TCONS_00000006 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000006
Unique NameTCONS_00000006
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1439

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000006 ID=TCONS_00000006|Name=TCONS_00000006|organism=Clytia hemisphaerica|type=transcript|length=1439bp
GTGGCTGAGTGTTGGTTCGAGTTTCAAAACCATACCAATTGAACTGCGAG
ACGGTCAGTCTTTTTTACTGCAGAGAACGAGGACTGTTCTGACcagaaaa
caaaaacatgcaTTGGTTAGCCTGTGTTGTTTTAACCATTTTGGTTATCG
ACCGAATCCAGGCTACTGAATTACCTGAAGAAAACCTATTGGTTCCGGAC
TTGATTGAATATTGGGGATATCCTGCCGAATCGCATGAAGTCCAAACCAA
AGATGGCTACCTGTTGACTTTACACCGTATTCCGTATGGTAAAGGACATA
CGGACACAACCCGGAAACGACCGGTATTCTTTTTACAACACGGACTCCTT
TGTAGTAGCTCGAATTGGGTTACCAACCAACCACACTTGTCTCTTGGATT
CATGCTCGCTGACTCTGGTTATGACGTATGGATGGGTAATAATCGAGGCA
ATACTTACTCCAAGAAACACGTGACTTTACCGGTTGACAGCAAGGCATTC
TGGGATTTCTCGTTCCAGGAATTCGCAAAATATGACATGCCCGCCATGTT
GGGGTACGCCTTAAATGTGACCGGAAATAAACAATTGTACTACGTCGGAC
ACTCTGAAGGCACCATGATGATTTTCGCCGGTTTGAGTGAAAGTGAGGAG
CTACAGAAAATGATTAAGACAGCCTTTGCACTAGCCCCTGTCGCGCATCT
GGATAAAGCCTCATCGCCTATTACTTATCTATCATCTTTCGAAACTGAAA
TTGGAGGATTTTTCGGTTTTCTCGGCGTCCGTGAGTTTATGGCTTCTAGC
TACTGGATACGTAAACTAGCTGACTTGACTTGCTCTTTCGATGAGGGCGC
CCTTTGTGGAAACTTCCTTTTCTTGATTGCCGGTTCAGACAGTCGAAACA
TGAACGCCACTCGTACGCCCATCTATTTCACACACACGCCCGCTGGAACA
TCAGTTAAAAATATGCTTCATTTCTGCCAGCTCATCGAAGCAGGGCGTTT
CCAAAAGTACGACTATGGGTGGGCGAAGAATCTTTACCACTACCACTCAT
TGAAGCCTCCTCAATACCcaatcaaaaacatcaaaacggAAATCGAATTT
TTCTCTGGGGGACGAGATACCCTCGCTGACCCTCAAGACGTTTCATGGTT
GACTACGCAAGTTAAAAGTCTCACCAAACATCACGTTATCCCGGAATACA
ATCATTTAGATTTCATTTGGGGCGAATCAGCACGCCGTAAGGTCtataag
aaaatcattaaatctGCTTATCGTAAAGATGGCATTTTACGACGATAAAT
CATTTCTTTTTGTGACTGGCAGAAAACTGTTTTTGATTGGATGAAACTTG
TTGAAAAAGTAGATATAATCAACGGACAAGACTTTGATATCATGTTGCGG
ACAATATTTAAATGGTACAAAAAAAACGAATTGCAAAAC
Run BLAST on NCBI

protein sequence of TCONS_00000006-protein

>TCONS_00000006-protein ID=TCONS_00000006-protein|Name=TCONS_00000006-protein|organism=Clytia hemisphaerica|type=polypeptide|length=396bp
MHWLACVVLTILVIDRIQATELPEENLLVPDLIEYWGYPAESHEVQTKDG
YLLTLHRIPYGKGHTDTTRKRPVFFLQHGLLCSSSNWVTNQPHLSLGFML
ADSGYDVWMGNNRGNTYSKKHVTLPVDSKAFWDFSFQEFAKYDMPAMLGY
ALNVTGNKQLYYVGHSEGTMMIFAGLSESEELQKMIKTAFALAPVAHLDK
ASSPITYLSSFETEIGGFFGFLGVREFMASSYWIRKLADLTCSFDEGALC
GNFLFLIAGSDSRNMNATRTPIYFTHTPAGTSVKNMLHFCQLIEAGRFQK
YDYGWAKNLYHYHSLKPPQYPIKNIKTEIEFFSGGRDTLADPQDVSWLTT
QVKSLTKHHVIPEYNHLDFIWGESARRKVYKKIIKSAYRKDGILRR
Run BLAST on NCBI

transcript from alignment at sc0000001:117825..119319+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000006 ID=TCONS_00000006|Name=TCONS_00000006|organism=Clytia hemisphaerica|type=transcript|length=1495bp|location=Sequence derived from alignment at sc0000001:117825..119319+ (Clytia hemisphaerica)
GTGGCTGAGTGTTGGTTCGAGTTTCAAAACCATACCAATTGAACTGCGAG ACGGTCAGTCTTTTTTACTGCAGAGAACGAGGACTGTTCTGACcagaaaa caaaaacatgcaTTGGTTAGCCTGTGTTGTTTTAACCATTTTGGTTATCG ACCGAATCCAGGCTACTGAATTACCTGAAGAAAACCTATTGGTTCCGGAC TTGATTGAATATTGGGGATATCCTGCCGAATCGCATGAAGTCCAAACCAA AGATGGCTACCTGTTGACTTTACACCGTATTCCGTATGGTAAAGGACATA CGGACACAACCCGGAAACGACCGGTATTCTTTTTACAACACGGACTCCTT TGTAGTAGCTCGAATTGGGTTACCAACCAACCACACTTGTCTCTTGGATT CATGCTCGCTGACTCTGGTTATGACGTATGGATGGGTAATAATCGAGGCA ATACTTACTCCAAGAAACACGTGACTTTACCGGTTGACAGCAAGGCATTC TGGGATTTCTCGTTCCAGGAATTCGCAAAATATGACATGCCCGCCATGTT GGGGTACGCCTTAAATGTGACCGGAAATAAACAATTGTACTACGTCGGAC ACTCTGAAGGCACCATGATGATTTTCGCCGGTTTGAGTGAAAGTGAGGAG CTACAGAAAATGATTAAGACAGCCTTTGCACTAGCCCCTGTCGCGCATCT GGATAAAGCCTCATCGCCTATTACTTATCTATCATCTTTCGAAACTGAAA TTGGAGGATTTTTCGGTTTTCTCGGCGTCCGTGAGTTTATGGCTTCTAGC TACTGGATACGTAAACTAGCTGACTTGACTTGCTCTTTCGATGAGGGCGC CCTTTGTGGAAACTTCCTTTTCTTGATTGCCGGTTCAGACAGTCGAAACA TGAACGCCACTCGCACGCCCATCTNTTCTTGATTGCCGGTTCAGACAGTC GAAACATGAACGCCACTCGTACGCCCATCTATTTCACACACACGCCCGCT GGAACATCAGTTAAAAATATGCTTCATTTCTGCCAGCTCATCGAAGCAGG GCGTTTCCAAAAGTACGACTATGGGTGGGCGAAGAATCTTTACCACTACC ACTCATTGAAGCCTCCTCAATACCcaatcaaaaacatcaaaacggAAATC GAATTTTTCTCTGGGGGACGAGATACCCTCGCTGACCCTCAAGACGTTTC ATGGTTGACTACGCAAGTTAAAAGTCTCACCAAACATCACGTTATCCCGG AATACAATCATTTAGATTTCATTTGGGGCGAATCAGCACGCCGTAAGGTC tataagaaaatcattaaatctGCTTATCGTAAAGATGGCATTTTACGACG ATAAATCATTTCTTTTTGTGACTGGCAGAAAACTGTTTTTGATTGGATGA AACTTGTTGAAAAAGTAGATATAATCAACGGACAAGACTTTGATATCATG TTGCGGACAATATTTAAATGGTACAAAAAAAACGAATTGCAAAAC

Coding sequence (CDS) from alignment at sc0000001:117825..119319+

>TCONS_00000006 ID=TCONS_00000006|Name=TCONS_00000006|organism=Clytia hemisphaerica|type=CDS|length=2382bp|location=Sequence derived from alignment at sc0000001:117825..119319+ (Clytia hemisphaerica)
atgcaTTGGTTAGCCTGTGTTGTTTTAACCATTTTGGTTATCGACCGAAT
CCAGGCTACTGAATTACCTGAAGAAAACCTATTGGTTCCGGACTTGATTG
AATATTGGGGATATCCTGCCGAATCGCATGAAGTCCAAACCAAAGATGGC
TACCTGTTGACTTTACACCGTATTCCGTATGGTAAAGGACATACGGACAC
AACCCGGAAACGACCGGTATTCTTTTTACAACACGGACTCCTTTGTAGTA
GCTCGAATTGGGTTACCAACCAACCACACTTGTCTCTTGGATTCATGCTC
GCTGACTCTGGTTATGACGTATGGATGGGTAATAATCGAGGCAATACTTA
CTCCAAGAAACACGTGACTTTACCGGTTGACAGCAAGGCATTCTGGGATT
TCTCGTTCCAGGAATTCGCAAAATATGACATGCCCGCCATGTTGGGGTAC
GCCTTAAATGTGACCGGAAATAAACAATTGTACTACGTCGGACACTCTGA
AGGCACCATGATGATTTTCGCCGGTTTGAGTGAAAGTGAGGAGCTACAGA
AAATGATTAAGACAGCCTTTGCACTAGCCCCTGTCGCGCATCTGGATAAA
GCCTCATCGCCTATTACTTATCTATCATCTTTCGAAACTGAAATTGGAGG
ATTTTTCGGTTTTCTCGGCGTCCGTGAGTTTATGGCTTCTAGCTACTGGA
TACGTAAACTAGCTGACTTGACTTGCTCTTTCGATGAGGGCGCCCTTTGT
GGAAACTTCCTTTTCTTGATTGCCGGTTCAGACAGTCGAAACATGAACGC
CACTCGTACGCCCATCTATTTCACACACACGCCCGCTGGAACATCAGTTA
AAAATATGCTTCATTTCTGCCAGCTCATCGAAGCAGGGCGTTTCCAAAAG
TACGACTATGGGTGGGCGAAGAATCTTTACCACTACCACTCATTGAAGCC
TCCTCAATACCcaatcaaaaacatcaaaacggAAATCGAATTTTTCTCTG
GGGGACGAGATACCCTCGCTGACCCTCAAGACGTTTCATGGTTGACTACG
CAAGTTAAAAGTCTCACCAAACATCACGTTATCCCGGAATACAATCATTT
AGATTTCATTTGGGGCGAATCAGCACGCCGTAAGGTCtataagaaaatca
ttaaatctGCTTATCGTAAAGATGGCATTTTACGACGATAAatgcaTTGG
TTAGCCTGTGTTGTTTTAACCATTTTGGTTATCGACCGAATCCAGGCTAC
TGAATTACCTGAAGAAAACCTATTGGTTCCGGACTTGATTGAATATTGGG
GATATCCTGCCGAATCGCATGAAGTCCAAACCAAAGATGGCTACCTGTTG
ACTTTACACCGTATTCCGTATGGTAAAGGACATACGGACACAACCCGGAA
ACGACCGGTATTCTTTTTACAACACGGACTCCTTTGTAGTAGCTCGAATT
GGGTTACCAACCAACCACACTTGTCTCTTGGATTCATGCTCGCTGACTCT
GGTTATGACGTATGGATGGGTAATAATCGAGGCAATACTTACTCCAAGAA
ACACGTGACTTTACCGGTTGACAGCAAGGCATTCTGGGATTTCTCGTTCC
AGGAATTCGCAAAATATGACATGCCCGCCATGTTGGGGTACGCCTTAAAT
GTGACCGGAAATAAACAATTGTACTACGTCGGACACTCTGAAGGCACCAT
GATGATTTTCGCCGGTTTGAGTGAAAGTGAGGAGCTACAGAAAATGATTA
AGACAGCCTTTGCACTAGCCCCTGTCGCGCATCTGGATAAAGCCTCATCG
CCTATTACTTATCTATCATCTTTCGAAACTGAAATTGGAGGATTTTTCGG
TTTTCTCGGCGTCCGTGAGTTTATGGCTTCTAGCTACTGGATACGTAAAC
TAGCTGACTTGACTTGCTCTTTCGATGAGGGCGCCCTTTGTGGAAACTTC
CTTTTCTTGATTGCCGGTTCAGACAGTCGAAACATGAACGCCACTCGTAC
GCCCATCTATTTCACACACACGCCCGCTGGAACATCAGTTAAAAATATGC
TTCATTTCTGCCAGCTCATCGAAGCAGGGCGTTTCCAAAAGTACGACTAT
GGGTGGGCGAAGAATCTTTACCACTACCACTCATTGAAGCCTCCTCAATA
CCcaatcaaaaacatcaaaacggAAATCGAATTTTTCTCTGGGGGACGAG
ATACCCTCGCTGACCCTCAAGACGTTTCATGGTTGACTACGCAAGTTAAA
AGTCTCACCAAACATCACGTTATCCCGGAATACAATCATTTAGATTTCAT
TTGGGGCGAATCAGCACGCCGTAAGGTCtataagaaaatcattaaatctG
CTTATCGTAAAGATGGCATTTTACGACGATAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000004XLOC_000004Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000006-exon-sc0000001-1491911889:117825..118723TCONS_00000006-exon-sc0000001-1491911889:117825..118723Clytia hemisphaericaexon
TCONS_00000006-exon-sc0000001-1510915933:117825..118723TCONS_00000006-exon-sc0000001-1510915933:117825..118723Clytia hemisphaericaexon
TCONS_00000006-exon-sc0000001-1491911889:118780..119319TCONS_00000006-exon-sc0000001-1491911889:118780..119319Clytia hemisphaericaexon
TCONS_00000006-exon-sc0000001-1510915933:118780..119319TCONS_00000006-exon-sc0000001-1510915933:118780..119319Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000006-proteinTCONS_00000006-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:117825..119319 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.259593 0.421907 1.04507 1.24609 9.25757 9.98959 29.0361 29.6481 23.9657 16.4986 9.4681 22.4562 54.0194 132.141 70.2633 24.4138 57.6399 57.3036 179.615 132.511 157.119 159.518 65.6802 94.8911 178.996 116.054 24.6399 43.2645 12.5816 19.1791
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR006693AB_hydrolase_lipase
IPR025483Lipase_euk
Vocabulary: Biological Process
TermDefinition
GO:0006629lipid metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0016788hydrolase activity, acting on ester bonds
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006629 lipid metabolic process
molecular_function GO:0016788 hydrolase activity, acting on ester bonds
Blast
BLAST of TCONS_00000006 vs. Swiss-Prot (Human)
Match: LICH (Lysosomal acid lipase/cholesteryl ester hydrolase OS=Homo sapiens GN=LIPA PE=1 SV=2)

HSP 1 Score: 350.903 bits (899), Expect = 4.302e-116
Identity = 179/388 (46.13%), Postives = 250/388 (64.43%), Query Frame = 3
Query:  117 LACVVLTILVID----RIQATELPEENLLVPDLIEYWGYPAESHEVQTKDGYLLTLHRIPYGKGHTDTTRKRPVFFLQHGLLCSSSNWVTNQPHLSLGFMLADSGYDVWMGNNRGNTYSKKHVTLPVDSKAFWDFSFQEFAKYDMPAMLGYALNVTGNKQLYYVGHSEGTMMIFAGLSESEELQKMIKTAFALAPVAHLDKASSPITYLSSFETEIGGFFGFLGVREFMASSYWIRKLADLTCS-FDEGALCGNFLFLIAGSDSRNMNATRTPIYFTHTPAGTSVKNMLHFCQLIEAGRFQKYDYG-WAKNLYHYHSLKPPQYPIKNIKTEIEFFSGGRDTLADPQDVSWLTTQVKSLTKHHVIPEYNHLDFIWGESARRKVYKKIIK 1262
            + C+VL  L  +    ++ A + PE N+ V ++I YWG+P+E + V+T+DGY+L L+RIP+G+ +      +PV FLQHGLL  SSNWVTN  + SLGF+LAD+G+DVWMGN+RGNT+S+KH TL V    FW FS+ E AKYD+PA + + LN TG +Q+YYVGHS+GT + F   S+  EL K IK  FAL PVA +   +SP+  L      +       G +EF+  S +++ L    C+      LCGN  FL+ G + RN+N +R  +Y TH+PAGTSV+NMLH+ Q ++  +FQ +D+G  AKN +HY+   PP Y +K++      +SGG D LAD  DV+ L TQ+ +L  H  IPE+ HLDFIWG  A  ++Y KII 
Sbjct:    9 VVCLVLWTLHSEGSGGKLTAVD-PETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHL--IKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIIN 393          
The following BLAST results are available for this feature:
BLAST of TCONS_00000006 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
LICH4.302e-11646.13Lysosomal acid lipase/cholesteryl ester hydrolase ... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php