000017|Name=TCONS_00000017|organism=Clytia hemisphaerica|type=transcript|length=1129bp
aaattttttaaagttctcagaagactccagtggtgtatatcatgaataga
ttttaAAAATCCCAATCAGCCTAAAGTAGAAATTTGTCTCGTTTATTGTA
TTTTCTTATCATCTAGCAGATTATTCAATcaataataatttttaaaaaga
tcATGGAAAAGAAAGAACATTTGTACAAGATTTTGGTCATTGGAGACTTG
GGAACAGGAAAGACCAGTATAATCAAACGTTATGTTCACAATTTCTTCTC
AGTTCACTACAGGGCAACTATTGGTGTTGATTTTGCTTTGAAAGTGTTGA
ATTGGGATGACAAAACATTGATACGTCTACAGCTATGGGATATAGCagGA
CAAGAACGTTTTGGAAACATGACAAGGGTGTATTACAAAGAAGCCGTAGG
ATGTTTCATCGTGTTCGATGTAACGAGACAATCAACATTCGAAGCAGTCT
CTAAATGGAAGAACGATCTCGATACTAAAGTTCAACTTCCTGATGGAAAA
CCAATCCCATGTTTATTATTAGCTAACAAATGTGATCAACCGAAAGAAGG
GTTAGTCAATAAGCCATCAGATATGGATAAATTTTGTGAAGAGAAAGGGT
TCATTGGTTGGTACGAGACAAGTGCCAAAGAAAACATAAATATCGATGAA
GCTTCGAAATTCCTTGTTCAAAAGATTCTAGAGAACGATCGAGCCAACAA
TCTGACAAGTCCAGACATCGATGATGATAAAATTGACCTGAGGAAGAAGC
CTGTTGATGTCGTCACGCAGCAAGAACGCTCGGGCTGCTGCTAAACTTTT
AAACGAAATCACATTTAATGCcagttatatttttttttcaaaattaaaag
gtaataatatttttgtgcttttgaatttttttaatagaattctttattta
cattttgttttgtttttgttgacaACAATCTAACTTTGGGTATCTATGTC
GTCAGGACTAGCTCAGTAAAAATTTCACGGAATTTGAATTTGCCATGTTT
TGACAGAATATTACACAAGTAAggtcagtagcgtagacaagagggtGCAC
AACAtagtatgaacccccccccttttttaagggggggggatccgagtttt
caaggaaggctttataggggggatgggca
Run BLAST on NCBI

protein sequence of TCONS_00000017-protein

>TCONS_00000017-protein ID=TCONS_00000017-protein|Name=TCONS_00000017-protein|organism=Clytia hemisphaerica|type=polypeptide|length=213bp
MEKKEHLYKILVIGDLGTGKTSIIKRYVHNFFSVHYRATIGVDFALKVLN
WDDKTLIRLQLWDIAGQERFGNMTRVYYKEAVGCFIVFDVTRQSTFEAVS
KWKNDLDTKVQLPDGKPIPCLLLANKCDQPKEGLVNKPSDMDKFCEEKGF
IGWYETSAKENINIDEASKFLVQKILENDRANNLTSPDIDDDKIDLRKKP
VDVVTQQERSGCC
Run BLAST on NCBI

transcript from alignment at sc0000001:359692..372295+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000017 ID=TCONS_00000017|Name=TCONS_00000017|organism=Clytia hemisphaerica|type=transcript|length=12604bp|location=Sequence derived from alignment at sc0000001:359692..372295+ (Clytia hemisphaerica)
aaattttttaaagttctcagaagactccagtggtgtatatcatgaataga ttttaAAAATCCCAATCAGCCTAAAGTAGAAATTTGTCTCGTTTATTGTA TTTTCTTATCATCTAGCAGATTATTCAATcaataataatttttaaaaaga tcATGGAAAAGAAAGAACATTTGTACAAGATTTTGGTCATTGGAGACTTG GGAACAGGAAAGACCAGTATAATCAAACGTTATGTTCACAATTTCTTCTC AGTTCACTACAGGGCAACTGTAAGTTCATTTCATTCTGTTTAATTTTGGA TATATACATTatataaaggaagaaattttggcgggaagaaaatttgacGG ATTTGGATTTGGTGGATTTTGTCGAaacccgccaaattaagttccagCCA AAAGTTACTTTTTCCACCATccatcaaattaaattcctgccaaatttaaG TCTTCTCATTTTTTCGTTTCGATTTTTCACTATTTAGGCCCTAAATGGga gtattttcaacattttcacaCTGATTGTAAACCTTGAAACTCATTAATTT CATTGCCAATCCGCTAAACTAAATttcctctaaaaaactttttcggtcat ccgccaaattaaattccggccaaaatttcttcctttaatatACTTTCctt aataaatttatttttgctgttaATTGGAACAACTTGGGAAAGAACAGATT AACTTTcgaaagatttgaattttttataaatcaaaataaTGAGTGAATTT CAAAGACCTTTTTGTAGAGCAAAATTCCTCCACCTTTCCTGATTGTGATA GAGGAATCTCTAGAAACATAGTGGCCCTACCTGTCCTACCCTTTAATTTC CACTGGAGCAAAGAAAATATGAGGGGTTTTGTATAATTGGTcgaaaatga tcagaaaacattAATTCAACTTTTAAGAAATTCAACTCAAAGAAGGTTTT TAAGATGTTGACAGTGTCGAAATAGTCTAATTTAAAGAatttatattcaa aacaaaaacttggTTCAATAAAAATGGTGTACATAGGATTTCCGAGTCCT CCATCCAAACTTACTAAATTTCATGATCAAATGAgtaaataaaacaaata tacaggtacgagccgggaagtatcttatccatttggtggactaactttct tggggtttttcttgttccttatggtaataagaatattttaagcttctggg ccacctggatttctcacctgggtatccataatggcggatttttggtcatg tgacccccgtacgcaaaactgaaaattcgtccaacccaaatataggcata tcatatatcaatcgatcggaaatttgatactgattaattttgagatgcaa agttgggtctgaaaactttcctatctcgagatataaatcactttcgtttt ctcaggtttggctgcagttgtaggcTTTCATGGAGTtaggcaattctttt agtcatatctcaagaaatatgctttaaaacatatcaaaactttatgtgct cctagaaaaggcattaaaaattgtttatgcaaattttcaaaaattttgca gaaaaaatgtGTATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNcataaaattttgatgaaattagtcTGGCTTTGAGA CCACTAAGCCATGATAGCTTTGTATGCGCCAGACGTCagactttgaatta ttttcctaaaaaagaacaaagtcccaaagtttttatttcttgcaaGCTTG CTAGACACTAGCACAGATTTGTCGCACAGTCACTGAACGGGCCTGTAGAG TTTCTGTCCACCCTACGACcatcacatggtatgggttggcCCTAGCAAAG TAgcatttacttttcattaaCTGAAACACAGCACCGAGTTGGAGTTAGTC CTGATCTCCTAGACAACGGTCAATACTACTACTGCGCCTTCACATGGGAT AAATCataactggacgtctatcttccattgtgtctttgaagcgagcttcg ttgccgcctgtattattaaattggtataaaaaagcCGTTGATATTCCGTC ACAATGCTATTTCGTTGAATTacttaggtaaaatgattgatagatagCTT GATAGTTTGAAAATCTATACTGTATATTAATatgctaaaacgtgtgtgtt tacaacgttttataaaaagttttcgaaaatctaacaaagctctacaaagc ctcctcttcatggcgttgaacttttttctcctttcttttataaaatcaaa atcttatcatCAATCAGCAGCTATCTTTCTTCCGTTGGGTATTTTTTTTA TGTATAGTGATttgctggattgggacacgcagcgtgcgacgctgcgcata cggctagttacTCTCAAGTCACaaaatgattattttcaattttttttata cgcNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN agaattttaaaatcaagatttcttaatattatacttagatttttgtaaga aaacggGGATATTTTGGACATGTAGCTTAAAGCATTATTTTATATGGCAA CAACTTCTTTAAAGCGCTTTAAGTTAAAACTCCTACAGTCTGACTTCTTC AACTAGCTGAAGGCTTTGTGTTGCACTCATGTAGTTAAAGCGGATATACA ATGATGCATTGGATTCATTATACGCCTCTTATAATTGTAACAGTAACCAG AATAGCCCCAAGCAGGTTCACAAATATGGCTCCATCACTAGGCTTCCTAC AATGGCCTTGGATTATCGCCTCTCGAAGCCATATTATGCCAACGTTTTTT GGTCCTACAGACAACACagattctaagccctctaaatctcgTTTCATGCA TGAACAATGAAGATAAAGGAATTGGCGAANNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNccagaagcttaaaatattcttattaccataag gaacaagaaaaaccccaagaaagttagtccaccaaatggataagatactt cccggctcgtacctgtATAAAAGGGTAGACGAGTGCAGAATGAACTTGGA CAAACTTAGTCCActataaaaataatctttaacatAACCAGCTCCTAGAA TAAGTACTAGTAAATAACACTACGTTcaggctattttgaaatgttttcaa ggGGCTATTATTCCCAAAATCATCCAAACGACCATGTTACTCCTCGTTAA TTTTTATGGACAAATTAAAATTCAGCCACTCCTCCTTGTAACTTATTTTG TTCAcatatcttttttaattttcctttttatttttgtcactTAAATAGAA GTCGAATGACAActaataaatcaaaatattctaaTTGCACAACTGTGAAA TCaattagtttttgaaaaaggtcataaagatttttatttttctcttttcg cgGGGTGATTACAGCAGGTTTATTACGGATTAATCACCCTGCTCCTCCCT TACATTTCTAAGCTAAAATGTAATCAGCCATATGATTACATGAAAAGAGT CACACTTACATTTTGAGAATTAATTGATGAAGGCTAAAATAGCTTCACTT GTCTACTTGTCTACTTATATGTTTACGAAGTAACTTCGACCTCTATATAT ACTAGGTCACTACTAAAATAAATCTTAATTGCCTGATTACATAATTAGGG TTGGGGTTAATGTCGTTAGCTATAGCATTTCAAAATAGTCGTAAAATAAA ACTTAAGGAAGACTTAACAGGAAGTACTCAAATAGGGAATTTGAAAGTAA TTAAAGGGGTAATGACAGTTAGCTTTCTGAGGAGCAAATATAATTTGATA TTGACTTTAATCATGCGAAAATGGGGATAAATGGCTTCCTGAGATTGTGA AACCTCGATTGTATTCACGAATCCAAGAGTTAACTTGGGGTTGCGCtcag aatttcaattttttaatttccatCTCTTTCCATCACTCTTTATGAGTATA TATaaacagatttaaaaaatatatttacagtTAACTTGTTGaggatttaa aggttttatttttacataagtgttcccgtttatATCAGACGCATATTtaa tatcaggacagtgtctgcctattgttttATTATGCTTATATAtccggggg ggtacttaggcaaaatgggtgctgggtatgtgcgaacCATAAAGGTTCCT TTTTCACACTCCCGAAAGCCTCTCAAAGGAGTCGTGATTtccaaaatttg aacaaaagtcaagtgaaaatcgacaaaaattttgagaaaagtctctctaa gggtcccaaaaaacgcCAACTTTTcttctctctaagggtcgattttcgat ttttggctcgtcAACTGGCAAACCTACATATAAtataaacctttttcatt tttctctcaGATTGGTGTTGATTTTGCTTTGAAAGTGTTGAATTGGGATG ACAAAACATTGATACGTCTACAGCTATGGGATATAGCaggtgaaactttt ttttttattgaaccaaaataaaaaaatgaagatacGACTTTTGCAAAAAT AGATTCTGTCACATTTGCAAAAcgcgctttttttataagaatacacttta taagaatgtccatgataaaaatagccaaaaaagctaagaatatcaccatc atggagtTTTGCTACTCAaactaagaatgccatttttagagtacTTTCAA TTATAAGTcgccccaagtaaggctcactccttcacaaaaatgccattatA TGCTTGAGGCGTACGTACTAAAtattaaatctagtctgaattaggatcct aacctaagatgcggtaagaatattttaggatgattttcccaaaaaagtta aaactattcatgatgaaatggatttacaccattcttataaaaaaagcgtt tacCACACAAGTCATCttttcattttaagaaaatacTAGTAACAATTTCT ACGTGGTTCTAccactacagggtgtccctaattaaagtatcgagtttgaa catgcgattgagtagaaaagtttgtgtgtgttatcgctaaaatataagaa cgttctccatcacacaggcttattaNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaaggtagttacaa cgtataaattaatcgtaatgacaaagaaaaaagagggagagcttaaaata caattttgtgaacacgcacataaaactttctactcataaattgtgtttcg actcgatactttaattagggacaccctgtatttacCTTTTAATTAGTTCT ACGAAATAGAATTGGTTgtaaattatattttcattatttttgtttcaaat tcttTAGGACAAGAACGTTTTGGAAACATGACAAGGGTAATGATCGTTTG AATTATTCTAGAGATCGTcctatcattatttttttaacccTTACTGAAGT TATCAAAGTAGTGAAAATAGGGTACACGCCTTATAATGCCTCAATGTCAC CAtagaaataagaacatgataagaacaattttaggctcaaagtgccaaaa aaataagaacagatgAGCTTCTTAAAAGATTTGCTGGGTCTTATGTAAAA AATGCACAAtggaatctccataactcgagcaTGCAAGCGGGGGATACAAA TTTATTCGAGTTTAGGAAATcccgagttatggagtaaggtttataagaca GTGTTAACTTTAGGGAGAATAAACTTGTTCGAGTGTAGGAGACGTTGGAG TTAGAGGTTTGATAAAATCAATAAATCCACTGAATTTGATTTCTTGCTTC ACATGTGTATTACAAAGAAGCTGTGGGATGAAGACTTGTCTGAAATCTAG CGTCTCCGCTGCTTCTTGTTTACAtcaagggaactaattttcgcgggaac taatttttgttttttccgcGGTTTTTCAGCAACCCACAGAACCCACGAAT TACTAATTTAGCCATTCtatcaaaaaagttgaaaaatccctagaaatAAC GAAAAAAATGTGTCGAAAATATGGCAAAActtcgaaaattaattcccgcg agagacgattttttcgaattttttttctactgcaaaaattagttcctttt taaaaatttttatactTTCACATACACAGGTGTATTACAAAGAAGCCGTA GGATGTTTCATCGTGTTCGATGTAACGAGACAATCAACATTCGAAGCAGT CTCTAAATGGAAGAACGATCTCGATACTAAAGTTCAACTTCCTGATGGAA AACCAATCCCATGTTTATTATTAGCTAACAAAGTAAGTTTAGTTTTACTC CTGACTaaagtaacctgataacagattgtatattttctggcccagtacgc tgaagctctaaagacgtgggcgaaaatatagtttttagcgatctttagag cttcagggTGCTGTCGCGTTAAGAAAACTCCACAGTTGTTATCAGGTTAG ACTACAGAGGAAAGCTAGTAGGTAGGCTTGGTTAGTGAAGAATGACTCGG TAAATTGCATACTTTTACTATACAAGTGTTTTTCCATTCATCATCGAAAT TCTTAACTTCTTGGGGAAATtcattctaaaatattcttacggtattctta ggtcaAGATCGAaattaaaaacttaaatttaacatgtaatacccacctga agcataaaatggcattttcgtATTGAGCCTTACTCGggaagggctactta gactacacattATATTGGTGATCAATATTCAACAAAATTgcttgcggacc gtaatgtacgaagtaaccAACAGttgctctattataaaaaggagttttct ttctgtaaacaatccccctatattgttggcaaatcgagctgacaatatat tgcggacaacttttcaatatattgccagcATTCAACAATATATTCTCAAT ATATTGcccgacaatatattgtgtagtgtatgtagccctttaggTTCTGT TCAAATTTCattataaatattcttatagagtatAATTTGTAGCTAGAAAT GTGTTATCCCTTTCCAGTGAAGGGATACGCCGATAAAGTGATCATTCTCC TTCAGTTAATTTAACCAACACTGGGCTTAATCCACCACAGTTATCTTTTT TCTAGGTAGATTTTTTGGATGATAATTTTCTAGAAGAAAAATTAATATGA AGCATCACACGAACAAAGCATGTATGAACAGACTGAAAACTTATATAAGA AGCCATCTGTTTCATTTCTCTTTAGTGTGATCAACCGAAAGAAGGGTTAG TCAATAAGCCATCAGATATGGATAAATTTTGTGAAGAGAAAGGGTTCATT GGTTGGTACGAGACAAGTGCCAAAGAAAACATAAATATCGATGAAGCTTC GAAATTCCTTGTTCAAAAGGTAGGTATCAAAGTTGTTTAAGATATTGTTG GCAAATTCCCTAAAACCATTATTGTtagctacaatcaaggtcattatatt tgagaaaaagggtaattcctacgaaatcttaCAGCCACAAACGATTTGAA AGCGCTCTGATTTATTTTCGCAGGGTAGAGTCTTAAccctgagttttaac actagacttaacaACATCCAAATAGTTCAAGATTGGTCCAATacggctca gaatatagcctgaaagTCTATGAACCCCTCCCTAATTGAAAATTTCGATT ACATTTTACAAATAGCCCCAAAGTGACTTTCTGGCCCGAAGCGaagaaat aaccaaaattctcaatatgtTTTGACgatacagtgccgtaggaagcattt tcatattgggggggctgaagtttagtgacactgcgagggccaaccatggt ttggcccgagggggaaaatttttaaaatttttgtaaaacatgAAGCTGAG CTGAATAGGACTGAACATTCCGAGATTATCTTtagacatttttgtgaaat tcttaAAGACATACACTGACTGATTTTTTATCTTACCACTCTACCAAAGC TTGCCGAAGTTAGATATGAGATAGTAGAttgcacttttttttataagaac aaattatataagaacataaggctttggtggccaaaatcttaagaacaaat taagaatattttaaggctttgtgttCTTTAAAACACCTGTTTtgttagga aaatggacaaaaatactcaaaaataacatgctaaaaacatttttaggctt gaaacccgaAAAGCTAAGAGCATCTGaaggattcaaaaattttggatatt cttataaaaaaacgtgtattatttgatttctattatTCTGTTTCGTAGAT TCTAGAGAACGATCGAGCCAACAATCTGACAAGTCCAGACATCGATGATG ATAAAATTGACCTGAGGAAGAAGCCTGTTGATGTCGTCACGCAGCAAGAA CGCTCGGGCTGCTGCTAAGTAATCTATACTAGACAGTTAGCGTCCGTCCC TGGTAAGAGGGAATCCGGTTCTGTTATAATTTTTAGATAAATTCATTTTG TAgataataaaaaagtatttcagCAATTATATAATTTTAAGATGATCCGT ACTTTTTAGAATAATAGAGGATATGTTCATGGGGTGGaaacttcttcatt tttaaaaacattttgacccTAAATATTGAAGttgcttaaccctttaagtg ccgatgtcgtatatatacgacatgggctatataggagggcgaagccctcc tgtaatgcccagtttgagttagaaatcgttaNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNcgagctatatacgagcttctaattccttctagatcaggagatataag cccttaaagtttgaactagcgatttttttaaaaaaacttagaaaaaagga ccatggcactcaaagggttaagatTCTGCAAAACTTGCGATCAAATTTTA AGCTATTCTAATGAGCGAATGCCCAAAACTCTTGAAATGTGTTTTATTCT TGTAACTTTTCTTTTGGGTATATCCCCATAAACTTCGATATTTCTTATAT ACTTCGATatgttattttatattttatcctTGATATAAAAAGAAGCACAA TTTGTTTTATCTTTTATAGACTTTTAAACGAAATCACATTTAATGCcagt tatatttttttttcaaaattaaaaggtaataatatttttgtgcttttgaa tttttttaatagaattctttatttacattttgttttgtttttgttgacaA CAATCTAACTTTGGGTATCTATGTCGTCAGGACTAGCTCAGTAAAAATTT CACGGAATTTGAATTTGCCATGTTTTGACAGAATATTACACAAGTAAggt cagtagcgtagacaagagggtGCACAACAtagtatgaacccccccccttt tttaagggggggggatccgagttttcaaggaaggctttataggggggatg ggca

Coding sequence (CDS) from alignment at sc0000001:359692..372295+

>TCONS_00000017 ID=TCONS_00000017|Name=TCONS_00000017|organism=Clytia hemisphaerica|type=CDS|length=3852bp|location=Sequence derived from alignment at sc0000001:359692..372295+ (Clytia hemisphaerica)
ATGGAAAAGAAAGAACATTTGTACAAGATTTTGGTCATTGGAGACTTGGG
AACAGGAAAGACCAGTATAATCAAACGTTATGTTCACAATTTCTTCTCAG
TTCACTACAGGGCAACTATTGGTGTTGATTTTGCTTTGAAAGTGTTGAAT
TGGGATGACAAAACATTGATACGTCTACAGCTATGGGATATAGCagGACA
AGAACGTTTTGGAAACATGACAAGGGTGTATTACAAAGAAGCCGTAGGAT
GTTTCATCGTGTTCGATGTAACGAGACAATCAACATTCGAAGCAGTCTCT
AAATGGAAGAACGATCTCGATACTAAAGTTCAACTTCCTGATGGAAAACC
AATCCCATGTTTATTATTAGCTAACAAATGTGATCAACCGAAAGAAGGGT
TAGTCAATAAGCCATCAGATATGGATAAATTTTGTGAAGAGAAAGGGTTC
ATTGGTTGGTACGAGACAAGTGCCAAAGAAAACATAAATATCGATGAAGC
TTCGAAATTCCTTGTTCAAAAGATTCTAGAGAACGATCGAGCCAACAATC
TGACAAGTCCAGACATCGATGATGATAAAATTGACCTGAGGAAGAAGCCT
GTTGATGTCGTCACGCAGCAAGAACGCTCGGGCTGCTGCTAAATGGAAAA
GAAAGAACATTTGTACAAGATTTTGGTCATTGGAGACTTGGGAACAGGAA
AGACCAGTATAATCAAACGTTATGTTCACAATTTCTTCTCAGTTCACTAC
AGGGCAACTATTGGTGTTGATTTTGCTTTGAAAGTGTTGAATTGGGATGA
CAAAACATTGATACGTCTACAGCTATGGGATATAGCagGACAAGAACGTT
TTGGAAACATGACAAGGGTGTATTACAAAGAAGCCGTAGGATGTTTCATC
GTGTTCGATGTAACGAGACAATCAACATTCGAAGCAGTCTCTAAATGGAA
GAACGATCTCGATACTAAAGTTCAACTTCCTGATGGAAAACCAATCCCAT
GTTTATTATTAGCTAACAAATGTGATCAACCGAAAGAAGGGTTAGTCAAT
AAGCCATCAGATATGGATAAATTTTGTGAAGAGAAAGGGTTCATTGGTTG
GTACGAGACAAGTGCCAAAGAAAACATAAATATCGATGAAGCTTCGAAAT
TCCTTGTTCAAAAGATTCTAGAGAACGATCGAGCCAACAATCTGACAAGT
CCAGACATCGATGATGATAAAATTGACCTGAGGAAGAAGCCTGTTGATGT
CGTCACGCAGCAAGAACGCTCGGGCTGCTGCTAAATGGAAAAGAAAGAAC
ATTTGTACAAGATTTTGGTCATTGGAGACTTGGGAACAGGAAAGACCAGT
ATAATCAAACGTTATGTTCACAATTTCTTCTCAGTTCACTACAGGGCAAC
TATTGGTGTTGATTTTGCTTTGAAAGTGTTGAATTGGGATGACAAAACAT
TGATACGTCTACAGCTATGGGATATAGCagGACAAGAACGTTTTGGAAAC
ATGACAAGGGTGTATTACAAAGAAGCCGTAGGATGTTTCATCGTGTTCGA
TGTAACGAGACAATCAACATTCGAAGCAGTCTCTAAATGGAAGAACGATC
TCGATACTAAAGTTCAACTTCCTGATGGAAAACCAATCCCATGTTTATTA
TTAGCTAACAAATGTGATCAACCGAAAGAAGGGTTAGTCAATAAGCCATC
AGATATGGATAAATTTTGTGAAGAGAAAGGGTTCATTGGTTGGTACGAGA
CAAGTGCCAAAGAAAACATAAATATCGATGAAGCTTCGAAATTCCTTGTT
CAAAAGATTCTAGAGAACGATCGAGCCAACAATCTGACAAGTCCAGACAT
CGATGATGATAAAATTGACCTGAGGAAGAAGCCTGTTGATGTCGTCACGC
AGCAAGAACGCTCGGGCTGCTGCTAAATGGAAAAGAAAGAACATTTGTAC
AAGATTTTGGTCATTGGAGACTTGGGAACAGGAAAGACCAGTATAATCAA
ACGTTATGTTCACAATTTCTTCTCAGTTCACTACAGGGCAACTATTGGTG
TTGATTTTGCTTTGAAAGTGTTGAATTGGGATGACAAAACATTGATACGT
CTACAGCTATGGGATATAGCagGACAAGAACGTTTTGGAAACATGACAAG
GGTGTATTACAAAGAAGCCGTAGGATGTTTCATCGTGTTCGATGTAACGA
GACAATCAACATTCGAAGCAGTCTCTAAATGGAAGAACGATCTCGATACT
AAAGTTCAACTTCCTGATGGAAAACCAATCCCATGTTTATTATTAGCTAA
CAAATGTGATCAACCGAAAGAAGGGTTAGTCAATAAGCCATCAGATATGG
ATAAATTTTGTGAAGAGAAAGGGTTCATTGGTTGGTACGAGACAAGTGCC
AAAGAAAACATAAATATCGATGAAGCTTCGAAATTCCTTGTTCAAAAGAT
TCTAGAGAACGATCGAGCCAACAATCTGACAAGTCCAGACATCGATGATG
ATAAAATTGACCTGAGGAAGAAGCCTGTTGATGTCGTCACGCAGCAAGAA
CGCTCGGGCTGCTGCTAAATGGAAAAGAAAGAACATTTGTACAAGATTTT
GGTCATTGGAGACTTGGGAACAGGAAAGACCAGTATAATCAAACGTTATG
TTCACAATTTCTTCTCAGTTCACTACAGGGCAACTATTGGTGTTGATTTT
GCTTTGAAAGTGTTGAATTGGGATGACAAAACATTGATACGTCTACAGCT
ATGGGATATAGCagGACAAGAACGTTTTGGAAACATGACAAGGGTGTATT
ACAAAGAAGCCGTAGGATGTTTCATCGTGTTCGATGTAACGAGACAATCA
ACATTCGAAGCAGTCTCTAAATGGAAGAACGATCTCGATACTAAAGTTCA
ACTTCCTGATGGAAAACCAATCCCATGTTTATTATTAGCTAACAAATGTG
ATCAACCGAAAGAAGGGTTAGTCAATAAGCCATCAGATATGGATAAATTT
TGTGAAGAGAAAGGGTTCATTGGTTGGTACGAGACAAGTGCCAAAGAAAA
CATAAATATCGATGAAGCTTCGAAATTCCTTGTTCAAAAGATTCTAGAGA
ACGATCGAGCCAACAATCTGACAAGTCCAGACATCGATGATGATAAAATT
GACCTGAGGAAGAAGCCTGTTGATGTCGTCACGCAGCAAGAACGCTCGGG
CTGCTGCTAAATGGAAAAGAAAGAACATTTGTACAAGATTTTGGTCATTG
GAGACTTGGGAACAGGAAAGACCAGTATAATCAAACGTTATGTTCACAAT
TTCTTCTCAGTTCACTACAGGGCAACTATTGGTGTTGATTTTGCTTTGAA
AGTGTTGAATTGGGATGACAAAACATTGATACGTCTACAGCTATGGGATA
TAGCagGACAAGAACGTTTTGGAAACATGACAAGGGTGTATTACAAAGAA
GCCGTAGGATGTTTCATCGTGTTCGATGTAACGAGACAATCAACATTCGA
AGCAGTCTCTAAATGGAAGAACGATCTCGATACTAAAGTTCAACTTCCTG
ATGGAAAACCAATCCCATGTTTATTATTAGCTAACAAATGTGATCAACCG
AAAGAAGGGTTAGTCAATAAGCCATCAGATATGGATAAATTTTGTGAAGA
GAAAGGGTTCATTGGTTGGTACGAGACAAGTGCCAAAGAAAACATAAATA
TCGATGAAGCTTCGAAATTCCTTGTTCAAAAGATTCTAGAGAACGATCGA
GCCAACAATCTGACAAGTCCAGACATCGATGATGATAAAATTGACCTGAG
GAAGAAGCCTGTTGATGTCGTCACGCAGCAAGAACGCTCGGGCTGCTGCT
AA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000009XLOC_000009Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000017-exon-sc0000001-1491911889:359692..359960TCONS_00000017-exon-sc0000001-1491911889:359692..359960Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1510915933:359692..359960TCONS_00000017-exon-sc0000001-1510915933:359692..359960Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1491911889:366852..366930TCONS_00000017-exon-sc0000001-1491911889:366852..366930Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1510915933:366852..366930TCONS_00000017-exon-sc0000001-1510915933:366852..366930Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1491911889:367799..367827TCONS_00000017-exon-sc0000001-1491911889:367799..367827Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1510915933:367799..367827TCONS_00000017-exon-sc0000001-1510915933:367799..367827Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1491911889:368571..368723TCONS_00000017-exon-sc0000001-1491911889:368571..368723Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1510915933:368571..368723TCONS_00000017-exon-sc0000001-1510915933:368571..368723Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1491911889:369667..369810TCONS_00000017-exon-sc0000001-1491911889:369667..369810Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1510915933:369667..369810TCONS_00000017-exon-sc0000001-1510915933:369667..369810Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1491911889:370690..370809TCONS_00000017-exon-sc0000001-1491911889:370690..370809Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1510915933:370690..370809TCONS_00000017-exon-sc0000001-1510915933:370690..370809Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1491911889:371961..372295TCONS_00000017-exon-sc0000001-1491911889:371961..372295Clytia hemisphaericaexon
TCONS_00000017-exon-sc0000001-1510915933:371961..372295TCONS_00000017-exon-sc0000001-1510915933:371961..372295Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000017-proteinTCONS_00000017-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:359692..372295 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
4.47002 1.51085 1.11395 1.25302 0.929741 2.56274 2.89382 3.48832 3.35372 2.61907 0.822909 1.85883 5.85141 5.04437 8.43471 11.1243 11.4807 7.61786 6.29388 11.6495 10.1516 10.8981 7.9956 7.06754 7.45335 9.18362 20.3304 14.2817 25.577 18.5263
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001806Small_GTPase
IPR005225Small_GTP-bd_dom
IPR030697Rab29/Rab38/Rab32
IPR027417P-loop_NTPase
Vocabulary: Molecular Function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
Vocabulary: Cellular Component
TermDefinition
GO:0005802trans-Golgi network
GO:0031982vesicle
GO:0005794Golgi apparatus
Vocabulary: Biological Process
TermDefinition
GO:0016192vesicle-mediated transport
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016192 vesicle-mediated transport
cellular_component GO:0005794 Golgi apparatus
cellular_component GO:0005802 trans-Golgi network
cellular_component GO:0031982 vesicle
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005525 GTP binding
Blast
BLAST of TCONS_00000017 vs. Swiss-Prot (Human)
Match: RAB32 (Ras-related protein Rab-32 OS=Homo sapiens GN=RAB32 PE=1 SV=3)

HSP 1 Score: 284.263 bits (726), Expect = 5.902e-94
Identity = 130/176 (73.86%), Postives = 154/176 (87.50%), Query Frame = 3
Query:  168 HLYKILVIGDLGTGKTSIIKRYVHNFFSVHYRATIGVDFALKVLNWDDKTLIRLQLWDIAGQERFGNMTRVYYKEAVGCFIVFDVTRQSTFEAVSKWKNDLDTKVQLPDGKPIPCLLLANKCDQPKEGLVNKPSDMDKFCEEKGFIGWYETSAKENINIDEASKFLVQKILENDRA 695
            HL+K+LVIG+LG GKTSIIKRYVH  FS HYRATIGVDFALKVLNWD +TL+RLQLWDIAGQERFGNMTRVYYKEAVG F+VFD++R STFEAV KWK+DLD+KV LP+G PIP +LLANKCDQ K+     PS +D+FC+E GF GW+ETSAK+NINI+EA++FLV+KIL N ++
Sbjct:   24 HLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDS-SQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQS 198          
The following BLAST results are available for this feature:
BLAST of TCONS_00000017 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RAB325.902e-9473.86Ras-related protein Rab-32 OS=Homo sapiens GN=RAB3... [more]
back to top