TCONS_00000017 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000017
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1129

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000017 ID=TCONS_00000017|Name=|organism=Clytia hemisphaerica|type=transcript|length=1129bp
aaattttttaaagttctcagaagactccagtggtgtatatcatgaataga
ttttaAAAATCCCAATCAGCCTAAAGTAGAAATTTGTCTCGTTTATTGTA
TTTTCTTATCATCTAGCAGATTATTCAATcaataataatttttaaaaaga
tcATGGAAAAGAAAGAACATTTGTACAAGATTTTGGTCATTGGAGACTTG
GGAACAGGAAAGACCAGTATAATCAAACGTTATGTTCACAATTTCTTCTC
AGTTCACTACAGGGCAACTATTGGTGTTGATTTTGCTTTGAAAGTGTTGA
ATTGGGATGACAAAACATTGATACGTCTACAGCTATGGGATATAGCagGA
CAAGAACGTTTTGGAAACATGACAAGGGTGTATTACAAAGAAGCCGTAGG
ATGTTTCATCGTGTTCGATGTAACGAGACAATCAACATTCGAAGCAGTCT
CTAAATGGAAGAACGATCTCGATACTAAAGTTCAACTTCCTGATGGAAAA
CCAATCCCATGTTTATTATTAGCTAACAAATGTGATCAACCGAAAGAAGG
GTTAGTCAATAAGCCATCAGATATGGATAAATTTTGTGAAGAGAAAGGGT
TCATTGGTTGGTACGAGACAAGTGCCAAAGAAAACATAAATATCGATGAA
GCTTCGAAATTCCTTGTTCAAAAGATTCTAGAGAACGATCGAGCCAACAA
TCTGACAAGTCCAGACATCGATGATGATAAAATTGACCTGAGGAAGAAGC
CTGTTGATGTCGTCACGCAGCAAGAACGCTCGGGCTGCTGCTAAACTTTT
AAACGAAATCACATTTAATGCcagttatatttttttttcaaaattaaaag
gtaataatatttttgtgcttttgaatttttttaatagaattctttattta
cattttgttttgtttttgttgacaACAATCTAACTTTGGGTATCTATGTC
GTCAGGACTAGCTCAGTAAAAATTTCACGGAATTTGAATTTGCCATGTTT
TGACAGAATATTACACAAGTAAggtcagtagcgtagacaagagggtGCAC
AACAtagtatgaacccccccccttttttaagggggggggatccgagtttt
caaggaaggctttataggggggatgggca
Run BLAST on NCBI

protein sequence of TCONS_00000017-protein

>TCONS_00000017-protein ID=TCONS_00000017-protein|Name=TCONS_00000017-protein|organism=Clytia hemisphaerica|type=polypeptide|length=213bp
MEKKEHLYKILVIGDLGTGKTSIIKRYVHNFFSVHYRATIGVDFALKVLN
WDDKTLIRLQLWDIAGQERFGNMTRVYYKEAVGCFIVFDVTRQSTFEAVS
KWKNDLDTKVQLPDGKPIPCLLLANKCDQPKEGLVNKPSDMDKFCEEKGF
IGWYETSAKENINIDEASKFLVQKILENDRANNLTSPDIDDDKIDLRKKP
VDVVTQQERSGCC
Run BLAST on NCBI

transcript from alignment at sc0000001:359692..372295+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000017 ID=TCONS_00000017|Name=TCONS_00000017|organism=Clytia hemisphaerica|type=transcript|length=12604bp|location=Sequence derived from alignment at sc0000001:359692..372295+ (Clytia hemisphaerica)
aaattttttaaagttctcagaagactccagtggtgtatatcatgaataga ttttaAAAATCCCAATCAGCCTAAAGTAGAAATTTGTCTCGTTTATTGTA TTTTCTTATCATCTAGCAGATTATTCAATcaataataatttttaaaaaga tcATGGAAAAGAAAGAACATTTGTACAAGATTTTGGTCATTGGAGACTTG GGAACAGGAAAGACCAGTATAATCAAACGTTATGTTCACAATTTCTTCTC AGTTCACTACAGGGCAACTGTAAGTTCATTTCATTCTGTTTAATTTTGGA TATATACATTatataaaggaagaaattttggcgggaagaaaatttgacGG ATTTGGATTTGGTGGATTTTGTCGAaacccgccaaattaagttccagCCA AAAGTTACTTTTTCCACCATccatcaaattaaattcctgccaaatttaaG TCTTCTCATTTTTTCGTTTCGATTTTTCACTATTTAGGCCCTAAATGGga gtattttcaacattttcacaCTGATTGTAAACCTTGAAACTCATTAATTT CATTGCCAATCCGCTAAACTAAATttcctctaaaaaactttttcggtcat ccgccaaattaaattccggccaaaatttcttcctttaatatACTTTCctt aataaatttatttttgctgttaATTGGAACAACTTGGGAAAGAACAGATT AACTTTcgaaagatttgaattttttataaatcaaaataaTGAGTGAATTT CAAAGACCTTTTTGTAGAGCAAAATTCCTCCACCTTTCCTGATTGTGATA GAGGAATCTCTAGAAACATAGTGGCCCTACCTGTCCTACCCTTTAATTTC CACTGGAGCAAAGAAAATATGAGGGGTTTTGTATAATTGGTcgaaaatga tcagaaaacattAATTCAACTTTTAAGAAATTCAACTCAAAGAAGGTTTT TAAGATGTTGACAGTGTCGAAATAGTCTAATTTAAAGAatttatattcaa aacaaaaacttggTTCAATAAAAATGGTGTACATAGGATTTCCGAGTCCT CCATCCAAACTTACTAAATTTCATGATCAAATGAgtaaataaaacaaata tacaggtacgagccgggaagtatcttatccatttggtggactaactttct tggggtttttcttgttccttatggtaataagaatattttaagcttctggg ccacctggatttctcacctgggtatccataatggcggatttttggtcatg tgacccccgtacgcaaaactgaaaattcgtccaacccaaatataggcata tcatatatcaatcgatcggaaatttgatactgattaattttgagatgcaa agttgggtctgaaaactttcctatctcgagatataaatcactttcgtttt ctcaggtttggctgcagttgtaggcTTTCATGGAGTtaggcaattctttt agtcatatctcaagaaatatgctttaaaacatatcaaaactttatgtgct cctagaaaaggcattaaaaattgtttatgcaaattttcaaaaattttgca gaaaaaatgtGTATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNcataaaattttgatgaaattagtcTGGCTTTGAGA CCACTAAGCCATGATAGCTTTGTATGCGCCAGACGTCagactttgaatta ttttcctaaaaaagaacaaagtcccaaagtttttatttcttgcaaGCTTG CTAGACACTAGCACAGATTTGTCGCACAGTCACTGAACGGGCCTGTAGAG TTTCTGTCCACCCTACGACcatcacatggtatgggttggcCCTAGCAAAG TAgcatttacttttcattaaCTGAAACACAGCACCGAGTTGGAGTTAGTC CTGATCTCCTAGACAACGGTCAATACTACTACTGCGCCTTCACATGGGAT AAATCataactggacgtctatcttccattgtgtctttgaagcgagcttcg ttgccgcctgtattattaaattggtataaaaaagcCGTTGATATTCCGTC ACAATGCTATTTCGTTGAATTacttaggtaaaatgattgatagatagCTT GATAGTTTGAAAATCTATACTGTATATTAATatgctaaaacgtgtgtgtt tacaacgttttataaaaagttttcgaaaatctaacaaagctctacaaagc ctcctcttcatggcgttgaacttttttctcctttcttttataaaatcaaa atcttatcatCAATCAGCAGCTATCTTTCTTCCGTTGGGTATTTTTTTTA TGTATAGTGATttgctggattgggacacgcagcgtgcgacgctgcgcata cggctagttacTCTCAAGTCACaaaatgattattttcaattttttttata cgcNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN agaattttaaaatcaagatttcttaatattatacttagatttttgtaaga aaacggGGATATTTTGGACATGTAGCTTAAAGCATTATTTTATATGGCAA CAACTTCTTTAAAGCGCTTTAAGTTAAAACTCCTACAGTCTGACTTCTTC AACTAGCTGAAGGCTTTGTGTTGCACTCATGTAGTTAAAGCGGATATACA ATGATGCATTGGATTCATTATACGCCTCTTATAATTGTAACAGTAACCAG AATAGCCCCAAGCAGGTTCACAAATATGGCTCCATCACTAGGCTTCCTAC AATGGCCTTGGATTATCGCCTCTCGAAGCCATATTATGCCAACGTTTTTT GGTCCTACAGACAACACagattctaagccctctaaatctcgTTTCATGCA TGAACAATGAAGATAAAGGAATTGGCGAANNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNccagaagcttaaaatattcttattaccataag gaacaagaaaaaccccaagaaagttagtccaccaaatggataagatactt cccggctcgtacctgtATAAAAGGGTAGACGAGTGCAGAATGAACTTGGA CAAACTTAGTCCActataaaaataatctttaacatAACCAGCTCCTAGAA TAAGTACTAGTAAATAACACTACGTTcaggctattttgaaatgttttcaa ggGGCTATTATTCCCAAAATCATCCAAACGACCATGTTACTCCTCGTTAA TTTTTATGGACAAATTAAAATTCAGCCACTCCTCCTTGTAACTTATTTTG TTCAcatatcttttttaattttcctttttatttttgtcactTAAATAGAA GTCGAATGACAActaataaatcaaaatattctaaTTGCACAACTGTGAAA TCaattagtttttgaaaaaggtcataaagatttttatttttctcttttcg cgGGGTGATTACAGCAGGTTTATTACGGATTAATCACCCTGCTCCTCCCT TACATTTCTAAGCTAAAATGTAATCAGCCATATGATTACATGAAAAGAGT CACACTTACATTTTGAGAATTAATTGATGAAGGCTAAAATAGCTTCACTT GTCTACTTGTCTACTTATATGTTTACGAAGTAACTTCGACCTCTATATAT ACTAGGTCACTACTAAAATAAATCTTAATTGCCTGATTACATAATTAGGG TTGGGGTTAATGTCGTTAGCTATAGCATTTCAAAATAGTCGTAAAATAAA ACTTAAGGAAGACTTAACAGGAAGTACTCAAATAGGGAATTTGAAAGTAA TTAAAGGGGTAATGACAGTTAGCTTTCTGAGGAGCAAATATAATTTGATA TTGACTTTAATCATGCGAAAATGGGGATAAATGGCTTCCTGAGATTGTGA AACCTCGATTGTATTCACGAATCCAAGAGTTAACTTGGGGTTGCGCtcag aatttcaattttttaatttccatCTCTTTCCATCACTCTTTATGAGTATA TATaaacagatttaaaaaatatatttacagtTAACTTGTTGaggatttaa aggttttatttttacataagtgttcccgtttatATCAGACGCATATTtaa tatcaggacagtgtctgcctattgttttATTATGCTTATATAtccggggg ggtacttaggcaaaatgggtgctgggtatgtgcgaacCATAAAGGTTCCT TTTTCACACTCCCGAAAGCCTCTCAAAGGAGTCGTGATTtccaaaatttg aacaaaagtcaagtgaaaatcgacaaaaattttgagaaaagtctctctaa gggtcccaaaaaacgcCAACTTTTcttctctctaagggtcgattttcgat ttttggctcgtcAACTGGCAAACCTACATATAAtataaacctttttcatt tttctctcaGATTGGTGTTGATTTTGCTTTGAAAGTGTTGAATTGGGATG ACAAAACATTGATACGTCTACAGCTATGGGATATAGCaggtgaaactttt ttttttattgaaccaaaataaaaaaatgaagatacGACTTTTGCAAAAAT AGATTCTGTCACATTTGCAAAAcgcgctttttttataagaatacacttta taagaatgtccatgataaaaatagccaaaaaagctaagaatatcaccatc atggagtTTTGCTACTCAaactaagaatgccatttttagagtacTTTCAA TTATAAGTcgccccaagtaaggctcactccttcacaaaaatgccattatA TGCTTGAGGCGTACGTACTAAAtattaaatctagtctgaattaggatcct aacctaagatgcggtaagaatattttaggatgattttcccaaaaaagtta aaactattcatgatgaaatggatttacaccattcttataaaaaaagcgtt tacCACACAAGTCATCttttcattttaagaaaatacTAGTAACAATTTCT ACGTGGTTCTAccactacagggtgtccctaattaaagtatcgagtttgaa catgcgattgagtagaaaagtttgtgtgtgttatcgctaaaatataagaa cgttctccatcacacaggcttattaNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaaggtagttacaa cgtataaattaatcgtaatgacaaagaaaaaagagggagagcttaaaata caattttgtgaacacgcacataaaactttctactcataaattgtgtttcg actcgatactttaattagggacaccctgtatttacCTTTTAATTAGTTCT ACGAAATAGAATTGGTTgtaaattatattttcattatttttgtttcaaat tcttTAGGACAAGAACGTTTTGGAAACATGACAAGGGTAATGATCGTTTG AATTATTCTAGAGATCGTcctatcattatttttttaacccTTACTGAAGT TATCAAAGTAGTGAAAATAGGGTACACGCCTTATAATGCCTCAATGTCAC CAtagaaataagaacatgataagaacaattttaggctcaaagtgccaaaa aaataagaacagatgAGCTTCTTAAAAGATTTGCTGGGTCTTATGTAAAA AATGCACAAtggaatctccataactcgagcaTGCAAGCGGGGGATACAAA TTTATTCGAGTTTAGGAAATcccgagttatggagtaaggtttataagaca GTGTTAACTTTAGGGAGAATAAACTTGTTCGAGTGTAGGAGACGTTGGAG TTAGAGGTTTGATAAAATCAATAAATCCACTGAATTTGATTTCTTGCTTC ACATGTGTATTACAAAGAAGCTGTGGGATGAAGACTTGTCTGAAATCTAG CGTCTCCGCTGCTTCTTGTTTACAtcaagggaactaattttcgcgggaac taatttttgttttttccgcGGTTTTTCAGCAACCCACAGAACCCACGAAT TACTAATTTAGCCATTCtatcaaaaaagttgaaaaatccctagaaatAAC GAAAAAAATGTGTCGAAAATATGGCAAAActtcgaaaattaattcccgcg agagacgattttttcgaattttttttctactgcaaaaattagttcctttt taaaaatttttatactTTCACATACACAGGTGTATTACAAAGAAGCCGTA GGATGTTTCATCGTGTTCGATGTAACGAGACAATCAACATTCGAAGCAGT CTCTAAATGGAAGAACGATCTCGATACTAAAGTTCAACTTCCTGATGGAA AACCAATCCCATGTTTATTATTAGCTAACAAAGTAAGTTTAGTTTTACTC CTGACTaaagtaacctgataacagattgtatattttctggcccagtacgc tgaagctctaaagacgtgggcgaaaatatagtttttagcgatctttagag cttcagggTGCTGTCGCGTTAAGAAAACTCCACAGTTGTTATCAGGTTAG ACTACAGAGGAAAGCTAGTAGGTAGGCTTGGTTAGTGAAGAATGACTCGG TAAATTGCATACTTTTACTATACAAGTGTTTTTCCATTCATCATCGAAAT TCTTAACTTCTTGGGGAAATtcattctaaaatattcttacggtattctta ggtcaAGATCGAaattaaaaacttaaatttaacatgtaatacccacctga agcataaaatggcattttcgtATTGAGCCTTACTCGggaagggctactta gactacacattATATTGGTGATCAATATTCAACAAAATTgcttgcggacc gtaatgtacgaagtaaccAACAGttgctctattataaaaaggagttttct ttctgtaaacaatccccctatattgttggcaaatcgagctgacaatatat tgcggacaacttttcaatatattgccagcATTCAACAATATATTCTCAAT ATATTGcccgacaatatattgtgtagtgtatgtagccctttaggTTCTGT TCAAATTTCattataaatattcttatagagtatAATTTGTAGCTAGAAAT GTGTTATCCCTTTCCAGTGAAGGGATACGCCGATAAAGTGATCATTCTCC TTCAGTTAATTTAACCAACACTGGGCTTAATCCACCACAGTTATCTTTTT TCTAGGTAGATTTTTTGGATGATAATTTTCTAGAAGAAAAATTAATATGA AGCATCACACGAACAAAGCATGTATGAACAGACTGAAAACTTATATAAGA AGCCATCTGTTTCATTTCTCTTTAGTGTGATCAACCGAAAGAAGGGTTAG TCAATAAGCCATCAGATATGGATAAATTTTGTGAAGAGAAAGGGTTCATT GGTTGGTACGAGACAAGTGCCAAAGAAAACATAAATATCGATGAAGCTTC GAAATTCCTTGTTCAAAAGGTAGGTATCAAAGTTGTTTAAGATATTGTTG GCAAATTCCCTAAAACCATTATTGTtagctacaatcaaggtcattatatt tgagaaaaagggtaattcctacgaaatcttaCAGCCACAAACGATTTGAA AGCGCTCTGATTTATTTTCGCAGGGTAGAGTCTTAAccctgagttttaac actagacttaacaACATCCAAATAGTTCAAGATTGGTCCAATacggctca gaatatagcctgaaagTCTATGAACCCCTCCCTAATTGAAAATTTCGATT ACATTTTACAAATAGCCCCAAAGTGACTTTCTGGCCCGAAGCGaagaaat aaccaaaattctcaatatgtTTTGACgatacagtgccgtaggaagcattt tcatattgggggggctgaagtttagtgacactgcgagggccaaccatggt ttggcccgagggggaaaatttttaaaatttttgtaaaacatgAAGCTGAG CTGAATAGGACTGAACATTCCGAGATTATCTTtagacatttttgtgaaat tcttaAAGACATACACTGACTGATTTTTTATCTTACCACTCTACCAAAGC TTGCCGAAGTTAGATATGAGATAGTAGAttgcacttttttttataagaac aaattatataagaacataaggctttggtggccaaaatcttaagaacaaat taagaatattttaaggctttgtgttCTTTAAAACACCTGTTTtgttagga aaatggacaaaaatactcaaaaataacatgctaaaaacatttttaggctt gaaacccgaAAAGCTAAGAGCATCTGaaggattcaaaaattttggatatt cttataaaaaaacgtgtattatttgatttctattatTCTGTTTCGTAGAT TCTAGAGAACGATCGAGCCAACAATCTGACAAGTCCAGACATCGATGATG ATAAAATTGACCTGAGGAAGAAGCCTGTTGATGTCGTCACGCAGCAAGAA CGCTCGGGCTGCTGCTAAGTAATCTATACTAGACAGTTAGCGTCCGTCCC TGGTAAGAGGGAATCCGGTTCTGTTATAATTTTTAGATAAATTCATTTTG TAgataataaaaaagtatttcagCAATTATATAATTTTAAGATGATCCGT ACTTTTTAGAATAATAGAGGATATGTTCATGGGGTGGaaacttcttcatt tttaaaaacattttgacccTAAATATTGAAGttgcttaaccctttaagtg ccgatgtcgtatatatacgacatgggctatataggagggcgaagccctcc tgtaatgcccagtttgagttagaaatcgttaNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNcgagctatatacgagcttctaattccttctagatcaggagatataag cccttaaagtttgaactagcgatttttttaaaaaaacttagaaaaaagga ccatggcactcaaagggttaagatTCTGCAAAACTTGCGATCAAATTTTA AGCTATTCTAATGAGCGAATGCCCAAAACTCTTGAAATGTGTTTTATTCT TGTAACTTTTCTTTTGGGTATATCCCCATAAACTTCGATATTTCTTATAT ACTTCGATatgttattttatattttatcctTGATATAAAAAGAAGCACAA TTTGTTTTATCTTTTATAGACTTTTAAACGAAATCACATTTAATGCcagt tatatttttttttcaaaattaaaaggtaataatatttttgtgcttttgaa tttttttaatagaattctttatttacattttgttttgtttttgttgacaA CAATCTAACTTTGGGTATCTATGTCGTCAGGACTAGCTCAGTAAAAATTT CACGGAATTTGAATTTGCCATGTTTTGACAGAATATTACACAAGTAAggt cagtagcgtagacaagagggtGCACAACAtagtatgaacccccccccttt tttaagggggggggatccgagttttcaaggaaggctttataggggggatg ggca

Coding sequence (CDS) from alignment at sc0000001:359692..372295+

>TCONS_00000017 ID=TCONS_00000017|Name=|organism=Clytia hemisphaerica|type=CDS|length=3852bp|location=Sequence derived from alignment at sc0000001:359692..372295+ (Clytia hemisphaerica)
ATGGAAAAGAAAGAACATTTGTACAAGATTTTGGTCATTGGAGACTTGGG
AACAGGAAAGACCAGTATAATCAAACGTTATGTTCACAATTTCTTCTCAG
TTCACTACAGGGCAACTATTGGTGTTGATTTTGCTTTGAAAGTGTTGAAT
TGGGATGACAAAACATTGATACGTCTACAGCTATGGGATATAGCagGACA
AGAACGTTTTGGAAACATGACAAGGGTGTATTACAAAGAAGCCGTAGGAT
GTTTCATCGTGTTCGATGTAACGAGACAATCAACATTCGAAGCAGTCTCT
AAATGGAAGAACGATCTCGATACTAAAGTTCAACTTCCTGATGGAAAACC
AATCCCATGTTTATTATTAGCTAACAAATGTGATCAACCGAAAGAAGGGT
TAGTCAATAAGCCATCAGATATGGATAAATTTTGTGAAGAGAAAGGGTTC
ATTGGTTGGTACGAGACAAGTGCCAAAGAAAACATAAATATCGATGAAGC
TTCGAAATTCCTTGTTCAAAAGATTCTAGAGAACGATCGAGCCAACAATC
TGACAAGTCCAGACATCGATGATGATAAAATTGACCTGAGGAAGAAGCCT
GTTGATGTCGTCACGCAGCAAGAACGCTCGGGCTGCTGCTAAATGGAAAA
GAAAGAACATTTGTACAAGATTTTGGTCATTGGAGACTTGGGAACAGGAA
AGACCAGTATAATCAAACGTTATGTTCACAATTTCTTCTCAGTTCACTAC
AGGGCAACTATTGGTGTTGATTTTGCTTTGAAAGTGTTGAATTGGGATGA
CAAAACATTGATACGTCTACAGCTATGGGATATAGCagGACAAGAACGTT
TTGGAAACATGACAAGGGTGTATTACAAAGAAGCCGTAGGATGTTTCATC
GTGTTCGATGTAACGAGACAATCAACATTCGAAGCAGTCTCTAAATGGAA
GAACGATCTCGATACTAAAGTTCAACTTCCTGATGGAAAACCAATCCCAT
GTTTATTATTAGCTAACAAATGTGATCAACCGAAAGAAGGGTTAGTCAAT
AAGCCATCAGATATGGATAAATTTTGTGAAGAGAAAGGGTTCATTGGTTG
GTACGAGACAAGTGCCAAAGAAAACATAAATATCGATGAAGCTTCGAAAT
TCCTTGTTCAAAAGATTCTAGAGAACGATCGAGCCAACAATCTGACAAGT
CCAGACATCGATGATGATAAAATTGACCTGAGGAAGAAGCCTGTTGATGT
CGTCACGCAGCAAGAACGCTCGGGCTGCTGCTAAATGGAAAAGAAAGAAC
ATTTGTACAAGATTTTGGTCATTGGAGACTTGGGAACAGGAAAGACCAGT
ATAATCAAACGTTATGTTCACAATTTCTTCTCAGTTCACTACAGGGCAAC
TATTGGTGTTGATTTTGCTTTGAAAGTGTTGAATTGGGATGACAAAACAT
TGATACGTCTACAGCTATGGGATATAGCagGACAAGAACGTTTTGGAAAC
ATGACAAGGGTGTATTACAAAGAAGCCGTAGGATGTTTCATCGTGTTCGA
TGTAACGAGACAATCAACATTCGAAGCAGTCTCTAAATGGAAGAACGATC
TCGATACTAAAGTTCAACTTCCTGATGGAAAACCAATCCCATGTTTATTA
TTAGCTAACAAATGTGATCAACCGAAAGAAGGGTTAGTCAATAAGCCATC
AGATATGGATAAATTTTGTGAAGAGAAAGGGTTCATTGGTTGGTACGAGA
CAAGTGCCAAAGAAAACATAAATATCGATGAAGCTTCGAAATTCCTTGTT
CAAAAGATTCTAGAGAACGATCGAGCCAACAATCTGACAAGTCCAGACAT
CGATGATGATAAAATTGACCTGAGGAAGAAGCCTGTTGATGTCGTCACGC
AGCAAGAACGCTCGGGCTGCTGCTAAATGGAAAAGAAAGAACATTTGTAC
AAGATTTTGGTCATTGGAGACTTGGGAACAGGAAAGACCAGTATAATCAA
ACGTTATGTTCACAATTTCTTCTCAGTTCACTACAGGGCAACTATTGGTG
TTGATTTTGCTTTGAAAGTGTTGAATTGGGATGACAAAACATTGATACGT
CTACAGCTATGGGATATAGCagGACAAGAACGTTTTGGAAACATGACAAG
GGTGTATTACAAAGAAGCCGTAGGATGTTTCATCGTGTTCGATGTAACGA
GACAATCAACATTCGAAGCAGTCTCTAAATGGAAGAACGATCTCGATACT
AAAGTTCAACTTCCTGATGGAAAACCAATCCCATGTTTATTATTAGCTAA
CAAATGTGATCAACCGAAAGAAGGGTTAGTCAATAAGCCATCAGATATGG
ATAAATTTTGTGAAGAGAAAGGGTTCATTGGTTGGTACGAGACAAGTGCC
AAAGAAAACATAAATATCGATGAAGCTTCGAAATTCCTTGTTCAAAAGAT
TCTAGAGAACGATCGAGCCAACAATCTGACAAGTCCAGACATCGATGATG
ATAAAATTGACCTGAGGAAGAAGCCTGTTGATGTCGTCACGCAGCAAGAA
CGCTCGGGCTGCTGCTAAATGGAAAAGAAAGAACATTTGTACAAGATTTT
GGTCATTGGAGACTTGGGAACAGGAAAGACCAGTATAATCAAACGTTATG
TTCACAATTTCTTCTCAGTTCACTACAGGGCAACTATTGGTGTTGATTTT
GCTTTGAAAGTGTTGAATTGGGATGACAAAACATTGATACGTCTACAGCT
ATGGGATATAGCagGACAAGAACGTTTTGGAAACATGACAAGGGTGTATT
ACAAAGAAGCCGTAGGATGTTTCATCGTGTTCGATGTAACGAGACAATCA
ACATTCGAAGCAGTCTCTAAATGGAAGAACGATCTCGATACTAAAGTTCA
ACTTCCTGATGGAAAACCAATCCCATGTTTATTATTAGCTAACAAATGTG
ATCAACCGAAAGAAGGGTTAGTCAATAAGCCATCAGATATGGATAAATTT
TGTGAAGAGAAAGGGTTCATTGGTTGGTACGAGACAAGTGCCAAAGAAAA
CATAAATATCGATGAAGCTTCGAAATTCCTTGTTCAAAAGATTCTAGAGA
ACGATCGAGCCAACAATCTGACAAGTCCAGACATCGATGATGATAAAATT
GACCTGAGGAAGAAGCCTGTTGATGTCGTCACGCAGCAAGAACGCTCGGG
CTGCTGCTAAATGGAAAAGAAAGAACATTTGTACAAGATTTTGGTCATTG
GAGACTTGGGAACAGGAAAGACCAGTATAATCAAACGTTATGTTCACAAT
TTCTTCTCAGTTCACTACAGGGCAACTATTGGTGTTGATTTTGCTTTGAA
AGTGTTGAATTGGGATGACAAAACATTGATACGTCTACAGCTATGGGATA
TAGCagGACAAGAACGTTTTGGAAACATGACAAGGGTGTATTACAAAGAA
GCCGTAGGATGTTTCATCGTGTTCGATGTAACGAGACAATCAACATTCGA
AGCAGTCTCTAAATGGAAGAACGATCTCGATACTAAAGTTCAACTTCCTG
ATGGAAAACCAATCCCATGTTTATTATTAGCTAACAAATGTGATCAACCG
AAAGAAGGGTTAGTCAATAAGCCATCAGATATGGATAAATTTTGTGAAGA
GAAAGGGTTCATTGGTTGGTACGAGACAAGTGCCAAAGAAAACATAAATA
TCGATGAAGCTTCGAAATTCCTTGTTCAAAAGATTCTAGAGAACGATCGA
GCCAACAATCTGACAAGTCCAGACATCGATGATGATAAAATTGACCTGAG
GAAGAAGCCTGTTGATGTCGTCACGCAGCAAGAACGCTCGGGCTGCTGCT
AA
Gene-mRNA-Prot