TCONS_00000013 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000013
Unique NameTCONS_00000013
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2120

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000013 ID=TCONS_00000013|Name=TCONS_00000013|organism=Clytia hemisphaerica|type=transcript|length=2120bp
attgttttgatgctggattttttaattCTTCAGCATGAGATCTTAACTAG
CAAAATGTCTTGGCATGTCTCCTTTTTCtttaatatatttcaaaaaagta
CAAAGAGTACTAAGGTACAGATTGGAGAGAAATATTCTGCTGTTGAGTAG
CATAAAGCAACTGCTGCTTTGTGTATCGTACCAGTGCTTTCAGATCTTAA
TAAAACTGTTTATCATATACCTTTAACAGGTATATtatacaacaaaatat
aatGTCATCGCACAAGGCAGTAGAGCATACAGCTGCAAATCTGGATGGTT
TATGGACAGTAATAGCAAAAACGAGGAACTTTGATAATGAAGTTTCATCT
TCCAAGAAAGCTATTGTTGTCATTCCTGGTAATCCTGGTTTGGTTGAATT
TTATGAATTGTTTATGGAATGTTTGTACAAGTTAAAGGGGATTCCAATTA
TCGGTTTTTCACATGCAGGACATTCACCGATCCACCCATACACAGATGAA
CCAATGAGAACTCCTCCATTAACCTTGCAAGAACAAATTCAACACAAGAA
GGACTGTGTCCGACAATTCATTCCTGACGACTGCAATATCATCTTTATCG
GACATTCCATAGGAGCTTATATTATTCTACAGCTTATGGACCATATACCA
GAAAGATCGCTTCATGGTATATTACTCTTCCCCACCATCACGAACATGAT
TGGAACAGTTGACGGAAAATTCTGGAATCTGATAACTTCATATCTCAAAC
TCCCTTTACTATGGACTGCATATTTTTCCTCTTATCTACCTTACGCCCTA
CAAGATGTTTTGATACGATGGCGTGCAAAATGGCGGCAAATTGACGCCCC
GATCGTACCAGTGTGCAGACGATGTGTCTCTTGGGACGTTTTAAGTCAAG
GTTTCCGTATGGTCGAATGTGAGTTAGTAGAAGTCAAAACTTTGAATCCG
GAATTATCCCGGATTATACGACGATATTCCAATAAATTGACGGTTTATTA
TGGTGACGGTGACGCATGGACgcctttttctttttatgaggAATTTATAC
AGAAATTTCCTGAAGTGAAAACTTTCTACGGACGTGATGGTTTTAAACAT
GATTTTGTACTTGACTCTTCGGAAGGTGTAGCGAGGCTATGTAATAAGTT
TATTGAGAAGTTATGATAGTTCATGATTATAAGcatcttttacattttta
tcataaCCTAGCTTTAACTTCAGATATCCTCTATGTATAAGACACAGATT
TGCAGCCGTTATaagtttttttacaatatttggAGGATGTACCGTGTTTC
AATCCCGACTTATGGAAGATTTCGAAAATCGTTAAAACTCATTTTCGGGT
CAATAACTTTTTGCCCAAGGTGTAAAAATCGACTCTACCCCACATTCGAA
AGcagataaaattatctttccaacggtgtctAGAAACCTTCTATTCGaat
tttttctaggttgacTCTATTTTCGACAAAATTCTACAGGACTAAAACTG
TAAAAGTTGACATTccgttttataaaaatatacctTTTCGACTACTAAAA
TCTATTgctagtttgagtaaagaaaattaATACTCAAAGTTTTATGCCAT
TCTTTAGTAGTATACTCAAACTAGTATGAAGCTTGTCATTAATATTGATC
ACTGTTATTAGTTTTCGCTTACACAAGGAATGTATAGAATTTATTCTTGa
attttaaatatctttttggGCGATATCGTGTAACCCTGTATTAATGATTC
AATACTCTGACCACTCTAGAACCATCTATGTAACATGGTCAAAGGAATTT
TTGTTTCTAGTTAATTTTTAAATTGTTATGAGAATTATTAGATGATGATG
TTCATGTAAATAGATGAATTTGtctttaaaacttttatttCGCATTTTAT
GAGAGattttatttctgattttttaaattattgcTCGGGTCTAACGGAAA
TCTTTAGGTCTCTAAAATGGCAATTTAATGCTTCGAAAATACTACCTTTT
GACGTGagttttctcgaattttcaacCATTGGAGACCGAAATAATCGCAT
GAAAACTCTTAAATTTGGTATCCCTTAGActctttaagtgccaatgtcga
gtATATTGGACATATGGGCT
Run BLAST on NCBI

transcript from alignment at sc0000001:324098..332443+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000013 ID=TCONS_00000013|Name=TCONS_00000013|organism=Clytia hemisphaerica|type=transcript|length=8346bp|location=Sequence derived from alignment at sc0000001:324098..332443+ (Clytia hemisphaerica)
attgttttgatgctggattttttaattCTTCAGCATGAGATCTTAACTAG CAAAATGTCTTGGCATGTCTCCTTTTTCtttaatatatttcaaaaaagta CAAAGAGTACTAAGGTACAGATTGGAGAGAAATATTCTGCTGTTGAGTAG CATAAAGCAACTGCTGCTTTGTGTATCGTACCAGTGCTTTCAGATCTTAA TAAAACTGTTTATCATATACCTTTAACAGGTATATtatacaacaaaatat aatGTCATCGCACAAGGCAGTAGAGCATACAGCTGCAAATCTGGATGGTT TATGGACAGTAATAGCAAAAACGAGGAACTTTGATAATGAAGTTTCATCT TCCAAGAAAGCTATTGTTGTCATTCCTGGTAATCCTGGTTTGGTTGAATT TTATGAATTGTTTATGGAATGTTTGTACAAGTTAAAGGGGATTCCAATTA TCGGTTTTTCACATGCAGGTATAAATggatttctcttttttataagaacc attcAATTTTTATTAAGGGTCAGTTACTTTTTTGGATGTACTTTGAGTCa caaattgtaaattttcaaaaactctcTGCGATTCCAGTCTTTTTCGTAAT GTATGGTATTTTTAAGCCTGCCTTACTGTTCTTATATAAAGTGTGAATac tctttttcttaaaattaacATGAAGACAAAAAGTAAATCCAATTCTGCTC ATCATGTTGTTTCGATGTGATCCTGATGTGAACATCGAAAATCTAAAAGC TAACTAAGCAAGTTTCACCCATTCTCtatcaaatacacgtttttttataa taacatccATAATATTTTTAGCCTTTGGGTGTTCTTCtaagctttttgag tttttaagctgaaaaaaaacgttattaaaatgttctgaattttaaaccat tttgtgagtgtttttttcACACTTCCTAACTTGTTCATAATATCTTGGCC ATCAAACCCTTTTgttcatatagtttgttcttatgtgaaacaatgaaaca gaaaaaacaaaaacagtttttttgtaCTAATAGTTTCACAACCTTCTTCT GGGTTGATCATCAGCAAACTNgaaactaaaatttaccgcttaatttcgaa aaatatatcactcgaaaacaaaggaattgctagattcaatccgtcataaa aaatacggcgcattttttaaggcttcaatttttcttgcctgagaaaggtt agagattgacctctagccttcggcttgaaactcaatgattcgaacccact aaatgcaaagttccgatgttttgaaacccaatgccttaaccactgcgcca cggattcatgccgaaagagcgtttctgacggctatttatattgtacaaac tacagaccagactgtattNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNaatctgatacgtaaccacacccaaa ccacacccatacccaaccctaccaggtcgcctgcaggtcctgacactatt cccgcatgccggatccaAAAAATAggtacatgtctttcgtctttacgaag aagccttcaccgtcCAACATATGTCTTCTTGTCACTTGTCTTCTAGATCT TCAACCTTCTCTACCTTCTACCAGCACCAGGGTATGTATCTTCTTTCAGC AGACCTGGACTGGGTGGCAGAGCAGATATTAAATAGATGTAGTAAATTAC TATTACTATGNgtattaaaagaaattttttgtcaaagtgATTTAacagta aaaagtaaaaatagaccttttttcaaagaggatgtcatgttgaataatta tgtagtccagccataaaaacaatgatatatccatgcataattactgtatc atgcatattgtagtAATTATTCATGGttcatcattgtttttctgctggac tacataattattcaacagggtggcctctttgaaaaaaggtcttaTAGCTA TGCTATGGTATGGTGTGAGATtagatgtttttcatttttgttatgtTGGG CAGTTGGGAACTTTACACTTTATTTGGTATATATAAGCTGATTCTAATTA CCTACCAcactcttttttgttttttagtagAGAAAAATAACAGAAAATAG GAAGGTGGGAATCACAGATTGAAAAAGAAGATGCGATCTCTATTCTATCA AAGAAATAAAGTTTCAATCAGCAAATAGTTGTTTGGGAAAACGCAACAGC CTAGGCATTGAGTCAGTTTCGTATACCTATACTAGCTAAATAACTCCATC CATTCCGGGCTGGAAATGGTGCACAGTATGTGAATATATTCAGAGTGAGg cagtaccgtcaactgctccactTGGGGgcactatctgacaaaacatggga cggcaattcggccccCATTTCACCGAaactccaaagtcatttgatttgag ttaaggaaaggcatattaaaaaatacacaatttctgttttgattttACAG TTAGTTTATttcagaccagatatgcaacagtcccatgtttcaaccaattg TGCCAAATTAGAGCCGCTGACGGTAATTACGTTTGGCGTATTGGCACAAG GAGCCGATATAAAGTAAGATATTGGCGTaagtcaaagcttttcaagacGA GAGAAGCACCCCCATTCTAACGCCCAATTTCATGACGCCGCAGGTTTAAA AATGCATCCACCTAGCTCTCCCTTGACCACCATTGACCATATATATAAGg ccaaaaaaaaagtagttttgtttccggaaatgcgggtgacgaaaaaaaat ctcacccgggcggccggaaaatattttttttttcaattttcctagaaaaa NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNagtttttttctatttgcggccgggtg agatatatttttttccaaaaaaaagttcacccggccgatttccggaaaca agactacttttttttttggcctaaCANCCTGTTTCTATGAGACGTTTTTT GTGAGCCttcaaaaatgttacaaaacCAGTACTAATTTTTGAAACGGCTC GGCTTTCGGGGGGTTTGCCCCCTAAACCTCCATCAGGGCTAAGCCCTGGA CCCGTTTGGGGCACTGGATTACACTGCCCCAAAACCCAGTAATATCGCTG TTCTGTTCTTTTGGCTTAAACCTCAGTTTTAACGNGCAACTTTTAGGGGT GAGAAAATGAAATAATCCCAGGGCTGAACAGTCATTGTGTGAcatttttt aaaacacaaaaaattgacaaaaatctttaaggttgaataaaatcaactca aattaATTACaagccttgaaattttgactggtAATAGGAAATTTAATtac cttttcaaaaatatatttatgaaGCCATTCTTTATGATAGCAAAACGACT TAGGTACTAAATGAATTACCCTTATATGTTCAAAGTAAAGTATGTCACTC TTTGTcacaatcaattttttgaaaataatgtacacaaaaattaatgtttc aaTACTGCACGTCCTATAACACTCAGTGGTTAAAAATGAACAACTTTAGG TGTTGATTGTGCCAATAAATGACTTACTTTACgagtaaaaaagtaaaata tgtCATCCTTAAAGTAAGTCACTTTTTGTCACATTTTGCTTCTGGGTATA ATTCGAAATATAGTATTTCAATTTaggtaaaaattaaagcatTTTAAATT GGGAAATATATCTGGCTTATTAACCATATCAAAAATATAGACACTGTGCA CAATGTGCCCTGTTTCTATGAGACGTTTTTTGTGAGCCttcaaaaatgtt acaaaacCAGTACTAATTTTTGAAACGGCTCGGCTTTCGGGGGGTTTGCC ACCTAAACCTCCATCATGGCTAAGCCCTGGACCCGTTTGGGGCACTGGAT TACACTGCCCCAAAACCCAGTAATATCGCTGTTCTGTTCTTTTGGCTTAA ACCTCAGTTTTAACAAATAACAATTCGGTGTGGGCTTTGCATCATTTCCA CACTGGCATACATTGGGCCTGGAAATTAACTGTATTGAATTAACTGATTG TATCAAGTGTTGAGTCTGGGGTATCCCTAGATAGAACTTCTGCTAGTTGA Aacgtcatgttgaataattcaaaactccagcattaataaaacaatgataa gaaaaaattaataatgTATACTTGAACTAATTAAAATTATGAATTCAtct gtcattgttttgatgctggattttttaattCTTCAGCATGAGATCTTAAC TAGCAAAATGTCTTGGCATGTCTCCTTTTTCtttaatatatttcaaaaaa gtaCAAAGAGTACTAAGGTACAGATTGGAGAGAAATATTCTGCTGTTGAG TAGCATAAAGCAACTGCTGCTTTGTGTATCGTACCAGTGCTTTCAGATCT TAATAAAACTGTTTATCATATACCTTTAACAGGTATATtatacaacaaaa tataatGTCATCGCACAAGGCAGTAGAGCATACAGCTGCAAATCTGGATG GTTTATGGACAGTAATAGCAAAAACGAGGAACTTTGATAATGAAGTTTCA TCTTCCAAGAAAGCTATTGTTGTCATTCCTGGTAATCCTGGTTTGGTTGA ATTTTATGAATTGTTTATGGAATGTTTGTACAAGTTAAAGGGGATTCCAA TTATCGGTTTTTCACATGCAGGTATAAATggatttctcttttttataaga accattcAATTTTTATTAAGGGTCAGTTACTTTTTTGGATGTACTTTGAG TCacaaattgtaaattttcaaaaactctcTGCGATTCCAGTCTTTTTCGT AATGTATGGTATTTTTAAGCCTGCCTTACTGTTCTTATATAAAGTGTGAA TactctttttcttaaaattaacATGAAGAGAAAAAGTAAATCCAATTCTG CTCATCATGTTGTTTCGATGTGATCCTGATGTGAACATCGAAAATCTAAA AGCTAACTAAGCAAGTTTCACCCATTCTCtatcaaatacacgttttttta taataacatccATAATATTTTTAGCCTTTGGGTGTTCTTCtaagcttttt gagtttttaagctgaaaaaaaacgttattaaaatgttctgaattttaaac cattttgtgagtgtttttttcACACTTCCTAACTTGTTCATAATATCTTG GCCATCAAACCCTTTTgttcatatagtttgttcttatgtgaaacaatgaa acagaaaaaacaaaaacagtttttttgtaCTAATAGTTTCACAACCTTCT TCTGGGTTGATCATCAGCAAactctttttgtttgtttgctgATGATCAAC CCAGAAAAGGATTGCGAAAATATCAgtacaaaaaactgtttttgtttttt tctgtttgacTTAAAAATTTCTACTATGAATAAGAAGATTCTCCacaagt ttgttcttataaaaaacgtgttttcCACATCTCAGGACATTCACCGATCC ACCCATACACAGATGAACCAATGAGAACTCCTCCATTAACCTTGCAAGAA CAAATTCAACACAAGAAGGACTGTGTCCGACAATTCATTCCTGACGACTG CAATATCATCTTTATCGGACATTCCATAGGAGCTTATATTATTCTACAGC TTATGGACCATATACCAGAAAGGTGAATACACTCTTCTCAAAATAATAAG GGGCAAGGCTTCGGATCCGTAGAATCTTTCGTAGGANattgtacttaaca acatatccaaaaatgaaaaaaatctaagtttcaaactattggaactgccc caaactgccccattcttaaaaaaactggctcttaaaaatttctactatgt atggaGCACTCTANtctttttgtttgtttgctgATGATCAACCCAGAAAA GGATTGCGAAAATATCAgtacaaaaaactgtttttgtttttttctgtttg acTTAAAAATTTCTACTATGAATAAGAAGATTCTCCacaagtttgttctt ataaaaaacgtgttttcCACATCTCAGGACATTCACCGATCCACCCATAC ACAGATGAACCAATGAGAACTCCTCCATTAACCTTGCAAGAACAAATTCA ACACAAGAAGGACTGTGTCCGACAATTCATTCCTGACGACTGCAATATCA TCTTTATCGGACATTCCATAGGAGCTTATATTATTCTACAGCTTATGGAC CATATACCAGAAAGGTGAATACACTCTTCTCAAAATAATAAGGGGCAAGG CTTCGGATCCGTAGAATCTTTCGTAGGACACATTCGCGTGTGATTGGTTT GAAAGTAGATAGAATTTCGAGACTTTTTTGAGAAGGGGCATAAAAGGCTT GGCAACCAAAAGTTTTTAGGGCGATTTTTTATCCCCCGCCAAATAGTAAA ATTTGAcgattttttaatgtttttactGAGTTTTGATTCTCCTACttgga tttttaaaagttaaaaccctttgttgataattttaaaaaatactttgact TTGAAATAGTTTGTTTGACCTGAAAATATGAAAGATAATGAAGGAAAAGT GTTTGCTCAAAACTTGTTAACGATTATTCCTAAGATGATAGTGGAGAGAC TATAATACATTTTAACACCTATCTTTTATAGATCGCTTCATGGTATATTA CTCTTCCCCACCATCACGAACATGATTGGAACAGTTGACGGAAAATTCTG GAATCTGATAACTTCATATCTCAAACTCCCTTTACTATGGACTGCATATT TTTCCTCTTATCTACCTTACGCCCTACAAGATGTTTTGATACGATGGCGT GCAAAATGGCGGCAAATTGACGCCCCGATCGTACCAGTGTGCAGACGATG TGTCTCTTGGGACGTTTTAAGTCAAGGTTTCCGTATGGTCGAATGTGAGT TAGTAGAAGTCAAAACTTTGAATCCGGAATTATCCCGGATTATACGACGA TATTCCAATAAATTGACGGTTTATTATGGTGACGGTGACGCATGGACgcc tttttctttttatgaggAATTTATACAGAAATTTCCTGAAGTGAAAACTT TCTACGGACGTGATGGTTTTAAACATGATTTTGTACTTGACTCTTCGGAA GGTGTAGCGAGGCTATGTAATAAGTTTATTGAGAAGTTATGATAGTTCAT GATTATAAGcatcttttacatttttatcataaCCTAGCTTTAACTTCAGA TATCCTCTATGTATAAGACACAGATTTGCAGCCGTTATaagtttttttac aatatttggAGGATGTACCGTGTTTCAATCCCGACTTATGGAAGATTTCG AAAATCGTTAAAACTCATTTTCGGGTCAATAACTTTTTGCCCAAGGTGTA AAAATCGACTCTACCCCACATTCGAAAGcagataaaattatctttccaac ggtgtctAGAAACCTTCTATTCGaattttttctaggttgacTCTATTTTC GACAAAATTCTACAGGACTAAAACTGTAAAAGTTGACATTccgttttata aaaatatacctTTTCGACTACTAAAATCTATTgctagtttgagtaaagaa aattaATACTCAAAGTTTTATGCCATTCTTTAGTAGTATACTCAAACTAG TATGAAGCTTGTCATTAATATTGATCACTGTTATTAGTTTTCGCTTACAC AAGGAATGTATAGAATTTATTCTTGaattttaaatatctttttggGCGAT ATCGTGTAACCCTGTATTAATGATTCAATACTCTGACCACTCTAGAACCA TCTATGTAACATGGTCAAAGGAATTTTTGTTTCTAGTTAATTTTTAAATT GTTATGAGAATTATTAGATGATGATGTTCATGTAAATAGATGAATTTGtc tttaaaacttttatttCGCATTTTATGAGAGattttatttctgatttttt aaattattgcTCGGGTCTAACGGAAATCTTTAGGTCTCTAAAATGGCAAT TTAATGCTTCGAAAATACTACCTTTTGACGTGagttttctcgaattttca acCATTGGAGACCGAAATAATCGCATGAAAACTCTTAAATTTGGTATCCC TTAGActctttaagtgccaatgtcgagtATATTGGACATATGGGCT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000008XLOC_000008Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000013-exon-sc0000001-1491911889:324098..324565TCONS_00000013-exon-sc0000001-1491911889:324098..324565Clytia hemisphaericaexon
TCONS_00000013-exon-sc0000001-1510915933:324098..324565TCONS_00000013-exon-sc0000001-1510915933:324098..324565Clytia hemisphaericaexon
TCONS_00000013-exon-sc0000001-1491911889:329833..330019TCONS_00000013-exon-sc0000001-1491911889:329833..330019Clytia hemisphaericaexon
TCONS_00000013-exon-sc0000001-1510915933:329833..330019TCONS_00000013-exon-sc0000001-1510915933:329833..330019Clytia hemisphaericaexon
TCONS_00000013-exon-sc0000001-1491911889:330979..332443TCONS_00000013-exon-sc0000001-1491911889:330979..332443Clytia hemisphaericaexon
TCONS_00000013-exon-sc0000001-1510915933:330979..332443TCONS_00000013-exon-sc0000001-1510915933:330979..332443Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:324098..332443 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0.520039 0.136981 0.495784 1.14176 0.216641 0.134172 0.390646 0.0856086 0.170979 0 0.438031 0.0783302 0.289489 0 0.201677 0.142988 0.248564 0.671038 0.294774 0 0.611084 0.738986 0 0 0 0.428679
Blast
BLAST of TCONS_00000013 vs. Swiss-Prot (Human)
Match: LDAH (Lipid droplet-associated hydrolase OS=Homo sapiens GN=LDAH PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.574e-26
Identity = 82/283 (28.98%), Postives = 130/283 (45.94%), Query Frame = 3
Query:  333 DNEVSSSKKAIVVIPGNPGLVEFYELFMECLYKL--KGIPIIGFSHAGHSPIHPYTDEPMRTPPLT----------LQEQIQHKKDCVRQFIPDDCNIIFIGHSIGAYIILQLMDHIPERS-LHGILLFPTITNMIGTVDGKFWNLITSYLKLPLLWTAY-FSSYLPYALQDVLIRWRAKWRQIDAPIVPVCRRCVSWDVLSQGFRMVECELVEVKTLNPELSRIIRRYSNKLTVYYGDGDAWTPFSFYEEFIQKFPEVKTFYGRDGFKHDFVLDSSEGVARL 1139
            D  V   K  I +IPGNPG   FY  F + LY L  +  P+   SHAGH+ + P   + + T   +          L  QI+HK   +R  +P D  ++ IGHSIG+Y  LQ++  +PE   +   LLFPTI  M  + +G+    +  + +  L  T Y      P  ++ +LIR   +   ++    P+    +    L+    +   E++EV   + E    I+ +  KLT YYG  D W P  +YE+  + FPE           H F+   ++ +A +
Sbjct:   37 DQSVKRPKLLIFIIPGNPGFSAFYVPFAKALYSLTNRRFPVWTISHAGHA-LAPKDKKILTTSEDSNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSIGSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKPCPETIKSLLIRRGLQVMNLENEFSPL--NILEPFCLANAAYLGGQEMMEVVKRDDE---TIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAFITHFNQEMADM 313          
The following BLAST results are available for this feature:
BLAST of TCONS_00000013 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
LDAH1.574e-2628.98Lipid droplet-associated hydrolase OS=Homo sapiens... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php