Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000006-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00000006-protein
Unique NameTCONS_00000006-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length396

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000006-protein ID=TCONS_00000006-protein|Name=TCONS_00000006-protein|organism=Clytia hemisphaerica|type=polypeptide|length=396bp
MHWLACVVLTILVIDRIQATELPEENLLVPDLIEYWGYPAESHEVQTKDG
YLLTLHRIPYGKGHTDTTRKRPVFFLQHGLLCSSSNWVTNQPHLSLGFML
ADSGYDVWMGNNRGNTYSKKHVTLPVDSKAFWDFSFQEFAKYDMPAMLGY
ALNVTGNKQLYYVGHSEGTMMIFAGLSESEELQKMIKTAFALAPVAHLDK
ASSPITYLSSFETEIGGFFGFLGVREFMASSYWIRKLADLTCSFDEGALC
GNFLFLIAGSDSRNMNATRTPIYFTHTPAGTSVKNMLHFCQLIEAGRFQK
YDYGWAKNLYHYHSLKPPQYPIKNIKTEIEFFSGGRDTLADPQDVSWLTT
QVKSLTKHHVIPEYNHLDFIWGESARRKVYKKIIKSAYRKDGILRR
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000004XLOC_000004Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000006TCONS_00000006Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR006693AB_hydrolase_lipase
IPR025483Lipase_euk
Vocabulary: Biological Process
TermDefinition
GO:0006629lipid metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0016788hydrolase activity, acting on ester bonds
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006629 lipid metabolic process
molecular_function GO:0016788 hydrolase activity, acting on ester bonds
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029058Alpha/Beta hydrolase foldGENE3D3.40.50.1820coord: 15..385
e-value: 2.3E-68
score: 230.8
IPR029058Alpha/Beta hydrolase foldSUPERFAMILY53474alpha/beta-Hydrolasescoord: 24..384
IPR006693Partial AB-hydrolase lipase domainPFAMPF04083Abhydro_lipasecoord: 30..90
e-value: 1.5E-26
score: 91.7
IPR025483Lipase, eukaryoticPIRSFPIRSF000862Steryl_ester_lipcoord: 1..391
e-value: 5.3E-143
score: 474.7

Blast
BLAST of TCONS_00000006-protein vs. Swiss-Prot (Human)
Match: LICH (Lysosomal acid lipase/cholesteryl ester hydrolase OS=Homo sapiens GN=LIPA PE=1 SV=2)

HSP 1 Score: 350.903 bits (899), Expect = 5.675e-119
Identity = 179/388 (46.13%), Postives = 250/388 (64.43%), Query Frame = 0
Query:    4 LACVVLTILVID----RIQATELPEENLLVPDLIEYWGYPAESHEVQTKDGYLLTLHRIPYGKGHTDTTRKRPVFFLQHGLLCSSSNWVTNQPHLSLGFMLADSGYDVWMGNNRGNTYSKKHVTLPVDSKAFWDFSFQEFAKYDMPAMLGYALNVTGNKQLYYVGHSEGTMMIFAGLSESEELQKMIKTAFALAPVAHLDKASSPITYLSSFETEIGGFFGFLGVREFMASSYWIRKLADLTCS-FDEGALCGNFLFLIAGSDSRNMNATRTPIYFTHTPAGTSVKNMLHFCQLIEAGRFQKYDYG-WAKNLYHYHSLKPPQYPIKNIKTEIEFFSGGRDTLADPQDVSWLTTQVKSLTKHHVIPEYNHLDFIWGESARRKVYKKIIK 385
            + C+VL  L  +    ++ A + PE N+ V ++I YWG+P+E + V+T+DGY+L L+RIP+G+ +      +PV FLQHGLL  SSNWVTN  + SLGF+LAD+G+DVWMGN+RGNT+S+KH TL V    FW FS+ E AKYD+PA + + LN TG +Q+YYVGHS+GT + F   S+  EL K IK  FAL PVA +   +SP+  L      +       G +EF+  S +++ L    C+      LCGN  FL+ G + RN+N +R  +Y TH+PAGTSV+NMLH+ Q ++  +FQ +D+G  AKN +HY+   PP Y +K++      +SGG D LAD  DV+ L TQ+ +L  H  IPE+ HLDFIWG  A  ++Y KII 
Sbjct:    9 VVCLVLWTLHSEGSGGKLTAVD-PETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHL--IKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIIN 393          
The following BLAST results are available for this feature:
BLAST of TCONS_00000006-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
LICH5.675e-11946.13Lysosomal acid lipase/cholesteryl ester hydrolase ... [more]
back to top