TCONS_00000002 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000002
Unique NameTCONS_00000002
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4576

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000002 ID=TCONS_00000002|Name=TCONS_00000002|organism=Clytia hemisphaerica|type=transcript|length=4576bp
CTTAAAGAATTTAATATTAACTTAATTAAACCATCGATTGTTTTCTTCGC
TTTTAGATATTCTTGAAAATCACAAACTAATAGAATCGATGAAATGGTAA
TACTGAATAATAAAAGAAGTTTATTTAACAGAATTTGTTTCTGGTGCATA
TTTGGCAGTATGGATCTCAAGAATAGAACAGTGGAAAAAAGACTTAATAT
AATCTGAAGAACCTAaagatatgaaaatgaaaagagtTACAAAAAGTGAA
GATGCTTTGATGTTTGGAGATGCATTTATGGAACGACCATCCAGCTCCTT
TCCACCCTGATTTATAATGCTATATTTGCTCTACACGCTATCGAGCCAGC
TCTTAAATGATGTTCAACAGCAACATAAATAATGATATATTGGTTGATAA
ATCTATATTGATAGCACCTGAATGGAGCGTATCtttcaataaaagtgaaa
ttcaaaGACTGGACAATTCGTGTCAATCCATCAATGGAGATGCGCGTGTT
TTGGTACTTATCGTGGAAGAATAAACATTGAACGGATGATTGTTAGTTCT
AATCAACGCAAAAGCCTGGATAATATCCTTGATGGGTAAAATATGGGTAA
ATGGGTAAAATATTGGAATAATATGGAAATTTAAAATATATCAATATACA
GCGAACGGAGCTTTTGCTTTTAATATAAATACCTTGATGCTTACAATTAT
TGATGATGGCTGGGATGCACAAGTTGGaaagttgaaaagtcaaaatgTTA
GTTTGTTGTATAAATTCATCAACACGAAAGAAAATTAATACACAAAAGTT
GTCAGCTGGAACTGCATTCTGGTATAAATACATCAACACAAAATCATCAT
aacttgaaaatgttgaaaaccaCGTGACATGAGAAATGTTCAAAATGTTT
TGGATCAAGCAACAAATATCATCAACAGATGTGAAGATTCTTAATTCGAA
AATTTACAAAGATGTCTTGGTTGCTTCTGGATAGTTGATAATTGATAAAG
CTGGGCGTTACATCTAAAATATTGAAAGTCATTAAATACAGTAAAAACTA
TGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCAGATGAACGG
AAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCCGgttt
aattttaattatcatcGGACGTATTTTGTTATATTTCTTCCATGGCGCTA
AAAGAAGATCGAATAGTGTGATTGATATGAATGAGGTGGACGAATTGGAG
GAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGATGGTATTTAGATTT
GAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACATTACAAGGACGTA
TATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGAATGCGCACTCTAT
ATCACAGAAACAGGATATCCAATCGAGCATTGTTTGGATTTGTCCGATCA
AACATTATGGAGAGTTGAAATTTGTTTGAAcgctttcttcatttttcatt
ttctcattcGGTTCATTGCGGCGAACGACAAATTATCTTTTTGGGCAATG
GAACCTTTAACGTACGTTGATATTGTGACTGTACCAGCCGTCTTTGTGGC
TGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTACGTGTCATCT
ATTTGATCAACTTGGCAGATATCCTACAATTTCTCAACGTACTCCACACA
GGTTCAAGTCTTGAGATGGCACAGATGATTGGTAATTTCTTGGCTTTGAC
TCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAACACTGGTGATCCAT
GGGAGCCTATCAACTACACCAACAAACAGAAATTGAATTACTTCGAATGT
CTCTATTTTCTATTCGTAACCATGTCAACGGTTGGTTATGGTGATATATA
TTGTCATACGTATCTTGGAAGGTTGTTTAATATTGGTTTCATCTCTGTTG
GCCTGgGTCTATTTACATCATACCTACCAGCTATCCAAGAATTCTTAGCT
TCACATACGAAATATGATAGAGCTTTCAAGCCTACACCAGGGAAAAGGCA
TGTCATTGTTGCCGGATACATCACCGAAGAAAGTGTGACtgggtttttca
aagatttcttgCATCCTGATCGAGAAGATAGTCAAACCACTGTCGTTATA
TTGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCGACTTGCAAAGACA
TTGTACAAAAGCTTCATATTTTATTGGCACCATCTACAAGTTCATGGACT
GCCATCGGACTAGGATGCGAGAAGCAGATGCAGTCATTATTCTTTGTAAC
AAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAACATTACAAGGGT
GATTTCAGTGAAGAATTATCACGAGAACATTCGATGTATCGTACAACTCA
TGATGAACAAAAACAAGTCACATTTATTGAATTGTCCACAATGGAATCGG
GAACTTGGTGATGACATCATTTGCATTGATGAGttGAAACTTGGATTCGT
GGCACAAAGTTGTAATGCACCTGGATTCTCAACGTTGCTGGCAAATCTAT
TCGCTATGAGGAGCGATACGATAAGCGAGGAGATTCAAGAATCAGAGAAA
TGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGATGTACACAGCTCA
ACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAGTAGAattat
gttttgaaaaattgaatttaatgtTGATTGCCATcgaaatgaaaatctca
aaaaaagagCGATACTTTGCTATCAATCCCAATGACAAGAAGTTGAGACT
TTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCAGCGATGTTG
CGAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGACCTTCAAGATCCT
GAACGAATGGTCAAATGTAAATGCAGACGACGTATGAAACAAGAACAGGA
AAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACAAAAGTCGATGTTG
ATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGGATAAA
CAATCATTGACGGGAGACTATTTTGCAAGTGGTGAAAAACCAAAGTTTGA
CCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGCTACATATCTGCCA
GGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAACCATGTTGTT
GTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTGGTTTAAGACAACT
TGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCACGATGTCAAAAAAG
TTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgGCCGACGCTG
GCGAATTTCCCTGATGTTGACATCGTACCTGGTTCGCCTTACAACCGTTC
CGATTTACGGGCAGTCAATGTGAATACAGCGGACATGTGTATTTTGTTAT
CACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTGATAAA
GAAGTCATCCTGGTTACTTTGAATTTGAaagCCATGACTTTTGACGAATC
AGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGATTCGTCACGAGGAA
CTTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGTGGGATTCTCATCG
GGCGCCAATTCAAGGGCGGCCACCCGTATGACTGGACGCCCTGAAACTTC
AATGTCTCACATGACAGCGGGCGGTAATAGTATGATACAAGAAGTCAAGA
AAACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCCTATGATCACTGAA
CTTGTATGTGATTCGAATGCGATGTACATTGATCAAGATGATATGAACAT
CTATGATGATGATGGAATCTTTTTAACGCAACCGTACGCTTGCGGCTCCG
CTTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGCGACATATTTCAAC
AGTGACGTATTAACACTTGTCCGTAATCTGGTCACCGGTTCTGTGAGTCC
GGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGTACG
AAACACAAGAGATTGCCGCTGTCAGGAACAGATGTCGGGTGGCACAAATT
TCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAATGTGGTTTATTCGG
TGATCTATTTTTGTACGCTCTCCGTACGTACAACATGATCTGTTTGGGTC
TCTACCGATTCCGAGATTCGCAACGTATGAAGGACAAAATACCAAGCACG
AAACGTTACGTCATCACGTTCCCGCCctttaattttgttttggatCCAAC
TGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAACGTAAAAGGA
AATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCGctttt
taactttgttttttgaTAGCATTGACTTGTAGGTTTTtatatcttttgtt
ttttttaatctttttaaaacccTAATCACGTACTTCTATTACTTTTCAAT
TGTCTTGTTAAGATTTACAAATTATACCTAAAATTCTATGATCCAGGGGT
CTTATATAGACCCAGCGAACGGCGAC
Run BLAST on NCBI

protein sequence of TCONS_00000002-protein

>TCONS_00000002-protein ID=TCONS_00000002-protein|Name=TCONS_00000002-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1117bp
MASAACRIEVEIPADERKWPWFLVVSGLIFSSGLILIIIGRILLYFFHGA
KRRSNSVIDMNEVDELEEEEFFLEDLEQGWYLDLKEGAGNLVSAQTLQGR
ILVVLSFVFNLAECALYITETGYPIEHCLDLSDQTLWRVEICLNAFFIFH
FLIRFIAANDKLSFWAMEPLTYVDIVTVPAVFVAVYLGRNWLGLRFLRVI
YLINLADILQFLNVLHTGSSLEMAQMIGNFLALTLASAGIVHLLENTGDP
WEPINYTNKQKLNYFECLYFLFVTMSTVGYGDIYCHTYLGRLFNIGFISV
GLGLFTSYLPAIQEFLASHTKYDRAFKPTPGKRHVIVAGYITEESVTGFF
KDFLHPDREDSQTTVVILSPKYPSLKMQADLQRHCTKASYFIGTIYKFMD
CHRTRMREADAVIILCNKKCISPDEEDAANITRVISVKNYHENIRCIVQL
MMNKNKSHLLNCPQWNRELGDDIICIDELKLGFVAQSCNAPGFSTLLANL
FAMRSDTISEEIQESEKWKVAYMIGAANEMYTAQLSNAFIGMSFPQAVEL
CFEKLNLMLIAIEMKISKKERYFAINPNDKKLRLLPGTRGFFFAQDASDV
AKASKYCAKCHKDLQDPERMVKCKCRRRMKQEQEKKNPAQKGKYETKVDV
DPVHLLEAEPDEAKKDKQSLTGDYFASGEKPKFDQSGTFYWCETRSYISA
RMSLGDAAERKFKNHVVVLVLSQRLSPPLGLRQLVLPLRASNRLPHDVKK
VVILGDGDFLAREWPTLANFPDVDIVPGSPYNRSDLRAVNVNTADMCILL
SPGHGSEEDEHQALSDKEVILVTLNLKAMTFDESELAVTEEIKKVDSSRG
TSINGESSADVRVGFSSGANSRAATRMTGRPETSMSHMTAGGNSMIQEVK
KTFKGALNGANIPMITELVCDSNAMYIDQDDMNIYDDDGIFLTQPYACGS
AFTVSVLDSLVSATYFNSDVLTLVRNLVTGSVSPELDELLAEGKQPSGSY
ETQEIAAVRNRCRVAQISLFEGPLSEYGECGLFGDLFLYALRTYNMICLG
LYRFRDSQRMKDKIPSTKRYVITFPPFNFVLDPTDLVFVLMQFEKPKRKR
KSVSRVGSVASRFSGAF
Run BLAST on NCBI

transcript from alignment at sc0000001:38516..84744+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000002 ID=TCONS_00000002|Name=TCONS_00000002|organism=Clytia hemisphaerica|type=transcript|length=46229bp|location=Sequence derived from alignment at sc0000001:38516..84744+ (Clytia hemisphaerica)
CTTAAAGAATTTAATATTAACTTAATTAAACCATCGATTGTTTTCTTCGC TTTTAGATATTCTTGAAAATCACAAACTAATAGAATCGATGAAATGGTAA TACTGAATAATAAAAGAAGTTTATTTAACAGAATTTGTTTCTGGTGCATA TTTGGCAGTATGGATCTCAAGAATAGAACAGTGGAAAAAAGACTTAATAT AATCTGAAGAACCTAaagatatgaaaatgaaaagagtTACAAAAAGTGAA GATGCTTTGATGTTTGGAGATGCATTTATGGAACGACCATCCAGCTCCTT TCCACCCTGATTTATAATGCTATATTTGCTCTACACGCTATCGAGCCAGC TCTTAAATGATGTTCAACAGCAACATAAATAATGATATATTGGTTGATAA ATCTATATTGATAGCACCTGAATGGAGCGTATCtttcaataaaagtgaaa ttcaaaGACTGGACAATTCGTGTCAATCCATCAATGGAGATGCGCGTGTT TTGGTACTTATCGTGGAAGAATAAACATTGAACGGATGATTGTTAGTTCT AATCAACGCAAAAGCCTGGATAATATCCTTGATGGGTAAAATATGGGTAA ATGGGTAAAATATTGGAATAATATGGAAATTTAAAATATATCAATATACA GCGAACGGAGCTTTTGCTTTTAATATAAATACCTTGATGCTTACAATTAT TGATGATGGCTGGGATGCACAAGTTGGaaagttgaaaagtcaaaatgTTA GTTTGTTGTATAAATTCATCAACACGAAAGAAAATTAATACACAAAAGTT GTCAGCTGGAACTGCATTCTGGTATAAATACATCAACACAAAATCATCAT aacttgaaaatgttgaaaaccaCGTGACATGAGAAATGTTCAAAATGTTT TGGATCAAGCAACAAATATCATCAACAGATGTGAAGTAAGTCATTTCATC TTCGACTCCATTacgattttctttttatatataacAAGACGCCTTagcgg cgtgaaggcccagcgattGTCTTCTTATTCCATGTTGTTTACGCTTATGG GAATAACgcttgtaatttttttatctgcCTGTGTTTAATTTATAAACTAA TAATTGTGAGGTACATTTTGTCTGAATCTGATATTGGACgctttttgtac tatttttccTGTTACAACTACCATATATATaagcagtgtagacctaactc ttcatacaaaaattacgggaaacgcatatttggactttgtaccctatgct gcactcaagcacttgggccaaaatcccgcaaaggcgggacaaaaatcagt tttttgaagtttgcNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNcaaaaaaacgccacatagaagatctttca aattcagtatgtgaatagagcagtaaaaaatacaacttttctatttttcc ttttttttgcaaaagttctattctaggaatgaaaataaagggataatgat aattgaatactatccattgatgatccgcggcattatcgtaaagctagaat cgcttgttggaatgtttataaggctcttgacagaatattgtttgttttat tgtcaatgatgacagtgccgttataaattttgttagatctgacaaattga tgtttgtaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNtgatgtttgtaagtgcactttatagttttgattcccattgaagaatc atattctggttttcatgttattagatgctgttttagagctttagagctac actgataagtagtaagtctgcgaccgcagtcggaggcgacccgaaggctc ctctctttcgatagctatctacccgaaggtaggggagggcgccactcttt ctccctggatttctccacttacccttgatccttctcttagttgctgagca tNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgcaagtaccatttt gggaatctttggtatgacccggctgggggttgaacccacaaccttgcgaa ccgtagccggatgctctaccactgtactacggtcgacCATATATATAGAG GTTTAAAATTTGAACTAATGATAAAGGCACTTATAAAAGGGATTCAATTA TTTCGCTATTTTGGTATACACAGGGGAAAAACTactaaaataatgttttt ccTTTGAAGAGATAATTATTTGGATGAGGGTGTTTGGAGTTTAAATCTCA TAGTAGATCTTTATAACAAGGGAACTCATAGAACTGAcaatccaaaaaaa taatactacATATATACAGCTGCATAAACGACgcttaaaaaaatcataaa aattgaattatagTTTACAAAACGCACCATAATAAACAATcctttaattt ttcattaaatattaATCATATTGTTTTATTTGTTGAAAATAGCCAACATT TATTAGACGATGACAGTTATAAATGCTCTGTTCCTACCCCCTAAacatat tattttctttgtatatattttgtttattttttatgtcctATATTCCGCTT CTTTTTAAAACTGTANTAGCATTCCTCAtctattcctcgaacgttcctga gGAATGGACATTTTATGACGTTATTCTTAAGCGTTCATCACTCGTTCCTC GAATGTTCCTCAGGAACGGACATTTATGACGTTAATTTTAGGCGTTCCTC ACTCATTCCTCAAAcattcctcaggaatggagatatttcttcttcacttt atCGTTCCTCATCTTTTCCTCGAACGTGCCTGAAGAATGGGCTTTCATGA CGTTATTTAAAAGTGTTCCTCGTTTGTTCCtcaggaaaatatattttcgg aGCATTTAATACATTTTCATGGATAAgatattcaatatcaaaaactttta tgtCGTTTAAAATTTCAGGCTCTGCCTCCAGAGAAAGAGAGAGGGCTNgc tattaataagcatacatcaatgttcttagccaaattactcaattttttta tgagatagatgtttcacagccccggtggaactttttcctcaatGGGAATA ggaattttattgttccaaggtggaacaaaaatccagtggggatggttttg gagtgcaattcttAAACATTGAatctcgaatggggatgaaaatccagggt attttcccaccagggaagaatttttgcaaaattttccagTAGTGATGAGG TCTCAGAGGGTCTGTGGCACAGGATCTTATTTGTGTTTGAGCATGaagtt ttggtttctaaacTCGTTTTTTCGGCTGCAAatacaatgattttttttga cgtttcaaaaaatctttcacgTGTCtaattataattataatttgAATAAT TGCAAAAGAATTAACCAAAAATTGTATTGGGCATAATATAATACGTCAAA GTGATGAACACTTTACATGaatgtccattcctgaggaacgttcgaggaat agaTGACTCTCTATGAGGAAcaataaagtgaaaaagaaatatctccattc ctgaggaacgttcgaggaacgagtgaggaacgCTTAAAAATAACGTCATG AAACTCCATttctgaggaacgttcgaggaacgttcgaggaacgagtgagg aacgtttaaaaataacgtcagaaatgtccattcctgaggaacgagTGAGG GATGCTTGAAAATAACGTCATGAaagtccattcctgaggaatgttcgagg aacgagtgaggaacgtttaaaaataacgtcagaaatgtccattcctgagg aacgagTGAGGGATGCTTGAAAATAACGTCATGAaagtccattcctgagg aatgttcgaggaacgagtgaggaacacctaaaaataacgtcataaatgtc cattcctcaggaacgttcgaggaatagatgaggaatgctaaaacaaagtt ttgaaatatccattcctgaggaacttTCGAGGAACGCTGAGGAATGGTGA GGAATAGAAGAGGAATATTGAGGAATGGAGATGTCCGTGAGGAATGGTGA TCGGGTTAGTAGTGATACTAGATGGgaaggaactgggattggattgccac tatccaaccctgtggctctcacacacattttacagttcaaagaataagat ggaaagagtggggaaagaatgagaatttaNTTTTGAGTTCAAGCTCATCT GGATAGATATCTCTATATACAGACTGAAACAAGTATATATATCTACCGAG AAATTTCAATGTTGACAATTTGGACAGAATTCACAAAAAAAGTATGGCAT TCTAATTTTGTTTAAGATTTCAATTAATAGTATATTAAGAAAGGTAGTCA AAAGATTTCCCACAAACAGTTAGTCACATTAGCATCCTAccgaaatgcgt atcaaagattaatgctgccaTTTTGCACTATATCGGTTACTTGAAGCAAG AAAATGCGTCGCAAAACTTCTAATAGGATTCATAGAAAATATACTgacgc tttttaatgaaattaatatttttatgagaaattaccaaaattttgagcta tagatgaaaaaatttgagctgagccaaccttgaaaactaatttgaagaac aacttctcaagaaaaaatATACGGTGGAGAAGACCTACATCCATGCACCA ACGGATAGGAACCTCAATATCTCCGTtatattttgaaaggaatttttcCA GAAATTATCAGTCGGTCGGACGacaaacacaagttatttgtgattgtgGC TTAAACCAATCTAGGTATTGGTAAACAATGACTGTCGTCAGTAAAATCTG TAAAGTTATCGGAAATCGAACGAGTCACTACATCCGGGAGGTCACATATC TCAAACATCTTTGGTCGTTTAAGCATTCCATTTACACCTGAACCTTTAAA CCTTCAATGATACACCAAAAGTGCAATCAAATTTATAGAGTTTCGTCAGG AAATTTACAATTCAATTTGATTGTCCATTCTGTTTGATTGGATATGATAt gacttgaaactttcaaaaGCTTGACTTTTATAGCGTCACCTGACCAATCC AACGTTtgctctgttttgtttttgccatACATCAATTTTGTTTAACTGTA TATCAATAAGTATTTACATACAATACATATATACATCTGTGATAAAAAGC TGATATGATAATCAGACTGTACAGACTGTATCGTATAAAAGTCCAATAAG TTTCATGGTGTTTCATGCCGTCATGGGGCATGGATGGCGCACAATGACCA ATGTTGAATAACGTCAATGTAAACAATGGTAGTAAAAACTTGCATGGAGA TCATAACCATCGGCCAGCATGATTCAACACcattgattttttggaaattt tatttccaGTCACCAACCATTTAATATTCACATTTTGATTTGTCttgttt ttcttgtaaaaaagttgTACTGTAGCGGCAGCTGCTAGTTATTGATTTCT CGCTTAATACTCGAGCAAATCTTAATatgaatcaaaattataaaaaaatg aGTATCAGCCCCTATGTACGAGGTTGATTTCATCTTCACTCGGTTATACT AAGTTTGTATAGGTCTTACCGTATGTGGATTAAATTTCCTGTGTATTCAT TTTTCAGCGATTTTCGctatttttggccattttcacgAAAATCAGTCCTC ccaaaaagatttaaaatccGAAATNcgatttttgcgatttttggccattt tcacgAAAATTAGTcctcaaaaaaagatttaaaatccGAATATTGGCCCC GAGGGAAATAAAAGAGGCTGATTATCGCGAAAATTTGTCCATTAAAGATC TTCTGTTCTTAATTGGCAGGCAAAAGCTTTTTGCTTCGAATCTAATTTCT TACCACAATCTTACCACTGTGAAGAATGTGATGTTTGTATAAAAAAGGTC CTCGTAATTAATGCCAATTCTTATCATCTCATGATATACCTTTGTTGAAC ATCTTTGGATTGCAGTGATAGCTTCAAGATAATAATTTTTATCAGAACAC GTTTTTGTTAACCATGCAGAGAACAGTCAACTACATTTTCCATTCCTGTT GTTTATAAGAAGAATTGTGAGTAGGATTTGACGAGTAAATAGAATTTAGA ATTTTGAGAGTGGAAGATAATAGTTTTTCCCAGTCCCCCTACAGTGCTAT ACCGTCTTGGAAGAATTTCTGTCGCAATGAAGTATATAAAAACAcatccc cggtggaactttttgcCAAGTCcttgaaatcctaatggggatagcaattc tattgttccaaggttaaataattcagtggggatggttttggagtgcaatt tttaaaacattgaatttcgaaacgggatgaaatcaaagtcactTTCCAAG TGgagctgaaattccagggtattttcccaccgggtatgaaatttttgcca aatgtTCCAATGGAGCTgaccaccgggtctgtgacaaagGCTTTTCCATC TTAAAAATTCAGCATAATTCACCAAACATTCAAGAATATGTGCtgatttg ctgtgtaaaattcAATTTCCTGCCCAGGCCTTGTGTCACTGTGTCTAAGA AATAACGTTTTTCCTTAGCCTGGAAATCTAACCTACTTTAATTCAGTCAC AAGGATGAATTTGATGGTAAGTTGTAACTGAATAAATGTTCAATATTCCA AGGCAAATTTAAAAtctgtaaatataaaaaatctttaaagcgccgaaaac gctatattgtcATTAGCCgcgtgtcctagccttgtgaatacgggctttgT TAACTAGGCTAGTTTTTCCTATCAATAAAGTTCTTATAAGAGAAAATAAG ATGTCTGAAGAAGACTTATCTATGGATTAGTTTTTCACTCCTTGCTGTAT TACATCTGATATACgttattattttaaaaataaatcttttccCAATCGAT AAAATCGTCATTAATAATTCATTGTCAGATCTATGcagtatttaaaaatt tatttatgtTTTAGAAAAGAAATGTTGAGATGATGATTataacagaaaga aaaatagttttaaaaagattttaatagaatcttttctttttttaaggcGT TTTGAAACAGCTCAAACTGCTCAAAGTTGGAAGAAGTTTAGATTTTAGTT TagaaaaaatctctttttattTGGTGTCCCCTTTTGGTCGATTCTTGTCT TAGGCAGTATTTTGAGGCAATCAGAAATTAACTATGTGTTATTGGCTACT TTAGTTATAAATTTGGTTACACTCATTCCCACAAAAAGGCCTTGTTAAAA TTTACACGCCGTATCTAGAACCTTAGCACAATGTTATGGCTGAACCAAAT TTACCTGAAATTTCTGATTGAATAcaaatatttcttataaaaaatcttca CCAAAAAcagtataattttttattaaaattcttAAGTATTTTATCTCACT GCtatgaatattgaatatatattcatgaaacttttttatatataatacaA ATTGATAAGACTGTGACAAAATGTTGATTGCTATTAGtataatatttttc atatatttcataatataatgaaaaacgaaaagttttcttaaaaaaatttg gaaCTCGTTGTTGTTAtggtaaaataatatttctagaataattttttaaa gatgTCGATGACAAATGTTCTCTAATTTGTCGGACAGTTTTACAGTTCAC GCTCTCTTGGTCGATTTtaaaggggaattggattttcatcgaataaggga gcatatcgaatagtagagtgtTGTTTCTCGCGTTGATGGTggtttcaata ttttataaaaatgaagtgtattgaatagtagaacgtcgctTTATGAGAGT TTTATACACCCATATcttacagccccggtgaaactttttcctacaAGGCC CTTACAACGgtgataaaattttgattaaaatctcaatggggataaaaatt ttattggtccagtggggatggtttcggAGTGCAATTGctaaacaatgaat ttcgaatggggatgaaatcaaagtcaatttctcagtggggctgaaatttt agggtatttctcccaccggggacgaaatttttgctaaaCTTTCCAGCGGG TCTTGTTTGACGGtgattttcaatattatcgaagaAAGGAGTGCTTGAAA TAGTAgaaggtcgaattagagagagtcaactgaaGAAGTTTGTGGTACTG TctgtgaaaaatatttcacctTTGCGTATATGAAGTTGAAGACTCTTGAT AATTCaaacttcaactttttttcctcagtggggataaaattcctattgaa atcccaatgcaATGGGAATAGCAATTCTAAGGTTAAAAATCACAGCAAGG ATGgctttggagtacaatttttagtgaGCTCCATTTAAGAATAAATAAAG TGAGCTGGGTTCGAATTTgagaataaataaattttgaagttttatttttt ttggctcATACTCTAAATAAGTGATACTTACACTTCCAtctttttcttat aataaattTCTTACAATGGCATTCTCTGTAAATTACTTGGGGAAAACTGG CAATCTACAGTTAGCATTCTTAGATTTTGTTGCCTAATTCcacgatggtg atattcttagcatattcttaattttttggcaaatttcttcatgaatattc ttataaagtatgttATTATATCAAAAAGTGTGTATTTCTAAGCTATGGGA TTTCTATTTTCCAGTCTCAACTTTGAATGTGAAAAAACAACTTTATTCTA ACTCATTTTCCTATATAAATAATTGCCATGTTTTAGGGAAAAATTAGCAA ATATATGAGttcttctttctttcatttttcaaacaatcTTCTAATTTTCC tatgttgttttttcaaaaagtaattTTCTCTATTTATCAACGTAAAACAA GCCTCTAAACATTATCATAACATAGACTTGTGAGAATCAGTATGAAATTC TGTTATCTTGAAGCTGTTTTTTGAACCAATTTCTCTTGATgatattattt ttatcaaaatatttggaaattttctactgattttttttctctgaaaattc TGTTTCCTTTTCATAGAAGAGAAGTAAATTTACGTTCTGTGGCCTACTTT TGTGATAGGATTAGATTTTAGAATTGTATCTCTAGTTTTCAGTTTGTAGG TTAATGATTTTTGCGAGTTTTGAGATAACTGGGTACATGCTTAAAAAGTT TAGCAAAACATCCTCGTCTCCTGTGATAAAAATTTCCCGTGTAAAACTAA TCGTAACGCTCATCACTGTCATCAGCCATGGGAATGGTACCATAGGACTA CGATGCGATGGTAAAAAAGCTATGGTGATTCCCAGATATAACAATAAAAT TCAATCTCCATCCTTTGAAAACGAGAGATTTTCAACTTAAATACCATTTG GCTAACGAATTCTCACTGCTGGTCACTGAGATAGGGCTGTCtttagaaaa caaagaaaatttgcaTGCAAATTGGAACTTGGGTCCTTATTTTGACCCCA TTTTGATCAAAGGGTATACATTTATCACTGGAATATTATAAGGAAGTTGA GCTtaaatttttatgatttatgttgaataaagtaattttttatttggctt gaaggttttgtttttaacctttccagcgcactgttttttatattttcacg ctttctgcgcgcaacttttttttgagaaaacgcgATGTTTGGGAAATTTg ccataactcaagaactagaaatcttttggcaaaaagtaaactatccctga aaagctaattaAGTTTTACAGCTTTTAGGTTGGGTACAAGTTCAATTAAA GTATTCTAACTTAAATGGTAGCTTTACATACACCAatgcttttttcctca tttttcgacaatgtcacttttttggcatttttcactttctatGCAAAGAA AAGTGGGGGAAAGTTAattataaaatctttctttactATTTTATCAATAT ATACTTACTCATGAAGCCATAAACCAAAAATTAGCATCCAAAAACAATTC TACTGGTCACAAGGGCTTTTCAAACATTGTTCACTTTTCTCCAAAATCAG TGTNNNNNNNNNNNNNNNNNNNNNNNNTGCCATCTTGAatcagtgttttt atttgaaaagtgctgactcacaccgtgatcataacattacatcattatat atcaacggaaagcttagactctctactctctttttctttatttttcaacg atCAGAAAGCAAGCCAATTAAAGATATTGCGCGAGAAAGACATGCCTATC AAATTgcgtatatgtacggcattcggaacgtctcaaggacgtatatgtac ggcattcgggtccaaaaggttaaaaaagagtggtatcgtttgcttactca tcaattttaattcgcaAGCTTTTACACTTTAGATtggcacgaatgtggag caagtttggtcagaaagaggaaaagaaaaacgtttttttgcttatatcag cataacataacaataggcagacactgttctgatatgaaatatgtgtctga tatgaaacgggaacagttattttaaaagcaaaacctttAATGCTAATCTT GTCAGTTCGCgattaaaaaaataagacaaagTAATGTTTTTCTCAAATTG TGATTTTCAAAGGTCAATTTGGTCAACAGAGTATCCAGTCTATAGTTCAT TAGGTTAAAAAGGTGTTGATTTTTTAGCCAAACCTGAAATACAACGTTTT TTATGGTTCTTATATACCCagcaggcacacaacgttgtttcaacgtttat ttaacgttcccaacgttcatataacgttagatgaacgttgaaacaacgtt gtgtgcaagcTGGGTAGCTTTACTTTTTGGGCGATTTGAATGTTAGATGA CAGATGGAGTACTTTGTGATAGATTAAGTTGAATCATGATAGATAATATT TCTCGGTAGAAGCTtatgaaatattgaaatattacaCGCAGAGCATTTTG TACTCTGTGCCACAGTGTATCTTTACGTATAATGTTGCGTGGAACgtcaa ttaattttgaaattgccACGAATATCAGGTCTATTTACAGACAAAACACT TTATATATATGCTCCTTTCTAAAGAAGCACCATTTGttactattttgtat ttatgtGTGGTTTGTATGTAGTATGCAGTCCTGCCGAGTcttaataagga cgaaatgcttATACGTCTCAGCCACCCAGATCTCCTGAATggatatagtt ggacagaaattcttattttttcacatatgccttatcggggaaaacttcgt cggggaaaagtgacaaattttggccaagtgacgaatatttttccccgacg aaaattttccccgaccttaatgcgtttaccaactaccagcaagtaacgaa tatttttttctgacgaaaattttcctcgacgaagttttccccgataaggt atacagATTATTTAACTCTGAGGCTTCTTCTTGAAAGTTACTTGTAGGAA ACTCATAGTAAAGCACTAGTCTATTTTCAGCGTTAACTCCGAAAAGAATA CTGAAGAAGTTGGTGTTCAAAATGCTAGTACTAATGAGTTCTATTTTTTA GTGAGGCGTAGTGGTATTGTGGTTAACATCCTTGACTCCCGCCTGGGAGG CCCTAGTTCGATACACACCGTGTCACTACGATTCACTCGGCAAGTGATTG TACCTTTGCCCGGGTCAAAcaatgccatgtgaggggaattgggtaccatt attctcatacaagagtgtgggtagaaTAGACAGACATTGTGACCTGCCGT GACACTCACGAGGTTCGGCCTCGCATGAGCATCGctctcccagtgtcgtt cgagtgtcatggtatacgccatggcttggcagctcacgtctgtcaagtcg cagtgtctgtcagcgctgtgattcctactcctttgggagtaggacccatc ccgaatgcattcggagggcCTACTGATAAGGCCTGATATGGATAATTAAA GACCATCCTGGTTAGATCTCCAAAAGTGATTATCTCTTGCTTTAGAAAGT TATTGTAGAACAACAAGTTCTTCTTGTGCTACACgttttctctttatttt aagaacatccaaattttttgacgccttcggatgttcttaacttttttgcg ttttaagcctaaaaatgttcttaacatgctctgagtatttttgtccattt tcctaagaaattgagtgtCTTAGGGACTACgaagccttgaaatattctta acttgatctttggccatcgaagccctatgttcttatatagtttgttctta taaaaaaacgtgtatacaaaATCATGTAAAGTTGGATATCAAGAATAATC CATAGCTATAAGTTCTGTCTTTCAAGTTTAATACATCCAAAGATTATATG GATCTTAATATATTTAAGGTTCGTTTTCATTAATTATCATATTATGAGTT AGTCTATTACTTACGAATATAATCCTAttctcatttaaaaaaacttgtat ccTTCAGGTCACATAGCCATTCAAAaaagtccctctaagggtcaGGGTAC ATACTTAGCATACCTCAAACCTAGTAGCCCCTCGGGGTTCTACATCATTG cattttctctatttttctaTTACAGGATTCTTAATTCGAAAATTTACAAA GATGTCTTGGTTGCTTCTGGATAGTTGATAATTGATAAAGCTGGGCGTTA CATCTAAAATATTGAAAGTCATTAAATACAGTAAAAACTATGGCGAGTGC AGCTTGTCGTATTGAAGTCGAGATCCCGGCAGATGAACGGAAATGGCCAT GGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCCGgtttaattttaatt atcatcGGACGTATTTTGTTATATTTCTTCCATGGCGCTAAAAGAAGATC GAATAGTGTGATTGATATGAATGAGGtaaatttttagtttctatGGAATT GAGTTTTCTTTTGGAAGAATTCGTTTACTTGgctaggctgcacacatccc ctctggtATGTCTTGATATAGTTGATGcaattgacttccaagcccgaagg gctagactcgagacttcTGGATGGgcaatgaaaccacttatttcccatcc agaacgcccgtgcgtggtttttacacaaacgccggatttaaattaaaatc tatcgctatagatttcaaaaaatgcaatcctcaaaaacaaaaaaaaacgc tagatacaatccgtggttatgattacggcgcgttctggatgggaaataag tggcttcactttttcttgcctgggaaaggttagagagtctactctagccc ttcgggctttaagtTCAATGGTTGATGCTCAACCACAGCAtttcccgtcc gagagttaccccaatCTTTGTGTTtcagttttagaaacttgattggCTAG AGGTTAATACAATAATTGGATTTCTAAACcttttcaagaaattgaaacag gttaccTCAAGTTTGGGttaactctcggacgggaattttatacaagATTT TCATCCCTTACTTCAAAACATATCAgtggggatgcgtgcagccttaATTT CTCATATCCCAGTCAGTGTAAGTTTCGGCGTCGTTGGGTGGACGTTGATA AAACCTTAAAGATCTTTTTGCGTCTTTACTGATCTAACGTACCTGATGTT AATAAATTGTGTCTAAATGCTTAGAAAATAGCTAGTGGCCGAACAACTGA CCGACTAAACTGTGAAGCTAGTAAACTGATCATTGATGAATAATGCAAAC AGAGACTGGGACTGAGCCAACACGATATTAATGAACTAAAAGATGAATAG ACATCAATAGAGTGGGGATCAGGCCCTCGAGCCCAgacatcaatgctttg taataGGGCGAGCAAATATGAGCGagcaaaagaaaaagatcaagCACTTT GAGGAAAGAGCTCGAAGAAAGAAGACTTGAAAAGGAGAGCTCGAAGGAGC AGGACTTGAAAATGAGAACTAAAAGGAGAAGGACTTGAAAGAAGACCATC GTTAATTACATGCCAGATCTATTAATTTACTTGATATAATTATGGTATAC ACTTATTAGACAACCTAAACCTAATTGGAAAAAGACCTAACTTCCCTTCG TCACAAAACGATTAAACGATGCTATAGGTTAAAACAAATCACTATACTAA GAAAGAaaccaaagccgaagaaaattcgcaagtggttttttttttgccga GTAGAATTTACAACGATAGAGAATGCCAGTTTGTACCGCCGATTTTTGCC GCCCGTATACCGCCATTATGGCTGTAAACTTTTCGCATCTTTACTAccaa gtttatgtatcggaggatatccaGGTTGACGGTAaatgaaatcgatacaa aacaaagtcgatagttgatgtacggcgctatatcgcctttgctcacctaa acagacgacggtattttgatgtttttactgTCGTCGAGTAAAGTGGACga tgattttggagacattcaactttgctttataccgcccCCCTcgtttatct cgaatacatataAACTCGCCACCATGGATCTTtttaacggacgataacat cgtctattaaacgatttgaatttttgtttcaaataacACAAGTCTTACCT GACTTTTTACGGTAAAAATATTGCAATAACAATTACTTTTCCTATTTCCA ATCCGTTAGGTGGACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTT AGAACAAGGATGGTATTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGT CTGCTCAAACATTACAAGGACGTATATTGGTGAGAATTTCGATACAATTA ACTCTCTttatttcgaatctttctgtaaatcGAAATAAATTGTTGATACC ATCAGCTGGAACGtggtataaaatactctctgtaattcgattcATTGTCT AATTCGAAGAAGATACCTGGtcgcttgaagatcgaattagagaatgtttc gaattacagagggtATTGTATACTACGTTCAAGCAGATGGGACTAACAAT TtatttcgaattacagaaagatccGAATAAAacaggttcgaattagagag agtttgCTGTATTAATCTTTTTAGTCAGCACACGTcttcttaaaataatt tttttacttgagtCTTATTTTTGTCATAAGATCTGATCTTTCCAACGCGG AATATTTTGTATAGACTGGAGTTGTTTATAATGCGTATAATACAGtatat atgataatacgattattgtcacgggatttagtttgtataaagctaaaatt gttcccttccATTACTTTTTGTCTGAATTTATAAAGCCTATTTCTACTTT GGAAACTCATTTCTTTGTTTGTTACTTTGTTTAGGTTGTTTTGTCGTTTG TATTCAACTTGGCAGAATGCGCACTCTATATCACAGAAACAGGATAGTAA GTTTAAAAATTATCTAGCACCCTCAACCCCCCAAGAAATATCTTGATACA AAAGAATTCTAAACATTATTGCAAGATAAAAACCTGTCCCCCGGACTCCA TttccgagtttatgtatgtgtctTTTTCAgcaacggagacggtaaggttc taatttgactagatcatgaccaactgaggacgacggtaaatcagcatttt taccgtccttgattttgcaggtcagaagtccgggtttttccaaatcgttt cagtcacattatcgtcctcaaaagtgcaaatacataaactcgctactatC AGTGTTGAGTCCAGAAATGGCCGAGAACTCAACACTAAAAGTGGGGGAAA GGGGGACCATGTGCAGTGTCTCGGATATAAATTGGGAGATTGCAGATACA TATTTCCATCCgatacgctaaagctctgaaagtTGGGAATACTGACCCGC TCCTGTAAAGCTTTAGCGTTACCCTTACATATTTTTTAATAGAATTACCT AAAACGAAGAGAGCATCGTGATTCttagaatttttcaaatattcctAAGC CAATCATAAGATTTTTAAGGGAAAGCAATAActgtgccgtaggaagcatt ttttaaggggaagctgaagtttagtgacaccgcgagggcctaccatggtt tggcccgcgAGGGGAGGTTCGAAAAGTTTGTCCAGGAAAGCAGATTTTTA TTACCCAATAATTGTCATGTGATTGAAGATAGAGAGTCTATCatcatatt tccctaacaccctgctTGGAAGAGCTTGGACTCACAAACTTTcaccgcaa tggactgtgttcgaatcccaagctcttccaggcagggtgtcggggaaata tggtgatagactctctaccttcactcacatgtcattctctctcaatccgg ctgataatcgaagtatcgattgacgtcgaatgagcttagtaaaagctcaa attgcagatgtagaacgataaactcggtatacaataattgtatttttata ttatgaaaagATGATTACCGAGTCATAAATATTTGCTCTCCTCaccaaat tttgcgcccctcttgtctacgcgACTGCTACGTCGTCATATTTTACTTTG CATCTTTTTCAGTCCAATCGAGCATTGTTTGGATTTGTCCGATCAAACAT TATGGAGAGTTGAAATTTGTTTGAAcgctttcttcatttttcattttctc attcGGGTAAGTCATTTCTGAAACAACGTCCTAATAGCGTACACCTAACG TTCAAAACATCAATATAACATCAGATGAACgtttaagaccatgttcacac gttactgttccatTTCGCTCCGGTACGATTTTCGTTAGATCGAATGTGta catattggtttcggaatgtttcggagcaagaaaacggagcagttccgttc cgatgaaaaatgtggagcgaaaccgtttcgatctgttttgctttgtaacg tcttcttttttgacgcttcgaattttgacgttcacacgcTTGTTTCGGCA CCGTTTCGTTTTGGAACGGAATGGAACTGTagcgtctgaacatggtctaa ataaCTAACTACCTAACATAAGGAGGTGAAATTTAACTaagtctttttca ttttttcgtaTTTAGAGGTAAATGTCCGACTTCCCGGCAATTAGCCCCCC CctgctttttaaaatttgaagattctTCAACACCCGCTGTTTATAAGGCT CCAAACAAAGCTAAAAGTATCGGTAAATGACTTGAACGCGGACTTGCTCC GCGAAAAATGGTCCGTATTGCTTCTAGGACGAACCTCAGTTAAGCCTATT TTCTGTAAAGAATATTTGTCATGCTGTAACGCAGACGTTGCGATACTAAA TCTCGTTAACACACCTCGTTGTTGGGTTAACTGACCATAatgcacctttt cgaccgtagctgcgCGGTCAAGCGCGTGCCACTTAATTATTTAATTATCC tcctaaactcgatccaatccttttttgacacatttttctattgtctatag gtgcgaaaaaaggactgggacggttttagtgggataaagcggataaaaaa atgcccgcgcggcaattggcggctacggtcgaaaaggtgtatttcggCTT CTTCTTTTCCAGTTTATCGAGGTGAACGACAAATTATCTTTTTACCTCGA CCTTGTTGTTGGGCTAACTGTCCCTTACCTGCCATAAATTCGACTTTTTC TTTTCTAGTTCATTGCGGCGAACGACAAATTATCTTTTTACCTCGACCTT GTTGTTGGTTTAACTACCCCTTACCTGCCATAAATTCGACTTTTTCTTTT CTAGTTCATTGCGGCGAACGACAAATTATCTTTTTACCTCGACCTTGTTG TTGGTTTAACTCCCCCTTACCTGCCATAAATTCGACTTTTTCTTTTCTAG TTCATTGCGGCGAACGACAAATTATCTTTTTACCTCGACCTTGTTGTTGG GCTAACTGTCCCTTACCTGCCATAAATTCGACTTTTTCTTTTCTAGTTCA TTGCGGCGAACGACAAATTATCTTTTTACCTCAACCTTGTTGTTGGTTTA ACTACCCCTTACCTGCCATAAATTCGACTTTTTCTTTTCTAGTTCATTGC GGCGAACGACAAATTATCTTTTTACCTCGACCTTGTTGTTGGTTTAACTA CCCCTTACCTGCCATAAATTCGACTTTTTCTTTTCTAGTTCATTGCGGCG AACGACAAATTATCTTTTTGGGCAATGGAACCTTTAACGTACGTTGATAT TGTGACTGTACCAGCCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGC TAGGTAAGTTATTTTATACAGACTTGACCTCACGAATCGTGGATTGACCT TTAAGAATCGTCGTCAATTGTGGCATTACCCtctaaaacattaaaacaag ccgctgtttccttaaaaaagcagaaaaattcgtgttaatttcagatcgtg caaatttcaaggccgttaaatacttgcctagtaatatttgtgtaataagg taataaCGAATATGTATGAAAATTGACACCTTTTGTGTTCGAGCGTCTAT CCATTCCTTATTGGAGTACTTCACTGGAAAGCACAGCGAAAATTAGCCTA AATTTTAATAAAgctgactctctctaattccaTCTTCAAGGGAGGACCAA AAATCTTTCTTCGAATTATTGAAAGATTCGGATTACGGGGGATATTTTAT ACGATACTCCAGAACGAGGGAACGATGTTTTAGTCCGAATTATAAAatga ttcgaataatagaagttcgaattagagagagtagactgtatttcttttta ctttttaggtcTCCGCTTTCTACGTGTCATCTATTTGATCAACTTGGCAG ATATCCTACAATTTCTCAACGTACTCCACACAGGGTAAAATTATTTGACT ACAAAAGAATAATAGTATCATAGTAGAATAATTTCTAATCTGTTTCGACT CTTATAATACACCCTGTGTCACTGACCCGGTGGACCCCTACCCACTGGga aatctggcaaaaatttcgtccttAGAGGTTAAAACGCCCTACAATGTCAT CCCCACTAGATTATTTTGACTTCTATTGTGATTTTGATAGAAAGATAAAA AGTTCCatcagggctgtgagacaggattGTTATGATCATACACTTAAAAC AAAATTAAGTGACGCGGGTTTGTCAGATATCTTTTAATTCTCGCATATTT TTGCCCCTTTTCCAGTGCAATTATGTGAAATACATTTCTTATTGGTTATC ATATTTTTACCTTCAATAGTTCAAGTCTTGAGATGGCACAGATGATTGGT AATTTCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGGTAAG TTGCTGGAATAAAGAAAAGGGGgcgtaccgtaagttggtctaatgtcgac atccctcttctaatttcgacacccttctttagagaggaatgataggaagg tcggaatcactgatggacTCCGTAAGTGATttctaagcaaagaaaattag ttccaatcaGCGAtcccgaccttcctattattcctatctctaaagaaggg tgacgAAATTAGAAGGGAACTTTTACATtatagaccaacttacggtacgg CTTCGACGGGGTGACGATATTAGTTCTTTTTTCCTGTCGGTCCAGGAAAA ATGCTTTGATTTTTCGGTGTTCAAGACTCCCGTACGCCCGGCCCTTCCAC AGTTTAAGTATTGTTAGGTACCTTACGAAGCAAGGTAGACCAACCTCGGG TATAAAATATCGGCTTTTCTTGCTTCATGTACTAATCCCTTAGTTTAGTT TAAAGTTCAATATGCTTAATAATTTCTTGCTTTCGAGTACGATGTACGAG TACGCTAAATAGACGTAGCGTCGCACCTAAAATTTTCCATTTGAATTTAG ATACAGTGAAGTCTCTTTAAATCGAATTCCAACCTCTACAACTTGAATAA CTCCTATAATGGAACAAGTTTACTGGTCCATTCAGTTAACGAAGCCTCAT AAACCTATCTCATCTcctaactcgaaatttccataaatcGAACAAATTTC TGTTCCccatgcgtgttcgagttatggagactccatagtacaatatataa agtttgtctcaatataatttgcaccAGAGacaaaaaggctgtaacttttg atagaactCGAATTAAATTTACCACTTAAATTGCAAATTGCGGAAATTgt tgcaaattatattgagacaaacTTTAATTCATCTCAgactaagaccatgt tcagacgttacggttccgttccgaaacgaaacgaaacagttccgaaacaa gtgtgaacgtcaaaagtCGAAACGTCGAAatagaagacgttacaaagcaa aacagatcgaaacggtttcgctccactttttttcatcggaacggaactgc tccatTTTCTTGCTCTGAAACGTTccaaatatgaacacactcgatccgta acgaaattcataccggagcgaaacgaaacaataacgtgtgaacatggtct aagatacgcttttttatagtttgtcctttgtttttatttcagttgGAGAA CACTGGTGATCCATGGGAGCCTATCAACTACACCAACAAACAGAAATTGA ATTACTTCGAATGTCTCTATTTTCTATTCGTAAGTAAATCTTCTTATAAA CATAAAGTttcaggctcagtttttggtacctaaacaatgactctattgtt taagactaatagaatgctaagcataatgcgagcctgagtAGGAGCAGACa ctatgcttataaaataaaatctaccTTCAAATTGACTTTTTTAGTCAGAC TAGAAGTTCTTTTTAAGGGGCATTACTGTCAATAAATTGTCTTGCGTTGA ATCTGTTCGCCATAGTTTCTAGCGTTGAAATTGtgcaaaaatttttcaaa tattggatTTATTAGAAAagcacttttctttttttcaaagttttccaaaa tttgttgaaatacacgcttttttataagaataatttcataacacgaggct gaaaattggccaaaacctaagaacaaattaagaacgtTCTGTGCCTCAGA TTTTAGAATCATTAAGAAAGGActaattttaacagattttaaacgCATTT TCagtttaagtaaagaaactatgcgtattaagaacatcgtaagaacattt atcctgaacatttcaaaaaattaagaacagtttagCCAAAATGTActcag ggtgtctacgggaccttgaaaaccttgaaaaccttgaaaaccttgaaaat gaaccacccaaccttgaaaaccttgaaaactatcaattttctgggaaaaa ccttgaaaaccttgaaaactatcaattttctgggaaaaaccttgaaaacc ttgaaaaattgttaaaaaccttgaaaaNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNtagatcaaaagttatgggcctatttgtggtca aaaaggtgtttaattttgcataaattaatgcagattgtggggaaattccc tNNNNNNNNNNNNNNNNNNNNNNNNNNNtctagagaagttgggactttgg tgtaatacacttttttgctcagtttgaagagctctatcatgtggNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNcacgataatatcgtggaaactttttgattttgtaa tctacacatactaattcgcgagtttccgttgttttttttggaatctaaaa tatgtatcacgaaatgaaacgcttttcgacctcagccgcgcgactatatc cagtcattcgaaaagtaagaataagtaaaaaaccgcctgcggcgctaaac ctTTATAACATTTATAGAATTCCATATTTCCCTCTTTCTGTTGCGATTCT GTCGCAACGAATGCAacatattcttttatcattagctgagtttttgtcac tatttttttttgtttgcatgAGCCCTTAGAAATCGACTgttccccaattt tcaaatcgcttcagggtgtcttggaataatggccattcatcaataaaatt tcgaggattccttaaaacaactcttttggcatttttgtaaaaaccaaatc aaaaagcaaggcgttttttagccatttgaaagactcagaatcaaaatttt ctcttgtcggcgcaaaccatggttgcgcctcctcagtcactgtaaacaat tggttttgcttctaattctttatttctacagCTGGAAGACTACTTAGGGA GCTGGAGTATTTATTTTTGTGGTATTGTTCTCGAGAGGGAGATAGGAATC TAACTGTGGAAGTTATTCCccgggcaccaaaagcgaataaattttatttg ctgtcctctatttttctttcacctaccactctgaaaaaaaaattcctgta aAGAGCCATGTCAACTGAGTAtcagaaaaccttgaaaagtgccaaagttt ttgctaaaaaaccttgaaaaaccacttaaaaatgaccaaaaaaaccttga aaaccttgaaaatcccgaaaaaaaatccgtagacaccctggtactggttc ttataaaaaaaagctttacgtggaaattttattgataattCATTGAAGAT TTCCTTTCCATTCTGGGCCTCATACATATCGATTTCATGGAGAAAGAACT TGATAAATAACTTAGACATGCCAGACTACTCCATTCATGATAGATGGGTT TGTTTTAAGGATAAGAGAGGTGAACCCCTtatgtaggatttgaagccatt taTTTATCCTACATAAAAGTTGCGCGAGCAGAATTCACCGCTAACGAAGA TGAGAGAAAGTGctaaattcaatccgtcatctGAAATGTGACTACGTTAA TCTTAAGGCGTCAGcgtcattttcattttgcttggaaAGGGTTCGACTCT AGGCTTCGACTACATTTCATTGGTTTAACTAACGACATAAGCCTAAGCAT GGTTATATCGTCAAAATCTGGGAGTCTTGAAATTACAGTCAATTCTCTCT GATTTGAGCCTTGGTCTCCTCAGCTGGAAATTAGCATAAATTTCTCTCTA TAATTTGAATATTTCTCTAACTCGACGAAAGGTCTTAGTTCTTTGAAAGT CGAATAAGAGAGAGGCTACTGTACATTAGACTACAATTCTTCTGCTTTGT TATAGGTAACCATGTCAACGGTTGGTTATGGTGATATATATTGTCATACG TATCTTGGAAGGTTGTTTAATATTGGTTTCATCTCTGTTGGCCTGGTAAG ATGACATTGTTTTTTTCCAGGGGCCATTCCAATACAGTAGAACCCCAAAA ACCTATCTATGACAATGTCTCCTTGATTTGAACAGTTTCTTAGTCCCTAC TACGGCATGGGTTTCGCTTTGATTTTGATAGGCTGGTGGCGAATAAAAAA TTAACTCTGAAAAATTCTAGATTCTAGGCTGGCAAATTCTTTAGCTAGCC CAGAGATTTGGTTAGTGTGAGTATGTACTTGAATATGTAAATGAACTTTT AAAAACGAATTGTAATTCTTTTTGACCGGCGAAATTCCCCGTTTGTTGGA CCCCCTCTACATATGTTACAAACCCTTGTAAGCAAATCTTATATtaccca aattttcaaaacattttacaCTGATGCTTCAAACATGTAActattatttt cttattttaggGTCTATTTACATCATACCTACCAGCTATCCAAGAATTCT TAGCTTCACATACGAAATATGATAGAGCTTTCAAGCCTACACCAGGGAAA AGGTATATTGTACTATTCAGTATTTTGATATCTACGTTTTTTAATGGAAG ATGACTGGAATTGATTTACCACACctgttttcatttgtttttatcTACTT TTTGATGTATATTATAACTTTGGAAATTAATAATTTCTCTCCTGACAGGC AGGGataacttcaaattagcctatcatctcGGAATATCAGCTAATTAGCC TAGAATAAGcaaattagcctatttcatacaGGCTAATTAGCccataatga agaaaaattagaCTTTTGAGCCAAATACTAATAGTCGCATCTTTTTTTCA ATAAAAACAAATCTTATATGTTTCAAAGAACATTCTCCActtaaaaatct tttgtgttcAGCTCCCAGAAAAGATGTATTTTAAAAAAACTAGCTGATAG GCTAAATAACTGATaataggctaattttctgatcttataccgtgtgcaaa aaaaaaaaacaataaaaaattttaaaagatttgtcGAAGTTTTTATACTG CGCATGCTCGGCGCATGCGCAgttagaaaaaattgaatatctcctATTCT GGAGCTGATTAAGGGATAAAATTTGGAATATATTTTAATTGAGTGATTAG AGATTAATCTGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGGCTAAT TAGCCtgtatgaaataggctaatttgCTTATTCTAGGCTAATTAGCTGAT ATTCCgagatgataggctaatttgaagttatCCCTGCCTGCCTGAGTCCT TTGAAAAACATCAAAGGTTCTCATGACTTTATTTTCAACAACTCCATGtg actaaagtctattcacgataagtgtgcactcttttttcttttacaaataa cttttgaaggaattcttcaatgtttataaatttggtatcgttagaGAGAT acttgtgagtggaacaatttgaaataagaaagtctttaaaaatgttctaa aaacgaagatgaaaataaagaagaaaaaaaatgaagatcttgtagaaaag tgctatatctttcattttcactggagatattctttgatcttaggagaccT CCTAAgaatcactgtgaagaaatttcactaaaatatttattcaatataaa gttatgatacaaagttaataagtgattgaccccaaagtacagcagaaaac agcgtttttagacgtcaatcagcttataactttgtttgatatcttttgac tgaatgattatttttgagacatttttttcatagtgatgacgttcgatgat taaggattcacCTCAGTGAAAATGacagttatagcacttttctacaagat cttcattttttggacctaccccggtggggtagaggtcctataaattaacc tgtgttcgttcgtccgttcgtctgttaccaatttttctcaggattgaatc ataagAATCCTtagatttttggtacaaaggtgcaaaattgTGGTGggaaa aatgtgacggagcccgaattttcaataaaaaaattggcccaaaaaacggc taaaaaacgggttttttggactttgtgaaaaattgaatcattaatttttt cagattttttgtatgaaagtagggtaccatcataggtaaaagatggctca agaagatttttgcaaaaaaattttgttggctcaaaaaacgcatgtttatc tatatataaataaatcactattaataagcatacatcaatgttcttagtca aattgctcaatttcttttatgagatagatgttttttttgctcatgagggc ttacttttgaagaatatatgtgtttagacatgaaattttggttgcttggc gtgttttaaagaaaaactggccaaattcgatatttttggacctaccccgg tggggttgaggtcctataaattaacccatgttcgttagttagttagctag ttaccagcttttctcgagattggctcattagtttttatgatttttggcac aaaggtgcatgaccataaaccctcaaatgtgacagagcccgattttcgaa aaaaaaatttggggagcaaaattgggccaaaaaacggcttaaaaaagggt tttttggactttgtgaaaaattggatcattaattttttctgatttttagc atgaaagtagggtacaatcatagttaaaagatggctcaagcagatttttg caaaaaaaattttttggctcaaaaattgcatttttatctataagaaccac ttttaataagaatacatcacaagacatcaatgttcttagccatattatta ttattattattatttttattagtttttttttaagatgaaaatgtcgcggt ggagggtaatgatttgagttttctagaaacactttttttttcaatgtcca cgatcaaacatggttcaatcgtcaataaaactgatttttgaagccggaat tTTCTAtaaatcgccggaacaggcgattttcgccggaaaaacggtatttc ttgaatttcttgagctgtactttatatttttttatgaaattttgcacact gatgcaaaatgtcactacctaaattgtgaaggagcctgattttcgaaaaa atttcatttccggccgaaaatgccggaaacatgccggaaaagctgttttt ttggcattttctcgagattttctcattagttttttctgattttttgctca aagatgcgtattaacaatgcccaaaacatggccgagtccgatttttgaga aaaaattttttccggtggaaaatgcctgaaatatgccggaaatcgacgtt tttctagattttcattggacttttcccttttaattggttgttttttcatt caaaaacattattaatagcaatgtccaccatcaagcatgtttcaattttc aataaaattgatttttgaagccggaactaatTTAAAAGTCGcaggaacaa cctattttcgccggaaagacagtatttcttaaatttctcgagctttactt tatatttttttatgaaattttgcacactgatgcaaaaatgtcaataccta aaatgagacggagcctgattttcgaaaaacatttttctccggtcgaaatg ccggaaatatgccggaaaaaccggttttttgacattttctcgaattttca tttttagtattttctgattttttgcagaaagatgcgtattcgcaatgctc aaaacatggccgagttcgatttttgagaaaaagatttttccggttgaaaa tgccggaagtcgccgtttttgcagattttcattggattttttccttaaat ttctatgtttttcacacaaaaacattaatgataacaatgctcaccattta ttttttccctacaacccttccctctccccccatcatcaatcaatgatgaa ttttttgtgttatgcattttcgctaaacgctatgttttctgactgatttt tttcatttttcctcgTATTGCTatttaactttcatcatcaggtaggtcca ttcagcatctagcttgttttataagcacattatcaattaatttaaaagta ttagcttttctcgagattggctcttttattttttatgattttttgtacaa agaagcataactataaaccctcgaatgtgacagagcttgatttttgggaa aaaaattttagggtaaatttcagctaaaaaaacgattttttgcatgaaag tagattaaagatggctcaagctgatttttgtatacaaagaatttttcagc tcaaaaaacgcatgtttatctataagaatcactaataagcatacatcaat gttcttagccaaattacttaattttttgatgagatagatgttttttttgc tcacgaagtcttgaatataaaaaaatatttcaagagcatggaattttggt ttctaaacttttttttataagaaacaaacaactaattttaatagatcgtc actatttgtgttttgaatgattttttaatggtcacgctcacgtagatatc aattatatgtgtgttaaatgcataaccaggtaggtctataaaagtatcac ttgtttttttttctacagagcGTGTTTCAAGTCTTTGCCGAAAGTGTTGT GTTTCAACACGATGCGTTNcattttcatcttcgtttttagaattttttta aagatttttttatttcaaattgttccactcactaatatctttccaatgat accaaatttataaaggttgaagaattccttcaaacgttataggtaaaaga aaaaagagtgcacacttatcgtgaatagactttagtgttaagtaatagtt atcggacagttgcgagtacaatatgagaaatattttacgagttccgagat tctTCCGTacaatatacggaaaatccggaacgagtgaaatatttccatat tgtacgaccaaatgtctgataactggtttatcggtgacccaaaaaatgca ttCTTTGTGTTGGaggcactgacctttatataccctggacaaagcttctc aatcccagccaagcaaaatctttgatcggagttttttgaaaattggtacc ctaatgtcggcactactcgNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNtgcatcgagagcgctaggtctacttttcctcaaattcttttg atgatgtagcggcgttagacgttaatttttaacattgcaatggcttttcc ttgggtaccaattctaaaaaaactccaatcaaagatggcagatattgttt ggtccagggttatataaaggtcagtggttggaggacacttttgtagcaaa gtgacgttagattgcttctagcgctacaatgcaacaacatcttttcgtca atctatatttttacatttaaaatacaagatatattgtactctttttaacc aatcagattgcagatattttttggatcgccgataaagtGTCATATTTTGT CATCGGgtctttctaaaaaataatgTACTCCCTGGTGTGAATATGTATTG TCAGAGGGTAGTAAACAAATGTAATAAAAGTGGGTGTCCAGGGACACGAG GGTTAACTCGTTATCCACAGGTAAAACCTTATCGTCAAGGGAGGAGTTCA AAGTCTCgatcattgagtttgaagccccgaaGGGGCTGGATATGAATCTT cgacctttctcaagcaaaagAAAGGTGAAGCATTAAGTTTGCCCCGgatt tacaaattttgtttgaaaaacacggCATTGTTCTCCAACGTGGAATTCCG GTTCTAGCCCTTtcgggctttgaaatcaatggtctTGATGACCGGGGgtt gaaaatacaattttctGTCATGAAGAACCCATTGAGTTTCGAAGTGTTAT TCACAATCGTCATTTTACAGGCATGTCATTGTTGCCGGATACATCACCGA AGAAAGTGTGACtgggtttttcaaagatttcttgCATCCTGATCGAGAAG ATAGTCAAACCACTGTCGTTATATTGTCACCGTAAGTTACTTATCTTTTA TATCATATAATTTGACGCAAAAGATTTCCAGAATCTAAGGGAAATACAAG CGAAAATCGAGTAAAAAGTTGTAAATATTTTACCCCGACGCAAAATATTA CGAAAATCTAAGAGAAATACTAACataatttgttcaaaaatttgctttaa atattttacagaatttcaaaatttggagaAGTTGCTTTGAGTTAAATTTT GTCTTTTACCCTGATTCATTAACATTTAAACCATCGTTTGGAATAGTTTT ATGTTGGCTTCCATCTTTCATTCTACACAAACTTAGTTGGAGTATTTTAT TGATCAGCTCATCCACGAAAAAGGATACAAAATTACATACATATTACGTA ACCTCGACCCTTACTCCTAACCTTCTAACCcaaatattcttgttttaaat CCTGCAGGAAATATCCGAGTTTGAAGATGCAAGCCGACTTGCAAAGACAT TGTACAAAAGCTTCATATTTTATTGGCACCATCTACAAGTTCATGGACTG CCATCGGACTAGGGTAAGTCTAAACACTTGAAGATgcaataccttatcgg ggaaaacttcgttggggaaaagacacaaaattttggccaagtgacgaata tttttccccgaaaaaaattttccccggccttaatccGTTTGCCAACTACC AGCGagtgacaaatatttttcccggacgaaaattttcccctaCGAAGTTT TCCTCGATAAGGTAGATCATTTCATGATgtgtgtaccgtcaactgctcta acttgggacgatttgtcgaaacatgggactggttgatatctagTCTGTAT TCTCActcactgttaaatctctttgacaacaaatttgttttcgtgtattt tttaatacgccgttcattaagtcaaatcaaatgactttggaggttcggtg aaatggtggctgaattgccgtcccatattttgtcagatagtcccaagtta gagcagttgacagtatttatttatttatttatttatttattaaaggattG AGGTTCAAGGCACGCCGTGGGCCTCTAAGAACCTATCTTTTTACAAATGT TTGTTGTTACAGTTTTCTTTAGGTAAAGTTTTGTTCTGGGGCTTCCCCTG ACTttaaattgaatgtttttgtctttcatttgagcattGAGCTCATGTGC TCTCTTGCACAATTCTTTGATTGCCAATCGTTCAATAATTGTGACGTCTT CTGTTGCTCGATAGAATGAAGGAGAGCCTTTGTATGTCGTGATGGCTCTC AAGACTTtgttcttgtcttcttcattttcaaatactACCTTGATTGGTCG ATACCTCCCTTCCTCCTCTCTCTCTTTCGTGAACACTCCAATCCTCTgtg tgattttaatttttatattttttagcggcaattcttggtcattttcatcg attttttcctCCATTTTCCTTGCCTATTTCCTTCCTATTTGGGAATCACA TTTAGTGACTAATAAATTCAATCAATGAAGCGCGTATTAATGATAATAAA CTTTTCTTGCGGAAGAAAACTGGAGACTTTCCAATAGCTTGGAAATCACC ATACTTCTTGTGTTCTGCTTACTAGACTGTCAACACAAACGCCGGGTGCT TGCACATCAAAGATAATTCTAACAGAAAAAGTAACATTGAAAAGAGGGGC AATTTATATGCTAATTTAAGGACATGCCTTCCTGTAATGTCTCTACTGAC TCTTCTTTATTCACGCTTACAAAAACTGATTAATTGCAAGCGATTTATTG AGTAGAAAAAAGTAGGAAAACTTACAGAAATGCTTTACAGTTGAGTCTGT ATAACTCGAACCCGCACGAGGActacaaatttgttcgagttgaggaaatt tcgagttatggaaaaaGTTTACAAGGCGTTGATAAATGAAAGGGCGAGAA AACCTTTTCGAGTGAAGGAGACATTCgatttatagaggttcgagttaaag agactcttcTGTACTTTATTCATTAGATGCGAGAAGCAGATGCAGTCATT ATTCTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAA CATTACAAGGTAATTCCTTCAATTTGATTGGTTCTTCAAAATAAGTCCTT CAATTTGATTGGTTCTTCAAAGTAAGTCCTTCAATTTGATTGGCACTTCA AAGTAAGTCCTTCAATTTGATTGGCTCTTCAAAGTAAGTCCTTCGATTGG TTCATTTAAGATAACTAAcagtaaatttttcaaatcagtgcactTTATGA TTGAATAAGTCATCAAAGACTATACAAGCAGCACAATGTATTAAAAGGGA GGAttccggttcaaatccgggggggggggNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNACTTTATTCATTAGATGCGAGAAGCAGATGCAGTCATCATTCTT TGTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAACATTAC AAGGTAATTCCTTCAATTTGATTGGTTCTTCAAAATAAGTCCTTTAAATT CATTGGCTCTTCAAAGTAAGTCCTTCAATTTGATTGGTTCTTCAAAGTAA GTGATTCAATTTGATTGGTTCTTCAAATTAAGTCCTTCAATTTGATTGGC TCTTCAAAGTAAGTCCTTTAAATTCATTGGCTCTTCAAAGTAAGTCCTTC GATTGGTTCCGGTTAAAAtccggggggtacttaggctaatggagggtacg gtatgtgacgcccttaaagataacttttttggatttccaaaatcgggggt cggaaaaatcagaaaatcaaatttaagtCCCACTAAGGATttgagaaata ggaaaatttaaactttttactcCCGGTCATTTTGTAGGGTGATTTCAGTG AAGAATTATCACGAGAACATTCGATGTATCGTACAACTCATGATGAACAA AAACAAGGTATGGCTAAAACTTTCACTGGGATCTCTTATATCATTCCTAC ATTGATAACTTTTATTGTCGAAAGGACATAATAACCAAATTCCTTAACAT ATCCTGAAACTTTTATTGATGAATATGTTTGTTAGCGATTcgatgacttt tcatgtatatTACAATGGAGTGAATAAAGCCTAATAAAGGTAGGGTTCTG TTGTTGTTTTCTGACAAGTCTCAGGGATTGGTTTTGGTAATCGTATGCCC ATAATTaggatcttatcggagtttttgatttttctaaaaaagcgatgcat tgcgggattgtttcgggagtacgaaaatagaaatctcttaggaattcctc gaggaaattctattgtaatactcccgaaacaatacCACattgcatcgctt ttttagaaaaatctaaaactccgataaggtctatttggATCTTTATTATA TATGATTTTTTGTTTCAGTCACATTTATTGAATTGTCCACAATGGAATCG GGAACTTGGTGATGACATCATTTGCATTGATGAGGTAAAATAAAAACCTT ACTTCTTAACTCCGTTTGAAACCTCCTTCACTCATATTTcagtatttgac ccaaaatctCGACCTATTGCTCGAATcgttctataattcgaactaaatta TTGGTCCCCTGATCTGGAAAGTGGTTTacattactctctgtaattcgaat ctttctctgattcgaataatttttttgtcctttgaagatcgaattagaga gagtcaacattTCAGTATTTGAACCGAAAACTTATTAGGTCTCAGCTTGC AAAGTCTTTCTTAAGGCTCCTTTTACATGTTTCATcgttttactttgtaa gaaacAGACAACGGGttcatttataagaacagttttataagaacaccagc CTCAGACTTAGGCCCTCAGAACAATAGCTccattgtttagaacaatagaa atttaagaacaatctcaGGCTCAGCCAAAATTTGGTCACAACTCGGACCA AAACAAGCTTCCTTGTCTTAAATAAAAGGAAAGAAAGGGTTTGACCAAAA ACTCACCAGTTAATATTTTCATGAAacacttttttgtttacttttttttc agttGAAACTTGGATTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCA ACGTTGCTGGCAAATCTATTCGCTATGAGGAGCGATACGGTACGTAAAAC ACAATTATAGTATCTTTGTCTAGTTTTTTGGTGCTTCTTGAACCTTGCGG TTAATTTGATTATCTAATTTGCTTCTACAGCCAAAACATTTAAATTCGTG TTGCTCAAAAGCTTATTTTATGTGCATACTGTATACATTTTATGCGTAAG TGTGCATAGatacattttttcattttttgtgctcCCACATTACGAAAAAG ATCAAAACGGTCTGTCAACCTAGACCACTTCTCTTACGACCTTTAGATAA AATACGAGTCTTACGCGGAGTATGGATCTGCTCAGAAATGacatggacgt tgaaacaacgtcgccAGATCAAGATCTTCATCTGTCCGTacattcattta ttttttttctctataaCTTCAACAGATAAGCGAGGAGATTCAAGAATCAG AGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGATGTACACA GCTCAACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAGTAGA GTAAGTCATAGAATTCGTACTTAGTGTATTATTGGTTTTTACCGTGTTCt aggccgggggggggggggtacctaGGCAAGTGAactaaagaaaaactttt tggagCCTGACAGTCCCTGtactatacaccttttcgaccgtagttgcACG GCCatgcgcgtgccactttattatgtaatttaccaccctaaacaaactcg atccaatcctttttttacactatttttctattgtctttagctGCGAAAAT AAGACTAtaggacggttttagggtggtaaaatggacaaaagaaATGCCCT CGCGGCAATTTTGGAGCCTGGCAGTCCCTGTAAGGATTGAAAAAAGCAGA AAATTAAATCTTGTCCCATTAAGGGTTTTTGCCCCTAAAAATATCGAGTT TTGGTTAAATTagtttaatcaattttcacaaaattacCCGCTAAGGATGG GTAGAAAGTGGGGCGGCGAATacctgtcagctcgcaaccccaATACCCCC TCCCTGGGTTCTAGATGGCATCAGGTACTTATTACTGGTTCGCGCGGCCG ATACGTAGGTATACTGCCATAAAGTCTGGTATACACGGAGACGGGCTTAG TGTAAAGTGTCATAGTCGATAGCATTTATGATATTACTTTGTATATTGCG CACCATTCAAAACATTATAAATTTGCTTTTTAgattatgttttgaaaaat tgaatttaatgtTGATTGCCATcgaaatgaaaatctcaaaaaaagagCGA TAGTAAGTACTCTAATGCAATGATTTataacactttttttataagaactt tcaaaatttttgaagccttcggatgttcttaacttttctagatttaagcc taaaattattgttcttaacatgttcttattttcaccattttatggTTATT TCGTCCGTTTTCATAAGAGATtagctgttttagagtccccaaagccttaa aatgttcttaacttgttcttaatattttggccatcgaagccttatgttct tatatagtgtTTTCTTATAGAAACGTGTACTTCTTTTAAAAACTATTTCG AAATATCCTTATATAGTTTGAATATTACCAGTTCTGATAATATGAGTCAC AGACTTCTATAGATACATTTCCTATATAGTATTAAGCATAGCCtcaataa gaaactttttttgctagTGGATGAGCAGAAGCTTATGGTATACCTATGTT TCTGAGACAAGTATTTccttaaaaagattttgataattttttaacacTAC TTGATTCCCATTAATTACTTGACTTTTTATGTTCCAGTCTATATATTACT GTTTTTATGGTCGGGCCAAAAAGAGGACCAAATTTCCCCTGAGAAATCGA AAAGTTCGGCAAACAGGCGCACGAGGATCtcagctctagtttagacggcc cacttttcgccctgtatatttttattatgaATTAAAGTGGGCAAGAGGTT GGCTGTCTAAACAAGGGCTCAATAACATTAACAGTTCACCAGAATTGACT TATGATTATTTTATCTCTTCCCTAGCTTTGCTATCAATCCCAATGACAAG AAGTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGC CAGCGATGTTGCGAAGTAAATACacacttttattttgttcaatcaTATCA TACACAATACGCCTTGGAAGGGGGTCTATCTaacaaatcctgcattacta aaaatagacaaaaaggacgacaaatttcataaagaacgacaaatgtcgcc atccacaaccccaACCGAAAGTGTCTATATACCCCTacgtattcattcct ctttgtttatcacgggaattaactacatatggtttaaagaacgacaaatt actcatgcgtgttacaatggcAGGATTTGCAAGACGAACCTACTGTTGGG AAGATCTGATCATGCTAACCCagatggcacacaacgttggtTGAACGTTT ATCTAACTTTATATGGACGTTAAGGATGTTTGAttaacgtcaaaacaacg ttgtaATCAGCTGGGGACACAGACACATCCCAGCTAGGACACAATGctct ttcaacgtttatctaacattcacaacgtcaataaaacgttagatgaacgt tgaaacaacgttttgtgttctggttgaaacaacgttttgtgtcTTGGTTA AACCTTCATCAACGCacatcaaaaaaattgacttttggaATTTAAGGCTA GCTAGAGGTGATAGTAGAAGCCTTTCTCCAAATCATCATCTTAATATATC TGAAACATTTTAATATTTGTATGTACTCTACTTTTAGAGCATCGAAATAT TGTGCGAAGTGTCACAAAGACCTTCAAGATCCTGAACGAATGGTCAAATG TAAATGCAGACGTATGTTTATCTGATTTCGTTTCTAGTTATTAGATAAAT TAATTCAAGAGTTTCTTATTAGGtgccactcacatatcgatttttTTCAC AACCAACGTCACTCCGACGCTATTTCTAAGACCCCCAACTCCCTACCCTT AACGTCAGCCACcaaaaatcgataaaatcaaTGACAAAACTATGCTTCCC CACCCCCTCGTGTTATTGTAACGTTATTTGCGGGAAACATCCATCTGCGA GTGGCCCCTTACAATTTTACAAATAGCTTCCAACGCAAGATACAAAAATT TAGAAGAAACACTTGCATTCATTCAATACCTAAGTCTGTCTTTGAAAGCT CTTTTATTTCAGTTGATTAAGTTTCTTAAGGACTAGGTGATGGCCGAGGG atgtcttttgaaatttttcaaacatttataAGTTCTTAGTCAGGGCTTGT GTCACTCATTGTTAGGCATATGATTTTACTGcaaaatttttgtccaaaaa aaacaaaccacgTTTCTCAACTTTTCCCaaacaaccaatcaaattttacc ATGTTTCTTTACTATCCAATCACACTTTAACTTTTCCCAATCAGCCAATc acatttcaatattttccaaATCAACCAATCATATTCCTTTAACTTTTCTC AATCGACCAATCACATTTCAGGACGTATGAAACAAGAACAGGAAAAGAAG AATCCAGCTCAGAAAGGAAAATACGAAACAAAAGTCGATGTTGATCCAGT GCATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGGAGTAAGTTTTCT ATACTAAAGTCTCTTATCTTCGTCCGGTTAAGTAATGCTAAGAAAAACTT AACACAGAATGAAACCTAAGCTAAGGAGGAGTAAGTTTTCCATATAAGCA TCTCATCTCTTCTTCAGTTGGTAAAGCGAGGCTaaggaaaatttgacaaa aaagaacCTTTTTTATGACTTCGGGCTAGTGAGATGAAAAttcagttgac tctctctaattcgatcatTAAGGGATTATGAcctttcttcgaattagaga tagATTCGAATCATACAGAGCAGAGCATTTAACACTACTTTCCGCCTGAA GGCACAAGTGATTTAGTTCGAAATAcagagttcgaattagagaggatCGA CTGTATAAAGTGCACTCCCTTAAAGCTGAACCAAGTGAATGAAGAAAGGA GTAAGTTATCAGTAGAAAGTCACATATTTCTGTTTGCTAAAACGATATAG AGAATAGAGAAACTGTGTCAAAATTCGtttaaaaattcctttttaaattt gttttatttccaGTAAACAATCATTGACGGGAGACTATTTTGCAAGTGGT GAAAAACCAAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAG AAGCTACATATCTGCCAGGAtggtatgaaatttttttcaaagatatttgG GTTTTATACTTGGAATGGACCTTCATCTCCCCTTCACCTTCTCTCTTTCT TACCTCGCATCATCCTCCAAAAAtttaaatacagttgacgctctctaatt cgatcttcaaggggaattgaatcttcatcgaataagggagcttatcgaat atgggagcgtcgtttatgagagtttcttgttgacggggactttaagtttc atcgaataagggagcctatcgaatagtagaacgtcgaattagagagcgtc aactgtaataatATTTCTCCGAAAAACAATGTCTTGTAAAAAAGTTGTTT CGAATTGCATTTCCGTCCAACAAGTATATTATATATGGGGCTTGTATCTT TATTAGTTCACCAAATAAATGAACGAGGACAAATAAtgataatattttca ctttctcCTTTCTCCAGAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAG AACCATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTGG TTTAAGACAACTTGTAAGTTCGATCCCGATACGTTATACAGAACTCTCCG AAGCTGAAACCTTTATGAATAAATTTCTTCATCAGCTTACCAACGACAAC TCTCCTCACCGAGTTCATGATATAGTTAAGCCAGGACTCATTCATCCGTT CATAAGTTTTCTTATTAGGtctctgctcatcctctagcgaaaataGTTTC TTATAGacctatataggaagtatatctatagaggtctgtaATTCAGACta aattttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgtt cgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcg ttctcTCTACTTTCCCTTTTCGTTCTGCAGGTACTTCCATTGCGTGCAAG CAATCGTCTGCCGCACGATGTCAAAAAAGTTGTCATTCTTGGAGATGGAG ATTTCTTAGCTCGCGAGGTAACATTGGTATTTCTATGAGAGAAGAACCCT ACAGTAACCATATTATTAGCCTAAAATATGATCGGATTGTTGAAACATTA ACACTTCTTTGTGCGTTTACGAAATGGCATTTGAAATATGTTTCGAAAGa aagattgttttattttgaatttttgttgtgttttgtaATGATATTTAGTT TAGAAATTGTATGATAAGAAATAtccaattttttacttttagtgGCCGAC GCTGGCGAATTTCCCTGATGTTGACATCGTACCTGTAAGTACCtagattt tgaaatataattgaAGTTGAAGGATTGCCCTCTgcataataaaaacaaaa gaaaactaaaaCGGGAAAGGCGTTTTTTAATTAGTATTGTAGTTGTAGCC TCAGTCCTGGGGCCcaataaaaaatattctttaacgTGCATAATATACAT CTTCAAAATATTCATGGTTTAAATCAGTATTCTTCTggctatttctaaaa aatctgagTTTAGATTATCTTTTCTTAGCTTTTGAAATCTAATCCTTTTC TGCgagaaattttttgagttttgatgagtctagtttatattttcttttag tttttaaAATCTTATCCCGTTTCCAATTCCAGGGTTCGCCTTACAACCGT TCCGATTTACGGGCAGTCAATGTGAATACAGCGGACATGTGTATTTTGTT ATCACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTGATA AAGAAGTCATCCTGGTTACTTTGAATTTGAaaggtaaaattatttttcaa tcaaCTGACATACACCCAAGTCGATATGTCTCAGGCGACcttagcgaccg tagtgcagtggtagatcATCCgactacggtgcgcaaggttgtggatTCGA TTATCAGCCGGGGCGTACttagtacttgatgcctctgTGCTTGATACTCA GCAATTAAGATAAAGATCAAGGGTGAggggagcaatccagggagaaggAG TGGTGCCCtctcctaccttcgggtagatagctatagAAAGTATACTTCTT AAGGTGGGTACGGTAAACATTGGGTCAGTAGAAACTGTGGCGAGGTTTTT CGGATTTgggttaagggctctgaccatcgtgaatttttcataattgccat gtttaaaatgtgttttctgactgatgtaaccaacaaaactatggcatgtt atacattttctgttagacaaactattcctgaatctgaaaatttaaaaatt gcattgaaaaattttgacgaagaagaaagtgaatacttttgcgaggaaga gtatttcaactttgaagagcttagtttcggcgaagaaaaaacattttgaa aaatttttcgcagtagatggtgtatctttNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgttt ttcatcaatttttcatctggattttgcttaaaaaaacagtcataactttt gacacatcgttttagaaaaattttccgcaaaatttaaaatagttcattTC CTTGcagacagtgtaaagaaattttgaaacaaaaaagttaattacccatt aaaacttagcactttttgtaaaagagggtgatgcaacatattattaacat cNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNaatttataaaggcaattctttgttaaaagtgttaag gaacctgaaatataacttttatgttcaaataccaaaatcaatttttggac tatggccagagcccttaaggaaaagtatttctttttagacACAATTTTCA ACCAAAGTATACCAGATTACTTCTCAAGATGCATATTAACTAAATGTTAT CATCAAGTTTTGGCTTTTTATCACTTAAATTATTgactattttgaaaaat attgtcttGTTTTTTATCATTCAGCCATGACTTTTGACGAATCAGAACTA GCAGTCACGGAGGAGATCAAGAAAGTCGATTCGTCACGAGGAACTTCTAT CAACGGTGAAAGTTCTGCCGATGTACGGGTGGGATTCTCATCGGGCGCCA ATTCAAGGGCGGCCACCCGTATGACTGGACGCCCTGAAACTTCAATGTCT CACATGACAGCGGGCGGTAATAGTATGATACAAGAAGTCAAGAAAACGTT TAAAGGAGCTTTGAATGGAGCTAACATCCCTATGATCACTGAACTTGGTA AGTAGAAATTACTTTAAATTTAGCCCAGGCTAAACCCAGGCTTTAGTTCC CATCCCCTTAGCTCAATTTTGCATTcttctgatagcgctcacgaaAGGTG TGCCATGCTATATAAGAGAAGTAATTTTGGCAAATGAGCCTATTCgccaa ttttggtgcaatttggcggaatttattttggcgatttagtaaaatttcta aatttggcgagaattaattttggcgaatgacccatttttgttcaatattt tagctgaagaaagaggaaaaaagggtttttaggagaaatagagactaaAT TGAAAGAATAATTAAATATGGCGAGAATCaatttggcgaatgacctataa atttaaatttgatggcggaaaaaaaattctttccgccaaaatttcttccc tttaaaGTAGGTATAAGCTCACGATTGTATTACGTCCATTAGTAAAATCA AAACGTGGTTTAAGTgactctgggtacgagattgaatTTACCCTAGAAAT CTTTAATACTACTTTGAGTCAGCtactaggataaatctgatgacAAGTGG TGATTGGAATAACAGTAACAGTATTCAAAGGCAAACTTACAACcctaaaa tctttaaagcgattcaaaacgctatattgccgtAAGCCGTATGTCTCAGC GTTGTGATGAATACGGGCTTATTTAACTAGGCTACTCTGAATTGACTTAA AATCACTAACGTAAAGAAAAGCCACGGGCCCAGTTGTTGAAAAATAGTTT ATTGgttaaaaatagttttgaaaaggCTTTGTTATTTGATAAGCAAAGTG ATTCTGGGATTTCATTGCCTGCAAGCATCCTCTAAGAGATTATACTACCT GTGACTTTCCCAGACAcgcaacgttttttcaacgttgcttcaacgttcat ttaacgttatatggacgttgtgaacattagaaaaatgttgaaacgacgtt gtgtgccagctgggttgacTCAATCTTGGGTTTTCAACATATTACTCTAA ACTTATACTCCCAGGTAGCTAATCAACGGGCGGGGGCTAATTTCCGGGGC GGAAATTACACTCTTAATACTAGACTGGAGTTGTTTATAGTTATGtaata atacgattattgttacggtaTTATACTCCCAGGTAGCTAATCAACGGGCG GGGGCTAATTTCCGGGGCGGAAATTACACTCTTAATACTAGACTGGAGTT GTTTATAGTTATGtaataatacgattattgttacggtaTTATACTCCCAG GTAGCTAATCAACGGGCGGGGGCTAATTTCCGGGGCGGAAATTACACTCT TAATACTAGACTGGAGTTGTTTATAGTTATGtaataatacgattattgtt acgggatttagtttgtatagaattgttccctccattacttttagctttat ttctactatgtctgagaTAATCTTAATACCCCCCAAAAAGGCAATTACAG ACTAAAACCAGTCTTATTTggatcaaaaaaggaaaaagggtCAAAAGTTT TAAACGACTAAGAATAATGGATCTCtaaatcatttttttccttcAGTATG TGATTCGAATGCGATGTACATTGATCAAGATGATATGAACATCTATGATG ATGATGGAATCTTTTTAACGCAACCGTACGCTTGCGGCTCCGCTTTCACC GTATCGGTTCTCGATTCACTCGTCAGTGCGGTAAGTATTTGTTTAAAAAG CTGTCAGCCGCATAGGATAAATTCTATCAATTCCAATTCCTAACTTTGAA AATGCAAACATCTGTCATCCTTTAAAACATAAGCGAACTGGGCTAGAATT TACCAAGAAAAACTCTTaggcatggcgttctaaatctgaTCTTAGTTCAA ATTGTCGGAGGGTCGTTGCATTCGATCTTATCATAGACAATGAATTTTAA CGTAattttccttgtaaattcattatCAGTACCCTCAGAAGCCGACTGTG CAGTTTAAGGGTTGAAAGGTGTATTTTTCACACTCTAAACAAGTTCGTTT ACTTAGTTAACAATCATGTGGTTCAAAGCTTCGAATGTATATCAAATTCT AATTAAAATGACTCTCATCATGTGTGAAGTTGTTTGTAGGGGCGTTGTAa tcctttgaaattttgaacctttgcttgaaaacaatagaaaaaagtgtgaa aagtccctgaaaagttccatttttcgagatttcaaattggcataacttga gttaagaaaataaatacaccgaaaaatttagaggtttttcctaaaatcct agaagctatctgcatggaaaatatctcagaccatctgattatccctttaa ctaCTGTATTCAGCTTACTGAAGATTAAAGGATTGTTTAGTATgatcaaa atgaaaagaaagagcATATAAAAGTGCTAAGCATATAAGTAAGTTTTATG TAGGTATATTTAAGAGGTATTAAAATTAAGAATGTATtatgttggacggt gaaaaagaatgcggctattatattttgatttttataattatgAATGTATT ATAATTCATAGTGGATTTCAAGAAGCACAAATTGACTCTTCGACCATCTT TAACCTTGGTTTTCCCTTTTTTCATCAGACATATTTCAACAGTGACGTAT TAACACTTGTCCGTAATCTGGTCACCGGTTCTGTGAGTCCGGAACTGGAC GAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGTACGAAACACAAGA GATTGCCGCTGTCAGGAACAGATGTCGGGTGGCACAAATTTCTTTGTTTG AAGGGCCTTTATCTGAATATGGGGTGAGTATTTAAATTATTATACAGTCA TTTCTCTCTAATCcgaacctctactattcgaatctttctataattcgaac aaaaatatttttcccttcAGTTAGAAATTATTTATGAAATACTTTCTGTG ATTCGATgaaaattcttggtcccttatgaagatcgaattagagaaagccA ACTATGTTGAAGTATTAGTATgtttcacccctgtctcagtgactcaCTGA GAATTTAAGGCCAGCAAGGATAAATGAAAGGAATAAATACCAATGAGTAT GGAAAATCAGTTCTTTAAATGAGTGAGGGTTTCGAATTCATCTTTATTTA CAGCCGATTTTCCGAGGTGGATGAAGGGGTTCCAACTAGGTCTGTGATTT GAGGTGTTAAGATAGTCAAAGACTTTCAGACAATTAAAGAAAAGAGACCT TtctttcaattccaaaaaaattgttaaTTGTGTTAATTTATGATATTCAA TGTCTTccttgcaatgtcttctggcaTTAAATCACGGACcgaacagctga ttggttgtaagtgacgtaaaatcagtcaatacgtaaCTTGAAGCCAGTCA GCTGTTGGGTTCGtgaaagacattgcaatggtgcatatcatgaattgtgt CAGTGTTTGGTATGCTGACAGTGAATACAAGGTGCTTCTAAGTCAAATta ggctattccaaaaaaaatttgtaccccctatgttgaagAGGTCATTTTCG GGAAAGGTGACAGCCTGGATTTTATTTCACATTTTCAAGACCCCCCTAGC TgatcttttctcattttttagactACCCTGGATTTATCTCCTCGACATAT AGTTCTAGAGTCCCACAGTCAGACTTGGATCCCTCTGGATTTTTGGATTC ATTTTACTGACTACCCTGGATTTCTTATTTTCCataccaccctggacgtc acaccgccttaacatagggggtacagactatttctggaatagcccaatct tTGGAAACTCAAATTTCTCTTGATTCGTATTAGTCATGAATATGATAAAT ACACAGTTTACCATTTTTTCATTACTAGGAATGTGGTTTATTCGGTGATC TATTTTTGTACGCTCTCCGTACGTACAACATGATCTGTNTGTGGTTTATT CGGTGATCTATTTTTGTACGCTCTTCGTACGTACAACATGATCTGTTTGG GTCTCTACCGATTCCGAGATTCGCAACGTATGAAGGACAAAATACCAAGC ACGAAACGTTACGTCATCACGTTCCCGCCctttaattttgttttggatCC AACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAACGTAAAA GGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCGct ttttaactttgttttttgaTAGCATTGACTTGTAGGTTTTtatatctttt gttttttttaatctttttaaaacccTAATCACGTACTTCTATTACTTTTC AATTGTCTTGTTAAGATTTACAAATTATACCTAAAATTCTATGATCCAGG GGTCTTATATAGACCCAGCGAACGGCGAC

Coding sequence (CDS) from alignment at sc0000001:38516..84744+

>TCONS_00000002 ID=TCONS_00000002|Name=TCONS_00000002|organism=Clytia hemisphaerica|type=CDS|length=103974bp|location=Sequence derived from alignment at sc0000001:38516..84744+ (Clytia hemisphaerica)
ATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCAGATGAACG
GAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCCGgtt
taattttaattatcatcGGACGTATTTTGTTATATTTCTTCCATGGCGCT
AAAAGAAGATCGAATAGTGTGATTGATATGAATGAGGTGGACGAATTGGA
GGAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGATGGTATTTAGATT
TGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACATTACAAGGACGT
ATATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGAATGCGCACTCTA
TATCACAGAAACAGGATATCCAATCGAGCATTGTTTGGATTTGTCCGATC
AAACATTATGGAGAGTTGAAATTTGTTTGAAcgctttcttcatttttcat
tttctcattcGGTTCATTGCGGCGAACGACAAATTATCTTTTTGGGCAAT
GGAACCTTTAACGTACGTTGATATTGTGACTGTACCAGCCGTCTTTGTGG
CTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTACGTGTCATC
TATTTGATCAACTTGGCAGATATCCTACAATTTCTCAACGTACTCCACAC
AGGTTCAAGTCTTGAGATGGCACAGATGATTGGTAATTTCTTGGCTTTGA
CTCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAACACTGGTGATCCA
TGGGAGCCTATCAACTACACCAACAAACAGAAATTGAATTACTTCGAATG
TCTCTATTTTCTATTCGTAACCATGTCAACGGTTGGTTATGGTGATATAT
ATTGTCATACGTATCTTGGAAGGTTGTTTAATATTGGTTTCATCTCTGTT
GGCCTGgGTCTATTTACATCATACCTACCAGCTATCCAAGAATTCTTAGC
TTCACATACGAAATATGATAGAGCTTTCAAGCCTACACCAGGGAAAAGGC
ATGTCATTGTTGCCGGATACATCACCGAAGAAAGTGTGACtgggtttttc
aaagatttcttgCATCCTGATCGAGAAGATAGTCAAACCACTGTCGTTAT
ATTGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCGACTTGCAAAGAC
ATTGTACAAAAGCTTCATATTTTATTGGCACCATCTACAAGTTCATGGAC
TGCCATCGGACTAGGATGCGAGAAGCAGATGCAGTCATTATTCTTTGTAA
CAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAACATTACAAGGG
TGATTTCAGTGAAGAATTATCACGAGAACATTCGATGTATCGTACAACTC
ATGATGAACAAAAACAAGTCACATTTATTGAATTGTCCACAATGGAATCG
GGAACTTGGTGATGACATCATTTGCATTGATGAGttGAAACTTGGATTCG
TGGCACAAAGTTGTAATGCACCTGGATTCTCAACGTTGCTGGCAAATCTA
TTCGCTATGAGGAGCGATACGATAAGCGAGGAGATTCAAGAATCAGAGAA
ATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGATGTACACAGCTC
AACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAGTAGAatta
tgttttgaaaaattgaatttaatgtTGATTGCCATcgaaatgaaaatctc
aaaaaaagagCGATACTTTGCTATCAATCCCAATGACAAGAAGTTGAGAC
TTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCAGCGATGTT
GCGAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGACCTTCAAGATCC
TGAACGAATGGTCAAATGTAAATGCAGACGACGTATGAAACAAGAACAGG
AAAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACAAAAGTCGATGTT
GATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGGATAA
ACAATCATTGACGGGAGACTATTTTGCAAGTGGTGAAAAACCAAAGTTTG
ACCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGCTACATATCTGCC
AGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAACCATGTTGT
TGTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTGGTTTAAGACAAC
TTGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCACGATGTCAAAAAA
GTTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgGCCGACGCT
GGCGAATTTCCCTGATGTTGACATCGTACCTGGTTCGCCTTACAACCGTT
CCGATTTACGGGCAGTCAATGTGAATACAGCGGACATGTGTATTTTGTTA
TCACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTGATAA
AGAAGTCATCCTGGTTACTTTGAATTTGAaagCCATGACTTTTGACGAAT
CAGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGATTCGTCACGAGGA
ACTTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGTGGGATTCTCATC
GGGCGCCAATTCAAGGGCGGCCACCCGTATGACTGGACGCCCTGAAACTT
CAATGTCTCACATGACAGCGGGCGGTAATAGTATGATACAAGAAGTCAAG
AAAACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCCTATGATCACTGA
ACTTGTATGTGATTCGAATGCGATGTACATTGATCAAGATGATATGAACA
TCTATGATGATGATGGAATCTTTTTAACGCAACCGTACGCTTGCGGCTCC
GCTTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGCGACATATTTCAA
CAGTGACGTATTAACACTTGTCCGTAATCTGGTCACCGGTTCTGTGAGTC
CGGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGTAC
GAAACACAAGAGATTGCCGCTGTCAGGAACAGATGTCGGGTGGCACAAAT
TTCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAATGTGGTTTATTCG
GTGATCTATTTTTGTACGCTCTCCGTACGTACAACATGATCTGTTTGGGT
CTCTACCGATTCCGAGATTCGCAACGTATGAAGGACAAAATACCAAGCAC
GAAACGTTACGTCATCACGTTCCCGCCctttaattttgttttggatCCAA
CTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAACGTAAAAGG
AAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCGcttt
ttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCAGATG
AACGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCC
GgtttaattttaattatcatcGGACGTATTTTGTTATATTTCTTCCATGG
CGCTAAAAGAAGATCGAATAGTGTGATTGATATGAATGAGGTGGACGAAT
TGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGATGGTATTTA
GATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACATTACAAGG
ACGTATATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGAATGCGCAC
TCTATATCACAGAAACAGGATATCCAATCGAGCATTGTTTGGATTTGTCC
GATCAAACATTATGGAGAGTTGAAATTTGTTTGAAcgctttcttcatttt
tcattttctcattcGGTTCATTGCGGCGAACGACAAATTATCTTTTTGGG
CAATGGAACCTTTAACGTACGTTGATATTGTGACTGTACCAGCCGTCTTT
GTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTACGTGT
CATCTATTTGATCAACTTGGCAGATATCCTACAATTTCTCAACGTACTCC
ACACAGGTTCAAGTCTTGAGATGGCACAGATGATTGGTAATTTCTTGGCT
TTGACTCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAACACTGGTGA
TCCATGGGAGCCTATCAACTACACCAACAAACAGAAATTGAATTACTTCG
AATGTCTCTATTTTCTATTCGTAACCATGTCAACGGTTGGTTATGGTGAT
ATATATTGTCATACGTATCTTGGAAGGTTGTTTAATATTGGTTTCATCTC
TGTTGGCCTGgGTCTATTTACATCATACCTACCAGCTATCCAAGAATTCT
TAGCTTCACATACGAAATATGATAGAGCTTTCAAGCCTACACCAGGGAAA
AGGCATGTCATTGTTGCCGGATACATCACCGAAGAAAGTGTGACtgggtt
tttcaaagatttcttgCATCCTGATCGAGAAGATAGTCAAACCACTGTCG
TTATATTGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCGACTTGCAA
AGACATTGTACAAAAGCTTCATATTTTATTGGCACCATCTACAAGTTCAT
GGACTGCCATCGGACTAGGATGCGAGAAGCAGATGCAGTCATTATTCTTT
GTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAACATTACA
AGGGTGATTTCAGTGAAGAATTATCACGAGAACATTCGATGTATCGTACA
ACTCATGATGAACAAAAACAAGTCACATTTATTGAATTGTCCACAATGGA
ATCGGGAACTTGGTGATGACATCATTTGCATTGATGAGttGAAACTTGGA
TTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCAACGTTGCTGGCAAA
TCTATTCGCTATGAGGAGCGATACGATAAGCGAGGAGATTCAAGAATCAG
AGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGATGTACACA
GCTCAACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAGTAGA
attatgttttgaaaaattgaatttaatgtTGATTGCCATcgaaatgaaaa
tctcaaaaaaagagCGATACTTTGCTATCAATCCCAATGACAAGAAGTTG
AGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCAGCGA
TGTTGCGAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGACCTTCAAG
ATCCTGAACGAATGGTCAAATGTAAATGCAGACGACGTATGAAACAAGAA
CAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACAAAAGTCGA
TGTTGATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGG
ATAAACAATCATTGACGGGAGACTATTTTGCAAGTGGTGAAAAACCAAAG
TTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGCTACATATC
TGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAACCATG
TTGTTGTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTGGTTTAAGA
CAACTTGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCACGATGTCAA
AAAAGTTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgGCCGA
CGCTGGCGAATTTCCCTGATGTTGACATCGTACCTGGTTCGCCTTACAAC
CGTTCCGATTTACGGGCAGTCAATGTGAATACAGCGGACATGTGTATTTT
GTTATCACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTG
ATAAAGAAGTCATCCTGGTTACTTTGAATTTGAaagCCATGACTTTTGAC
GAATCAGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGATTCGTCACG
AGGAACTTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGTGGGATTCT
CATCGGGCGCCAATTCAAGGGCGGCCACCCGTATGACTGGACGCCCTGAA
ACTTCAATGTCTCACATGACAGCGGGCGGTAATAGTATGATACAAGAAGT
CAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCCTATGATCA
CTGAACTTGTATGTGATTCGAATGCGATGTACATTGATCAAGATGATATG
AACATCTATGATGATGATGGAATCTTTTTAACGCAACCGTACGCTTGCGG
CTCCGCTTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGCGACATATT
TCAACAGTGACGTATTAACACTTGTCCGTAATCTGGTCACCGGTTCTGTG
AGTCCGGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTC
GTACGAAACACAAGAGATTGCCGCTGTCAGGAACAGATGTCGGGTGGCAC
AAATTTCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAATGTGGTTTA
TTCGGTGATCTATTTTTGTACGCTCTCCGTACGTACAACATGATCTGTTT
GGGTCTCTACCGATTCCGAGATTCGCAACGTATGAAGGACAAAATACCAA
GCACGAAACGTTACGTCATCACGTTCCCGCCctttaattttgttttggat
CCAACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAACGTAA
AAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCG
ctttttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCA
GATGAACGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAG
TTCCGgtttaattttaattatcatcGGACGTATTTTGTTATATTTCTTCC
ATGGCGCTAAAAGAAGATCGAATAGTGTGATTGATATGAATGAGGTGGAC
GAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGATGGTA
TTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACATTAC
AAGGACGTATATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGAATGC
GCACTCTATATCACAGAAACAGGATATCCAATCGAGCATTGTTTGGATTT
GTCCGATCAAACATTATGGAGAGTTGAAATTTGTTTGAAcgctttcttca
tttttcattttctcattcGGTTCATTGCGGCGAACGACAAATTATCTTTT
TGGGCAATGGAACCTTTAACGTACGTTGATATTGTGACTGTACCAGCCGT
CTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTAC
GTGTCATCTATTTGATCAACTTGGCAGATATCCTACAATTTCTCAACGTA
CTCCACACAGGTTCAAGTCTTGAGATGGCACAGATGATTGGTAATTTCTT
GGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAACACTG
GTGATCCATGGGAGCCTATCAACTACACCAACAAACAGAAATTGAATTAC
TTCGAATGTCTCTATTTTCTATTCGTAACCATGTCAACGGTTGGTTATGG
TGATATATATTGTCATACGTATCTTGGAAGGTTGTTTAATATTGGTTTCA
TCTCTGTTGGCCTGgGTCTATTTACATCATACCTACCAGCTATCCAAGAA
TTCTTAGCTTCACATACGAAATATGATAGAGCTTTCAAGCCTACACCAGG
GAAAAGGCATGTCATTGTTGCCGGATACATCACCGAAGAAAGTGTGACtg
ggtttttcaaagatttcttgCATCCTGATCGAGAAGATAGTCAAACCACT
GTCGTTATATTGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCGACTT
GCAAAGACATTGTACAAAAGCTTCATATTTTATTGGCACCATCTACAAGT
TCATGGACTGCCATCGGACTAGGATGCGAGAAGCAGATGCAGTCATTATT
CTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAACAT
TACAAGGGTGATTTCAGTGAAGAATTATCACGAGAACATTCGATGTATCG
TACAACTCATGATGAACAAAAACAAGTCACATTTATTGAATTGTCCACAA
TGGAATCGGGAACTTGGTGATGACATCATTTGCATTGATGAGttGAAACT
TGGATTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCAACGTTGCTGG
CAAATCTATTCGCTATGAGGAGCGATACGATAAGCGAGGAGATTCAAGAA
TCAGAGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGATGTA
CACAGCTCAACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAG
TAGAattatgttttgaaaaattgaatttaatgtTGATTGCCATcgaaatg
aaaatctcaaaaaaagagCGATACTTTGCTATCAATCCCAATGACAAGAA
GTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCA
GCGATGTTGCGAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGACCTT
CAAGATCCTGAACGAATGGTCAAATGTAAATGCAGACGACGTATGAAACA
AGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACAAAAG
TCGATGTTGATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGCTAAA
AAGGATAAACAATCATTGACGGGAGACTATTTTGCAAGTGGTGAAAAACC
AAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGCTACA
TATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAAC
CATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTGGTTT
AAGACAACTTGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCACGATG
TCAAAAAAGTTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgG
CCGACGCTGGCGAATTTCCCTGATGTTGACATCGTACCTGGTTCGCCTTA
CAACCGTTCCGATTTACGGGCAGTCAATGTGAATACAGCGGACATGTGTA
TTTTGTTATCACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTC
TCTGATAAAGAAGTCATCCTGGTTACTTTGAATTTGAaagCCATGACTTT
TGACGAATCAGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGATTCGT
CACGAGGAACTTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGTGGGA
TTCTCATCGGGCGCCAATTCAAGGGCGGCCACCCGTATGACTGGACGCCC
TGAAACTTCAATGTCTCACATGACAGCGGGCGGTAATAGTATGATACAAG
AAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCCTATG
ATCACTGAACTTGTATGTGATTCGAATGCGATGTACATTGATCAAGATGA
TATGAACATCTATGATGATGATGGAATCTTTTTAACGCAACCGTACGCTT
GCGGCTCCGCTTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGCGACA
TATTTCAACAGTGACGTATTAACACTTGTCCGTAATCTGGTCACCGGTTC
TGTGAGTCCGGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCG
GTTCGTACGAAACACAAGAGATTGCCGCTGTCAGGAACAGATGTCGGGTG
GCACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAATGTGG
TTTATTCGGTGATCTATTTTTGTACGCTCTCCGTACGTACAACATGATCT
GTTTGGGTCTCTACCGATTCCGAGATTCGCAACGTATGAAGGACAAAATA
CCAAGCACGAAACGTTACGTCATCACGTTCCCGCCctttaattttgtttt
ggatCCAACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAAC
GTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCA
GGCGctttttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCC
GGCAGATGAACGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCT
TTAGTTCCGgtttaattttaattatcatcGGACGTATTTTGTTATATTTC
TTCCATGGCGCTAAAAGAAGATCGAATAGTGTGATTGATATGAATGAGGT
GGACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGAT
GGTATTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACA
TTACAAGGACGTATATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGA
ATGCGCACTCTATATCACAGAAACAGGATATCCAATCGAGCATTGTTTGG
ATTTGTCCGATCAAACATTATGGAGAGTTGAAATTTGTTTGAAcgctttc
ttcatttttcattttctcattcGGTTCATTGCGGCGAACGACAAATTATC
TTTTTGGGCAATGGAACCTTTAACGTACGTTGATATTGTGACTGTACCAG
CCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTT
CTACGTGTCATCTATTTGATCAACTTGGCAGATATCCTACAATTTCTCAA
CGTACTCCACACAGGTTCAAGTCTTGAGATGGCACAGATGATTGGTAATT
TCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAAC
ACTGGTGATCCATGGGAGCCTATCAACTACACCAACAAACAGAAATTGAA
TTACTTCGAATGTCTCTATTTTCTATTCGTAACCATGTCAACGGTTGGTT
ATGGTGATATATATTGTCATACGTATCTTGGAAGGTTGTTTAATATTGGT
TTCATCTCTGTTGGCCTGgGTCTATTTACATCATACCTACCAGCTATCCA
AGAATTCTTAGCTTCACATACGAAATATGATAGAGCTTTCAAGCCTACAC
CAGGGAAAAGGCATGTCATTGTTGCCGGATACATCACCGAAGAAAGTGTG
ACtgggtttttcaaagatttcttgCATCCTGATCGAGAAGATAGTCAAAC
CACTGTCGTTATATTGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCG
ACTTGCAAAGACATTGTACAAAAGCTTCATATTTTATTGGCACCATCTAC
AAGTTCATGGACTGCCATCGGACTAGGATGCGAGAAGCAGATGCAGTCAT
TATTCTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTA
ACATTACAAGGGTGATTTCAGTGAAGAATTATCACGAGAACATTCGATGT
ATCGTACAACTCATGATGAACAAAAACAAGTCACATTTATTGAATTGTCC
ACAATGGAATCGGGAACTTGGTGATGACATCATTTGCATTGATGAGttGA
AACTTGGATTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCAACGTTG
CTGGCAAATCTATTCGCTATGAGGAGCGATACGATAAGCGAGGAGATTCA
AGAATCAGAGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGA
TGTACACAGCTCAACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAA
GCAGTAGAattatgttttgaaaaattgaatttaatgtTGATTGCCATcga
aatgaaaatctcaaaaaaagagCGATACTTTGCTATCAATCCCAATGACA
AGAAGTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGAC
GCCAGCGATGTTGCGAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGA
CCTTCAAGATCCTGAACGAATGGTCAAATGTAAATGCAGACGACGTATGA
AACAAGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACA
AAAGTCGATGTTGATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGC
TAAAAAGGATAAACAATCATTGACGGGAGACTATTTTGCAAGTGGTGAAA
AACCAAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGC
TACATATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAA
GAACCATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTG
GTTTAAGACAACTTGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCAC
GATGTCAAAAAAGTTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGA
GtgGCCGACGCTGGCGAATTTCCCTGATGTTGACATCGTACCTGGTTCGC
CTTACAACCGTTCCGATTTACGGGCAGTCAATGTGAATACAGCGGACATG
TGTATTTTGTTATCACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGC
TCTCTCTGATAAAGAAGTCATCCTGGTTACTTTGAATTTGAaagCCATGA
CTTTTGACGAATCAGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGAT
TCGTCACGAGGAACTTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGT
GGGATTCTCATCGGGCGCCAATTCAAGGGCGGCCACCCGTATGACTGGAC
GCCCTGAAACTTCAATGTCTCACATGACAGCGGGCGGTAATAGTATGATA
CAAGAAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCC
TATGATCACTGAACTTGTATGTGATTCGAATGCGATGTACATTGATCAAG
ATGATATGAACATCTATGATGATGATGGAATCTTTTTAACGCAACCGTAC
GCTTGCGGCTCCGCTTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGC
GACATATTTCAACAGTGACGTATTAACACTTGTCCGTAATCTGGTCACCG
GTTCTGTGAGTCCGGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCG
TCCGGTTCGTACGAAACACAAGAGATTGCCGCTGTCAGGAACAGATGTCG
GGTGGCACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAAT
GTGGTTTATTCGGTGATCTATTTTTGTACGCTCTCCGTACGTACAACATG
ATCTGTTTGGGTCTCTACCGATTCCGAGATTCGCAACGTATGAAGGACAA
AATACCAAGCACGAAACGTTACGTCATCACGTTCCCGCCctttaattttg
ttttggatCCAACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCG
AAACGTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATT
TTCAGGCGctttttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGA
TCCCGGCAGATGAACGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTA
ATCTTTAGTTCCGgtttaattttaattatcatcGGACGTATTTTGTTATA
TTTCTTCCATGGCGCTAAAAGAAGATCGAATAGTGTGATTGATATGAATG
AGGTGGACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGAACAA
GGATGGTATTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCA
AACATTACAAGGACGTATATTGGTTGTTTTGTCGTTTGTATTCAACTTGG
CAGAATGCGCACTCTATATCACAGAAACAGGATATCCAATCGAGCATTGT
TTGGATTTGTCCGATCAAACATTATGGAGAGTTGAAATTTGTTTGAAcgc
tttcttcatttttcattttctcattcGGTTCATTGCGGCGAACGACAAAT
TATCTTTTTGGGCAATGGAACCTTTAACGTACGTTGATATTGTGACTGTA
CCAGCCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCG
CTTTCTACGTGTCATCTATTTGATCAACTTGGCAGATATCCTACAATTTC
TCAACGTACTCCACACAGGTTCAAGTCTTGAGATGGCACAGATGATTGGT
AATTTCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGttgGA
GAACACTGGTGATCCATGGGAGCCTATCAACTACACCAACAAACAGAAAT
TGAATTACTTCGAATGTCTCTATTTTCTATTCGTAACCATGTCAACGGTT
GGTTATGGTGATATATATTGTCATACGTATCTTGGAAGGTTGTTTAATAT
TGGTTTCATCTCTGTTGGCCTGgGTCTATTTACATCATACCTACCAGCTA
TCCAAGAATTCTTAGCTTCACATACGAAATATGATAGAGCTTTCAAGCCT
ACACCAGGGAAAAGGCATGTCATTGTTGCCGGATACATCACCGAAGAAAG
TGTGACtgggtttttcaaagatttcttgCATCCTGATCGAGAAGATAGTC
AAACCACTGTCGTTATATTGTCACCGAAATATCCGAGTTTGAAGATGCAA
GCCGACTTGCAAAGACATTGTACAAAAGCTTCATATTTTATTGGCACCAT
CTACAAGTTCATGGACTGCCATCGGACTAGGATGCGAGAAGCAGATGCAG
TCATTATTCTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCC
GCTAACATTACAAGGGTGATTTCAGTGAAGAATTATCACGAGAACATTCG
ATGTATCGTACAACTCATGATGAACAAAAACAAGTCACATTTATTGAATT
GTCCACAATGGAATCGGGAACTTGGTGATGACATCATTTGCATTGATGAG
ttGAAACTTGGATTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCAAC
GTTGCTGGCAAATCTATTCGCTATGAGGAGCGATACGATAAGCGAGGAGA
TTCAAGAATCAGAGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAAAT
GAGATGTACACAGCTCAACTATCGAATGCTTTCATTGGAATGTCCTTCCC
ACAAGCAGTAGAattatgttttgaaaaattgaatttaatgtTGATTGCCA
TcgaaatgaaaatctcaaaaaaagagCGATACTTTGCTATCAATCCCAAT
GACAAGAAGTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCA
AGACGCCAGCGATGTTGCGAAAGCATCGAAATATTGTGCGAAGTGTCACA
AAGACCTTCAAGATCCTGAACGAATGGTCAAATGTAAATGCAGACGACGT
ATGAAACAAGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAATACGA
AACAAAAGTCGATGTTGATCCAGTGCATTTGCTCGAAGCCGAACCCGATG
AAGCTAAAAAGGATAAACAATCATTGACGGGAGACTATTTTGCAAGTGGT
GAAAAACCAAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAG
AAGCTACATATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGT
TCAAGAACCATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACCACCG
CTTGGTTTAAGACAACTTGTACTTCCATTGCGTGCAAGCAATCGTCTGCC
GCACGATGTCAAAAAAGTTGTCATTCTTGGAGATGGAGATTTCTTAGCTC
GCGAGtgGCCGACGCTGGCGAATTTCCCTGATGTTGACATCGTACCTGGT
TCGCCTTACAACCGTTCCGATTTACGGGCAGTCAATGTGAATACAGCGGA
CATGTGTATTTTGTTATCACCCGGACATGGTAGCGAGGAAGATGAGCACC
AAGCTCTCTCTGATAAAGAAGTCATCCTGGTTACTTTGAATTTGAaagCC
ATGACTTTTGACGAATCAGAACTAGCAGTCACGGAGGAGATCAAGAAAGT
CGATTCGTCACGAGGAACTTCTATCAACGGTGAAAGTTCTGCCGATGTAC
GGGTGGGATTCTCATCGGGCGCCAATTCAAGGGCGGCCACCCGTATGACT
GGACGCCCTGAAACTTCAATGTCTCACATGACAGCGGGCGGTAATAGTAT
GATACAAGAAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAACA
TCCCTATGATCACTGAACTTGTATGTGATTCGAATGCGATGTACATTGAT
CAAGATGATATGAACATCTATGATGATGATGGAATCTTTTTAACGCAACC
GTACGCTTGCGGCTCCGCTTTCACCGTATCGGTTCTCGATTCACTCGTCA
GTGCGACATATTTCAACAGTGACGTATTAACACTTGTCCGTAATCTGGTC
ACCGGTTCTGTGAGTCCGGAACTGGACGAATTGTTAGCAGAAGGCAAGCA
GCCGTCCGGTTCGTACGAAACACAAGAGATTGCCGCTGTCAGGAACAGAT
GTCGGGTGGCACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAATATGGG
GAATGTGGTTTATTCGGTGATCTATTTTTGTACGCTCTCCGTACGTACAA
CATGATCTGTTTGGGTCTCTACCGATTCCGAGATTCGCAACGTATGAAGG
ACAAAATACCAAGCACGAAACGTTACGTCATCACGTTCCCGCCctttaat
tttgttttggatCCAACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAA
ACCGAAACGTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGC
GATTTTCAGGCGctttttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTC
GAGATCCCGGCAGATGAACGGAAATGGCCATGGTTTTTAGTGGTTTCCGG
GTTAATCTTTAGTTCCGgtttaattttaattatcatcGGACGTATTTTGT
TATATTTCTTCCATGGCGCTAAAAGAAGATCGAATAGTGTGATTGATATG
AATGAGGTGGACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGA
ACAAGGATGGTATTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTG
CTCAAACATTACAAGGACGTATATTGGTTGTTTTGTCGTTTGTATTCAAC
TTGGCAGAATGCGCACTCTATATCACAGAAACAGGATATCCAATCGAGCA
TTGTTTGGATTTGTCCGATCAAACATTATGGAGAGTTGAAATTTGTTTGA
AcgctttcttcatttttcattttctcattcGGTTCATTGCGGCGAACGAC
AAATTATCTTTTTGGGCAATGGAACCTTTAACGTACGTTGATATTGTGAC
TGTACCAGCCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtc
TCCGCTTTCTACGTGTCATCTATTTGATCAACTTGGCAGATATCCTACAA
TTTCTCAACGTACTCCACACAGGTTCAAGTCTTGAGATGGCACAGATGAT
TGGTAATTTCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGt
tgGAGAACACTGGTGATCCATGGGAGCCTATCAACTACACCAACAAACAG
AAATTGAATTACTTCGAATGTCTCTATTTTCTATTCGTAACCATGTCAAC
GGTTGGTTATGGTGATATATATTGTCATACGTATCTTGGAAGGTTGTTTA
ATATTGGTTTCATCTCTGTTGGCCTGgGTCTATTTACATCATACCTACCA
GCTATCCAAGAATTCTTAGCTTCACATACGAAATATGATAGAGCTTTCAA
GCCTACACCAGGGAAAAGGCATGTCATTGTTGCCGGATACATCACCGAAG
AAAGTGTGACtgggtttttcaaagatttcttgCATCCTGATCGAGAAGAT
AGTCAAACCACTGTCGTTATATTGTCACCGAAATATCCGAGTTTGAAGAT
GCAAGCCGACTTGCAAAGACATTGTACAAAAGCTTCATATTTTATTGGCA
CCATCTACAAGTTCATGGACTGCCATCGGACTAGGATGCGAGAAGCAGAT
GCAGTCATTATTCTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGA
CGCCGCTAACATTACAAGGGTGATTTCAGTGAAGAATTATCACGAGAACA
TTCGATGTATCGTACAACTCATGATGAACAAAAACAAGTCACATTTATTG
AATTGTCCACAATGGAATCGGGAACTTGGTGATGACATCATTTGCATTGA
TGAGttGAAACTTGGATTCGTGGCACAAAGTTGTAATGCACCTGGATTCT
CAACGTTGCTGGCAAATCTATTCGCTATGAGGAGCGATACGATAAGCGAG
GAGATTCAAGAATCAGAGAAATGGAAAGTAGCGTACATGATTGGTGCAGC
AAATGAGATGTACACAGCTCAACTATCGAATGCTTTCATTGGAATGTCCT
TCCCACAAGCAGTAGAattatgttttgaaaaattgaatttaatgtTGATT
GCCATcgaaatgaaaatctcaaaaaaagagCGATACTTTGCTATCAATCC
CAATGACAAGAAGTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCG
CTCAAGACGCCAGCGATGTTGCGAAAGCATCGAAATATTGTGCGAAGTGT
CACAAAGACCTTCAAGATCCTGAACGAATGGTCAAATGTAAATGCAGACG
ACGTATGAAACAAGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAAT
ACGAAACAAAAGTCGATGTTGATCCAGTGCATTTGCTCGAAGCCGAACCC
GATGAAGCTAAAAAGGATAAACAATCATTGACGGGAGACTATTTTGCAAG
TGGTGAAAAACCAAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAA
CAAGAAGCTACATATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGG
AAGTTCAAGAACCATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACC
ACCGCTTGGTTTAAGACAACTTGTACTTCCATTGCGTGCAAGCAATCGTC
TGCCGCACGATGTCAAAAAAGTTGTCATTCTTGGAGATGGAGATTTCTTA
GCTCGCGAGtgGCCGACGCTGGCGAATTTCCCTGATGTTGACATCGTACC
TGGTTCGCCTTACAACCGTTCCGATTTACGGGCAGTCAATGTGAATACAG
CGGACATGTGTATTTTGTTATCACCCGGACATGGTAGCGAGGAAGATGAG
CACCAAGCTCTCTCTGATAAAGAAGTCATCCTGGTTACTTTGAATTTGAa
agCCATGACTTTTGACGAATCAGAACTAGCAGTCACGGAGGAGATCAAGA
AAGTCGATTCGTCACGAGGAACTTCTATCAACGGTGAAAGTTCTGCCGAT
GTACGGGTGGGATTCTCATCGGGCGCCAATTCAAGGGCGGCCACCCGTAT
GACTGGACGCCCTGAAACTTCAATGTCTCACATGACAGCGGGCGGTAATA
GTATGATACAAGAAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCT
AACATCCCTATGATCACTGAACTTGTATGTGATTCGAATGCGATGTACAT
TGATCAAGATGATATGAACATCTATGATGATGATGGAATCTTTTTAACGC
AACCGTACGCTTGCGGCTCCGCTTTCACCGTATCGGTTCTCGATTCACTC
GTCAGTGCGACATATTTCAACAGTGACGTATTAACACTTGTCCGTAATCT
GGTCACCGGTTCTGTGAGTCCGGAACTGGACGAATTGTTAGCAGAAGGCA
AGCAGCCGTCCGGTTCGTACGAAACACAAGAGATTGCCGCTGTCAGGAAC
AGATGTCGGGTGGCACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAATA
TGGGGAATGTGGTTTATTCGGTGATCTATTTTTGTACGCTCTCCGTACGT
ACAACATGATCTGTTTGGGTCTCTACCGATTCCGAGATTCGCAACGTATG
AAGGACAAAATACCAAGCACGAAACGTTACGTCATCACGTTCCCGCCctt
taattttgttttggatCCAACTGATCTGGTCTTTGTTTTAATGCAGTTCG
AAAAACCGAAACGTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCG
TCGCGATTTTCAGGCGctttttaaATGGCGAGTGCAGCTTGTCGTATTGA
AGTCGAGATCCCGGCAGATGAACGGAAATGGCCATGGTTTTTAGTGGTTT
CCGGGTTAATCTTTAGTTCCGgtttaattttaattatcatcGGACGTATT
TTGTTATATTTCTTCCATGGCGCTAAAAGAAGATCGAATAGTGTGATTGA
TATGAATGAGGTGGACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGATT
TAGAACAAGGATGGTATTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTG
TCTGCTCAAACATTACAAGGACGTATATTGGTTGTTTTGTCGTTTGTATT
CAACTTGGCAGAATGCGCACTCTATATCACAGAAACAGGATATCCAATCG
AGCATTGTTTGGATTTGTCCGATCAAACATTATGGAGAGTTGAAATTTGT
TTGAAcgctttcttcatttttcattttctcattcGGTTCATTGCGGCGAA
CGACAAATTATCTTTTTGGGCAATGGAACCTTTAACGTACGTTGATATTG
TGACTGTACCAGCCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTA
GgtcTCCGCTTTCTACGTGTCATCTATTTGATCAACTTGGCAGATATCCT
ACAATTTCTCAACGTACTCCACACAGGTTCAAGTCTTGAGATGGCACAGA
TGATTGGTAATTTCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTCAT
TTGttgGAGAACACTGGTGATCCATGGGAGCCTATCAACTACACCAACAA
ACAGAAATTGAATTACTTCGAATGTCTCTATTTTCTATTCGTAACCATGT
CAACGGTTGGTTATGGTGATATATATTGTCATACGTATCTTGGAAGGTTG
TTTAATATTGGTTTCATCTCTGTTGGCCTGgGTCTATTTACATCATACCT
ACCAGCTATCCAAGAATTCTTAGCTTCACATACGAAATATGATAGAGCTT
TCAAGCCTACACCAGGGAAAAGGCATGTCATTGTTGCCGGATACATCACC
GAAGAAAGTGTGACtgggtttttcaaagatttcttgCATCCTGATCGAGA
AGATAGTCAAACCACTGTCGTTATATTGTCACCGAAATATCCGAGTTTGA
AGATGCAAGCCGACTTGCAAAGACATTGTACAAAAGCTTCATATTTTATT
GGCACCATCTACAAGTTCATGGACTGCCATCGGACTAGGATGCGAGAAGC
AGATGCAGTCATTATTCTTTGTAACAAGAAATGTATAAGTCCCGATGAAG
AAGACGCCGCTAACATTACAAGGGTGATTTCAGTGAAGAATTATCACGAG
AACATTCGATGTATCGTACAACTCATGATGAACAAAAACAAGTCACATTT
ATTGAATTGTCCACAATGGAATCGGGAACTTGGTGATGACATCATTTGCA
TTGATGAGttGAAACTTGGATTCGTGGCACAAAGTTGTAATGCACCTGGA
TTCTCAACGTTGCTGGCAAATCTATTCGCTATGAGGAGCGATACGATAAG
CGAGGAGATTCAAGAATCAGAGAAATGGAAAGTAGCGTACATGATTGGTG
CAGCAAATGAGATGTACACAGCTCAACTATCGAATGCTTTCATTGGAATG
TCCTTCCCACAAGCAGTAGAattatgttttgaaaaattgaatttaatgtT
GATTGCCATcgaaatgaaaatctcaaaaaaagagCGATACTTTGCTATCA
ATCCCAATGACAAGAAGTTGAGACTTTTACCAGGAACGCGTGGTTTCTTT
TTCGCTCAAGACGCCAGCGATGTTGCGAAAGCATCGAAATATTGTGCGAA
GTGTCACAAAGACCTTCAAGATCCTGAACGAATGGTCAAATGTAAATGCA
GACGACGTATGAAACAAGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGA
AAATACGAAACAAAAGTCGATGTTGATCCAGTGCATTTGCTCGAAGCCGA
ACCCGATGAAGCTAAAAAGGATAAACAATCATTGACGGGAGACTATTTTG
CAAGTGGTGAAAAACCAAAGTTTGACCAAAGTGGGACGTTTTATTGGTGC
GAAACAAGAAGCTACATATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGA
AAGGAAGTTCAAGAACCATGTTGTTGTGTTGGTTTTATCACAACGTCTTT
CACCACCGCTTGGTTTAAGACAACTTGTACTTCCATTGCGTGCAAGCAAT
CGTCTGCCGCACGATGTCAAAAAAGTTGTCATTCTTGGAGATGGAGATTT
CTTAGCTCGCGAGtgGCCGACGCTGGCGAATTTCCCTGATGTTGACATCG
TACCTGGTTCGCCTTACAACCGTTCCGATTTACGGGCAGTCAATGTGAAT
ACAGCGGACATGTGTATTTTGTTATCACCCGGACATGGTAGCGAGGAAGA
TGAGCACCAAGCTCTCTCTGATAAAGAAGTCATCCTGGTTACTTTGAATT
TGAaagCCATGACTTTTGACGAATCAGAACTAGCAGTCACGGAGGAGATC
AAGAAAGTCGATTCGTCACGAGGAACTTCTATCAACGGTGAAAGTTCTGC
CGATGTACGGGTGGGATTCTCATCGGGCGCCAATTCAAGGGCGGCCACCC
GTATGACTGGACGCCCTGAAACTTCAATGTCTCACATGACAGCGGGCGGT
AATAGTATGATACAAGAAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGG
AGCTAACATCCCTATGATCACTGAACTTGTATGTGATTCGAATGCGATGT
ACATTGATCAAGATGATATGAACATCTATGATGATGATGGAATCTTTTTA
ACGCAACCGTACGCTTGCGGCTCCGCTTTCACCGTATCGGTTCTCGATTC
ACTCGTCAGTGCGACATATTTCAACAGTGACGTATTAACACTTGTCCGTA
ATCTGGTCACCGGTTCTGTGAGTCCGGAACTGGACGAATTGTTAGCAGAA
GGCAAGCAGCCGTCCGGTTCGTACGAAACACAAGAGATTGCCGCTGTCAG
GAACAGATGTCGGGTGGCACAAATTTCTTTGTTTGAAGGGCCTTTATCTG
AATATGGGGAATGTGGTTTATTCGGTGATCTATTTTTGTACGCTCTCCGT
ACGTACAACATGATCTGTTTGGGTCTCTACCGATTCCGAGATTCGCAACG
TATGAAGGACAAAATACCAAGCACGAAACGTTACGTCATCACGTTCCCGC
CctttaattttgttttggatCCAACTGATCTGGTCTTTGTTTTAATGCAG
TTCGAAAAACCGAAACGTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGT
GGCGTCGCGATTTTCAGGCGctttttaaATGGCGAGTGCAGCTTGTCGTA
TTGAAGTCGAGATCCCGGCAGATGAACGGAAATGGCCATGGTTTTTAGTG
GTTTCCGGGTTAATCTTTAGTTCCGgtttaattttaattatcatcGGACG
TATTTTGTTATATTTCTTCCATGGCGCTAAAAGAAGATCGAATAGTGTGA
TTGATATGAATGAGGTGGACGAATTGGAGGAAGAGGAATTCTTCTTGGAA
GATTTAGAACAAGGATGGTATTTAGATTTGAAAGAAGGTGCTGGCAATCT
TGTGTCTGCTCAAACATTACAAGGACGTATATTGGTTGTTTTGTCGTTTG
TATTCAACTTGGCAGAATGCGCACTCTATATCACAGAAACAGGATATCCA
ATCGAGCATTGTTTGGATTTGTCCGATCAAACATTATGGAGAGTTGAAAT
TTGTTTGAAcgctttcttcatttttcattttctcattcGGTTCATTGCGG
CGAACGACAAATTATCTTTTTGGGCAATGGAACCTTTAACGTACGTTGAT
ATTGTGACTGTACCAGCCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTG
GCTAGgtcTCCGCTTTCTACGTGTCATCTATTTGATCAACTTGGCAGATA
TCCTACAATTTCTCAACGTACTCCACACAGGTTCAAGTCTTGAGATGGCA
CAGATGATTGGTAATTTCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGT
TCATTTGttgGAGAACACTGGTGATCCATGGGAGCCTATCAACTACACCA
ACAAACAGAAATTGAATTACTTCGAATGTCTCTATTTTCTATTCGTAACC
ATGTCAACGGTTGGTTATGGTGATATATATTGTCATACGTATCTTGGAAG
GTTGTTTAATATTGGTTTCATCTCTGTTGGCCTGgGTCTATTTACATCAT
ACCTACCAGCTATCCAAGAATTCTTAGCTTCACATACGAAATATGATAGA
GCTTTCAAGCCTACACCAGGGAAAAGGCATGTCATTGTTGCCGGATACAT
CACCGAAGAAAGTGTGACtgggtttttcaaagatttcttgCATCCTGATC
GAGAAGATAGTCAAACCACTGTCGTTATATTGTCACCGAAATATCCGAGT
TTGAAGATGCAAGCCGACTTGCAAAGACATTGTACAAAAGCTTCATATTT
TATTGGCACCATCTACAAGTTCATGGACTGCCATCGGACTAGGATGCGAG
AAGCAGATGCAGTCATTATTCTTTGTAACAAGAAATGTATAAGTCCCGAT
GAAGAAGACGCCGCTAACATTACAAGGGTGATTTCAGTGAAGAATTATCA
CGAGAACATTCGATGTATCGTACAACTCATGATGAACAAAAACAAGTCAC
ATTTATTGAATTGTCCACAATGGAATCGGGAACTTGGTGATGACATCATT
TGCATTGATGAGttGAAACTTGGATTCGTGGCACAAAGTTGTAATGCACC
TGGATTCTCAACGTTGCTGGCAAATCTATTCGCTATGAGGAGCGATACGA
TAAGCGAGGAGATTCAAGAATCAGAGAAATGGAAAGTAGCGTACATGATT
GGTGCAGCAAATGAGATGTACACAGCTCAACTATCGAATGCTTTCATTGG
AATGTCCTTCCCACAAGCAGTAGAattatgttttgaaaaattgaatttaa
tgtTGATTGCCATcgaaatgaaaatctcaaaaaaagagCGATACTTTGCT
ATCAATCCCAATGACAAGAAGTTGAGACTTTTACCAGGAACGCGTGGTTT
CTTTTTCGCTCAAGACGCCAGCGATGTTGCGAAAGCATCGAAATATTGTG
CGAAGTGTCACAAAGACCTTCAAGATCCTGAACGAATGGTCAAATGTAAA
TGCAGACGACGTATGAAACAAGAACAGGAAAAGAAGAATCCAGCTCAGAA
AGGAAAATACGAAACAAAAGTCGATGTTGATCCAGTGCATTTGCTCGAAG
CCGAACCCGATGAAGCTAAAAAGGATAAACAATCATTGACGGGAGACTAT
TTTGCAAGTGGTGAAAAACCAAAGTTTGACCAAAGTGGGACGTTTTATTG
GTGCGAAACAAGAAGCTACATATCTGCCAGGAtgAGTCTCGGTGATGCTG
CAGAAAGGAAGTTCAAGAACCATGTTGTTGTGTTGGTTTTATCACAACGT
CTTTCACCACCGCTTGGTTTAAGACAACTTGTACTTCCATTGCGTGCAAG
CAATCGTCTGCCGCACGATGTCAAAAAAGTTGTCATTCTTGGAGATGGAG
ATTTCTTAGCTCGCGAGtgGCCGACGCTGGCGAATTTCCCTGATGTTGAC
ATCGTACCTGGTTCGCCTTACAACCGTTCCGATTTACGGGCAGTCAATGT
GAATACAGCGGACATGTGTATTTTGTTATCACCCGGACATGGTAGCGAGG
AAGATGAGCACCAAGCTCTCTCTGATAAAGAAGTCATCCTGGTTACTTTG
AATTTGAaagCCATGACTTTTGACGAATCAGAACTAGCAGTCACGGAGGA
GATCAAGAAAGTCGATTCGTCACGAGGAACTTCTATCAACGGTGAAAGTT
CTGCCGATGTACGGGTGGGATTCTCATCGGGCGCCAATTCAAGGGCGGCC
ACCCGTATGACTGGACGCCCTGAAACTTCAATGTCTCACATGACAGCGGG
CGGTAATAGTATGATACAAGAAGTCAAGAAAACGTTTAAAGGAGCTTTGA
ATGGAGCTAACATCCCTATGATCACTGAACTTGTATGTGATTCGAATGCG
ATGTACATTGATCAAGATGATATGAACATCTATGATGATGATGGAATCTT
TTTAACGCAACCGTACGCTTGCGGCTCCGCTTTCACCGTATCGGTTCTCG
ATTCACTCGTCAGTGCGACATATTTCAACAGTGACGTATTAACACTTGTC
CGTAATCTGGTCACCGGTTCTGTGAGTCCGGAACTGGACGAATTGTTAGC
AGAAGGCAAGCAGCCGTCCGGTTCGTACGAAACACAAGAGATTGCCGCTG
TCAGGAACAGATGTCGGGTGGCACAAATTTCTTTGTTTGAAGGGCCTTTA
TCTGAATATGGGGAATGTGGTTTATTCGGTGATCTATTTTTGTACGCTCT
CCGTACGTACAACATGATCTGTTTGGGTCTCTACCGATTCCGAGATTCGC
AACGTATGAAGGACAAAATACCAAGCACGAAACGTTACGTCATCACGTTC
CCGCCctttaattttgttttggatCCAACTGATCTGGTCTTTGTTTTAAT
GCAGTTCGAAAAACCGAAACGTAAAAGGAAATCTGTGTCTCGTGTTGGCT
CTGTGGCGTCGCGATTTTCAGGCGctttttaaATGGCGAGTGCAGCTTGT
CGTATTGAAGTCGAGATCCCGGCAGATGAACGGAAATGGCCATGGTTTTT
AGTGGTTTCCGGGTTAATCTTTAGTTCCGgtttaattttaattatcatcG
GACGTATTTTGTTATATTTCTTCCATGGCGCTAAAAGAAGATCGAATAGT
GTGATTGATATGAATGAGGTGGACGAATTGGAGGAAGAGGAATTCTTCTT
GGAAGATTTAGAACAAGGATGGTATTTAGATTTGAAAGAAGGTGCTGGCA
ATCTTGTGTCTGCTCAAACATTACAAGGACGTATATTGGTTGTTTTGTCG
TTTGTATTCAACTTGGCAGAATGCGCACTCTATATCACAGAAACAGGATA
TCCAATCGAGCATTGTTTGGATTTGTCCGATCAAACATTATGGAGAGTTG
AAATTTGTTTGAAcgctttcttcatttttcattttctcattcGGTTCATT
GCGGCGAACGACAAATTATCTTTTTGGGCAATGGAACCTTTAACGTACGT
TGATATTGTGACTGTACCAGCCGTCTTTGTGGCTGTCTATCTTGGCCGAA
ACTGGCTAGgtcTCCGCTTTCTACGTGTCATCTATTTGATCAACTTGGCA
GATATCCTACAATTTCTCAACGTACTCCACACAGGTTCAAGTCTTGAGAT
GGCACAGATGATTGGTAATTTCTTGGCTTTGACTCTGGCGTCAGCTGGTA
TTGTTCATTTGttgGAGAACACTGGTGATCCATGGGAGCCTATCAACTAC
ACCAACAAACAGAAATTGAATTACTTCGAATGTCTCTATTTTCTATTCGT
AACCATGTCAACGGTTGGTTATGGTGATATATATTGTCATACGTATCTTG
GAAGGTTGTTTAATATTGGTTTCATCTCTGTTGGCCTGgGTCTATTTACA
TCATACCTACCAGCTATCCAAGAATTCTTAGCTTCACATACGAAATATGA
TAGAGCTTTCAAGCCTACACCAGGGAAAAGGCATGTCATTGTTGCCGGAT
ACATCACCGAAGAAAGTGTGACtgggtttttcaaagatttcttgCATCCT
GATCGAGAAGATAGTCAAACCACTGTCGTTATATTGTCACCGAAATATCC
GAGTTTGAAGATGCAAGCCGACTTGCAAAGACATTGTACAAAAGCTTCAT
ATTTTATTGGCACCATCTACAAGTTCATGGACTGCCATCGGACTAGGATG
CGAGAAGCAGATGCAGTCATTATTCTTTGTAACAAGAAATGTATAAGTCC
CGATGAAGAAGACGCCGCTAACATTACAAGGGTGATTTCAGTGAAGAATT
ATCACGAGAACATTCGATGTATCGTACAACTCATGATGAACAAAAACAAG
TCACATTTATTGAATTGTCCACAATGGAATCGGGAACTTGGTGATGACAT
CATTTGCATTGATGAGttGAAACTTGGATTCGTGGCACAAAGTTGTAATG
CACCTGGATTCTCAACGTTGCTGGCAAATCTATTCGCTATGAGGAGCGAT
ACGATAAGCGAGGAGATTCAAGAATCAGAGAAATGGAAAGTAGCGTACAT
GATTGGTGCAGCAAATGAGATGTACACAGCTCAACTATCGAATGCTTTCA
TTGGAATGTCCTTCCCACAAGCAGTAGAattatgttttgaaaaattgaat
ttaatgtTGATTGCCATcgaaatgaaaatctcaaaaaaagagCGATACTT
TGCTATCAATCCCAATGACAAGAAGTTGAGACTTTTACCAGGAACGCGTG
GTTTCTTTTTCGCTCAAGACGCCAGCGATGTTGCGAAAGCATCGAAATAT
TGTGCGAAGTGTCACAAAGACCTTCAAGATCCTGAACGAATGGTCAAATG
TAAATGCAGACGACGTATGAAACAAGAACAGGAAAAGAAGAATCCAGCTC
AGAAAGGAAAATACGAAACAAAAGTCGATGTTGATCCAGTGCATTTGCTC
GAAGCCGAACCCGATGAAGCTAAAAAGGATAAACAATCATTGACGGGAGA
CTATTTTGCAAGTGGTGAAAAACCAAAGTTTGACCAAAGTGGGACGTTTT
ATTGGTGCGAAACAAGAAGCTACATATCTGCCAGGAtgAGTCTCGGTGAT
GCTGCAGAAAGGAAGTTCAAGAACCATGTTGTTGTGTTGGTTTTATCACA
ACGTCTTTCACCACCGCTTGGTTTAAGACAACTTGTACTTCCATTGCGTG
CAAGCAATCGTCTGCCGCACGATGTCAAAAAAGTTGTCATTCTTGGAGAT
GGAGATTTCTTAGCTCGCGAGtgGCCGACGCTGGCGAATTTCCCTGATGT
TGACATCGTACCTGGTTCGCCTTACAACCGTTCCGATTTACGGGCAGTCA
ATGTGAATACAGCGGACATGTGTATTTTGTTATCACCCGGACATGGTAGC
GAGGAAGATGAGCACCAAGCTCTCTCTGATAAAGAAGTCATCCTGGTTAC
TTTGAATTTGAaagCCATGACTTTTGACGAATCAGAACTAGCAGTCACGG
AGGAGATCAAGAAAGTCGATTCGTCACGAGGAACTTCTATCAACGGTGAA
AGTTCTGCCGATGTACGGGTGGGATTCTCATCGGGCGCCAATTCAAGGGC
GGCCACCCGTATGACTGGACGCCCTGAAACTTCAATGTCTCACATGACAG
CGGGCGGTAATAGTATGATACAAGAAGTCAAGAAAACGTTTAAAGGAGCT
TTGAATGGAGCTAACATCCCTATGATCACTGAACTTGTATGTGATTCGAA
TGCGATGTACATTGATCAAGATGATATGAACATCTATGATGATGATGGAA
TCTTTTTAACGCAACCGTACGCTTGCGGCTCCGCTTTCACCGTATCGGTT
CTCGATTCACTCGTCAGTGCGACATATTTCAACAGTGACGTATTAACACT
TGTCCGTAATCTGGTCACCGGTTCTGTGAGTCCGGAACTGGACGAATTGT
TAGCAGAAGGCAAGCAGCCGTCCGGTTCGTACGAAACACAAGAGATTGCC
GCTGTCAGGAACAGATGTCGGGTGGCACAAATTTCTTTGTTTGAAGGGCC
TTTATCTGAATATGGGGAATGTGGTTTATTCGGTGATCTATTTTTGTACG
CTCTCCGTACGTACAACATGATCTGTTTGGGTCTCTACCGATTCCGAGAT
TCGCAACGTATGAAGGACAAAATACCAAGCACGAAACGTTACGTCATCAC
GTTCCCGCCctttaattttgttttggatCCAACTGATCTGGTCTTTGTTT
TAATGCAGTTCGAAAAACCGAAACGTAAAAGGAAATCTGTGTCTCGTGTT
GGCTCTGTGGCGTCGCGATTTTCAGGCGctttttaaATGGCGAGTGCAGC
TTGTCGTATTGAAGTCGAGATCCCGGCAGATGAACGGAAATGGCCATGGT
TTTTAGTGGTTTCCGGGTTAATCTTTAGTTCCGgtttaattttaattatc
atcGGACGTATTTTGTTATATTTCTTCCATGGCGCTAAAAGAAGATCGAA
TAGTGTGATTGATATGAATGAGGTGGACGAATTGGAGGAAGAGGAATTCT
TCTTGGAAGATTTAGAACAAGGATGGTATTTAGATTTGAAAGAAGGTGCT
GGCAATCTTGTGTCTGCTCAAACATTACAAGGACGTATATTGGTTGTTTT
GTCGTTTGTATTCAACTTGGCAGAATGCGCACTCTATATCACAGAAACAG
GATATCCAATCGAGCATTGTTTGGATTTGTCCGATCAAACATTATGGAGA
GTTGAAATTTGTTTGAAcgctttcttcatttttcattttctcattcGGTT
CATTGCGGCGAACGACAAATTATCTTTTTGGGCAATGGAACCTTTAACGT
ACGTTGATATTGTGACTGTACCAGCCGTCTTTGTGGCTGTCTATCTTGGC
CGAAACTGGCTAGgtcTCCGCTTTCTACGTGTCATCTATTTGATCAACTT
GGCAGATATCCTACAATTTCTCAACGTACTCCACACAGGTTCAAGTCTTG
AGATGGCACAGATGATTGGTAATTTCTTGGCTTTGACTCTGGCGTCAGCT
GGTATTGTTCATTTGttgGAGAACACTGGTGATCCATGGGAGCCTATCAA
CTACACCAACAAACAGAAATTGAATTACTTCGAATGTCTCTATTTTCTAT
TCGTAACCATGTCAACGGTTGGTTATGGTGATATATATTGTCATACGTAT
CTTGGAAGGTTGTTTAATATTGGTTTCATCTCTGTTGGCCTGgGTCTATT
TACATCATACCTACCAGCTATCCAAGAATTCTTAGCTTCACATACGAAAT
ATGATAGAGCTTTCAAGCCTACACCAGGGAAAAGGCATGTCATTGTTGCC
GGATACATCACCGAAGAAAGTGTGACtgggtttttcaaagatttcttgCA
TCCTGATCGAGAAGATAGTCAAACCACTGTCGTTATATTGTCACCGAAAT
ATCCGAGTTTGAAGATGCAAGCCGACTTGCAAAGACATTGTACAAAAGCT
TCATATTTTATTGGCACCATCTACAAGTTCATGGACTGCCATCGGACTAG
GATGCGAGAAGCAGATGCAGTCATTATTCTTTGTAACAAGAAATGTATAA
GTCCCGATGAAGAAGACGCCGCTAACATTACAAGGGTGATTTCAGTGAAG
AATTATCACGAGAACATTCGATGTATCGTACAACTCATGATGAACAAAAA
CAAGTCACATTTATTGAATTGTCCACAATGGAATCGGGAACTTGGTGATG
ACATCATTTGCATTGATGAGttGAAACTTGGATTCGTGGCACAAAGTTGT
AATGCACCTGGATTCTCAACGTTGCTGGCAAATCTATTCGCTATGAGGAG
CGATACGATAAGCGAGGAGATTCAAGAATCAGAGAAATGGAAAGTAGCGT
ACATGATTGGTGCAGCAAATGAGATGTACACAGCTCAACTATCGAATGCT
TTCATTGGAATGTCCTTCCCACAAGCAGTAGAattatgttttgaaaaatt
gaatttaatgtTGATTGCCATcgaaatgaaaatctcaaaaaaagagCGAT
ACTTTGCTATCAATCCCAATGACAAGAAGTTGAGACTTTTACCAGGAACG
CGTGGTTTCTTTTTCGCTCAAGACGCCAGCGATGTTGCGAAAGCATCGAA
ATATTGTGCGAAGTGTCACAAAGACCTTCAAGATCCTGAACGAATGGTCA
AATGTAAATGCAGACGACGTATGAAACAAGAACAGGAAAAGAAGAATCCA
GCTCAGAAAGGAAAATACGAAACAAAAGTCGATGTTGATCCAGTGCATTT
GCTCGAAGCCGAACCCGATGAAGCTAAAAAGGATAAACAATCATTGACGG
GAGACTATTTTGCAAGTGGTGAAAAACCAAAGTTTGACCAAAGTGGGACG
TTTTATTGGTGCGAAACAAGAAGCTACATATCTGCCAGGAtgAGTCTCGG
TGATGCTGCAGAAAGGAAGTTCAAGAACCATGTTGTTGTGTTGGTTTTAT
CACAACGTCTTTCACCACCGCTTGGTTTAAGACAACTTGTACTTCCATTG
CGTGCAAGCAATCGTCTGCCGCACGATGTCAAAAAAGTTGTCATTCTTGG
AGATGGAGATTTCTTAGCTCGCGAGtgGCCGACGCTGGCGAATTTCCCTG
ATGTTGACATCGTACCTGGTTCGCCTTACAACCGTTCCGATTTACGGGCA
GTCAATGTGAATACAGCGGACATGTGTATTTTGTTATCACCCGGACATGG
TAGCGAGGAAGATGAGCACCAAGCTCTCTCTGATAAAGAAGTCATCCTGG
TTACTTTGAATTTGAaagCCATGACTTTTGACGAATCAGAACTAGCAGTC
ACGGAGGAGATCAAGAAAGTCGATTCGTCACGAGGAACTTCTATCAACGG
TGAAAGTTCTGCCGATGTACGGGTGGGATTCTCATCGGGCGCCAATTCAA
GGGCGGCCACCCGTATGACTGGACGCCCTGAAACTTCAATGTCTCACATG
ACAGCGGGCGGTAATAGTATGATACAAGAAGTCAAGAAAACGTTTAAAGG
AGCTTTGAATGGAGCTAACATCCCTATGATCACTGAACTTGTATGTGATT
CGAATGCGATGTACATTGATCAAGATGATATGAACATCTATGATGATGAT
GGAATCTTTTTAACGCAACCGTACGCTTGCGGCTCCGCTTTCACCGTATC
GGTTCTCGATTCACTCGTCAGTGCGACATATTTCAACAGTGACGTATTAA
CACTTGTCCGTAATCTGGTCACCGGTTCTGTGAGTCCGGAACTGGACGAA
TTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGTACGAAACACAAGAGAT
TGCCGCTGTCAGGAACAGATGTCGGGTGGCACAAATTTCTTTGTTTGAAG
GGCCTTTATCTGAATATGGGGAATGTGGTTTATTCGGTGATCTATTTTTG
TACGCTCTCCGTACGTACAACATGATCTGTTTGGGTCTCTACCGATTCCG
AGATTCGCAACGTATGAAGGACAAAATACCAAGCACGAAACGTTACGTCA
TCACGTTCCCGCCctttaattttgttttggatCCAACTGATCTGGTCTTT
GTTTTAATGCAGTTCGAAAAACCGAAACGTAAAAGGAAATCTGTGTCTCG
TGTTGGCTCTGTGGCGTCGCGATTTTCAGGCGctttttaaATGGCGAGTG
CAGCTTGTCGTATTGAAGTCGAGATCCCGGCAGATGAACGGAAATGGCCA
TGGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCCGgtttaattttaat
tatcatcGGACGTATTTTGTTATATTTCTTCCATGGCGCTAAAAGAAGAT
CGAATAGTGTGATTGATATGAATGAGGTGGACGAATTGGAGGAAGAGGAA
TTCTTCTTGGAAGATTTAGAACAAGGATGGTATTTAGATTTGAAAGAAGG
TGCTGGCAATCTTGTGTCTGCTCAAACATTACAAGGACGTATATTGGTTG
TTTTGTCGTTTGTATTCAACTTGGCAGAATGCGCACTCTATATCACAGAA
ACAGGATATCCAATCGAGCATTGTTTGGATTTGTCCGATCAAACATTATG
GAGAGTTGAAATTTGTTTGAAcgctttcttcatttttcattttctcattc
GGTTCATTGCGGCGAACGACAAATTATCTTTTTGGGCAATGGAACCTTTA
ACGTACGTTGATATTGTGACTGTACCAGCCGTCTTTGTGGCTGTCTATCT
TGGCCGAAACTGGCTAGgtcTCCGCTTTCTACGTGTCATCTATTTGATCA
ACTTGGCAGATATCCTACAATTTCTCAACGTACTCCACACAGGTTCAAGT
CTTGAGATGGCACAGATGATTGGTAATTTCTTGGCTTTGACTCTGGCGTC
AGCTGGTATTGTTCATTTGttgGAGAACACTGGTGATCCATGGGAGCCTA
TCAACTACACCAACAAACAGAAATTGAATTACTTCGAATGTCTCTATTTT
CTATTCGTAACCATGTCAACGGTTGGTTATGGTGATATATATTGTCATAC
GTATCTTGGAAGGTTGTTTAATATTGGTTTCATCTCTGTTGGCCTGgGTC
TATTTACATCATACCTACCAGCTATCCAAGAATTCTTAGCTTCACATACG
AAATATGATAGAGCTTTCAAGCCTACACCAGGGAAAAGGCATGTCATTGT
TGCCGGATACATCACCGAAGAAAGTGTGACtgggtttttcaaagatttct
tgCATCCTGATCGAGAAGATAGTCAAACCACTGTCGTTATATTGTCACCG
AAATATCCGAGTTTGAAGATGCAAGCCGACTTGCAAAGACATTGTACAAA
AGCTTCATATTTTATTGGCACCATCTACAAGTTCATGGACTGCCATCGGA
CTAGGATGCGAGAAGCAGATGCAGTCATTATTCTTTGTAACAAGAAATGT
ATAAGTCCCGATGAAGAAGACGCCGCTAACATTACAAGGGTGATTTCAGT
GAAGAATTATCACGAGAACATTCGATGTATCGTACAACTCATGATGAACA
AAAACAAGTCACATTTATTGAATTGTCCACAATGGAATCGGGAACTTGGT
GATGACATCATTTGCATTGATGAGttGAAACTTGGATTCGTGGCACAAAG
TTGTAATGCACCTGGATTCTCAACGTTGCTGGCAAATCTATTCGCTATGA
GGAGCGATACGATAAGCGAGGAGATTCAAGAATCAGAGAAATGGAAAGTA
GCGTACATGATTGGTGCAGCAAATGAGATGTACACAGCTCAACTATCGAA
TGCTTTCATTGGAATGTCCTTCCCACAAGCAGTAGAattatgttttgaaa
aattgaatttaatgtTGATTGCCATcgaaatgaaaatctcaaaaaaagag
CGATACTTTGCTATCAATCCCAATGACAAGAAGTTGAGACTTTTACCAGG
AACGCGTGGTTTCTTTTTCGCTCAAGACGCCAGCGATGTTGCGAAAGCAT
CGAAATATTGTGCGAAGTGTCACAAAGACCTTCAAGATCCTGAACGAATG
GTCAAATGTAAATGCAGACGACGTATGAAACAAGAACAGGAAAAGAAGAA
TCCAGCTCAGAAAGGAAAATACGAAACAAAAGTCGATGTTGATCCAGTGC
ATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGGATAAACAATCATTG
ACGGGAGACTATTTTGCAAGTGGTGAAAAACCAAAGTTTGACCAAAGTGG
GACGTTTTATTGGTGCGAAACAAGAAGCTACATATCTGCCAGGAtgAGTC
TCGGTGATGCTGCAGAAAGGAAGTTCAAGAACCATGTTGTTGTGTTGGTT
TTATCACAACGTCTTTCACCACCGCTTGGTTTAAGACAACTTGTACTTCC
ATTGCGTGCAAGCAATCGTCTGCCGCACGATGTCAAAAAAGTTGTCATTC
TTGGAGATGGAGATTTCTTAGCTCGCGAGtgGCCGACGCTGGCGAATTTC
CCTGATGTTGACATCGTACCTGGTTCGCCTTACAACCGTTCCGATTTACG
GGCAGTCAATGTGAATACAGCGGACATGTGTATTTTGTTATCACCCGGAC
ATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTGATAAAGAAGTCATC
CTGGTTACTTTGAATTTGAaagCCATGACTTTTGACGAATCAGAACTAGC
AGTCACGGAGGAGATCAAGAAAGTCGATTCGTCACGAGGAACTTCTATCA
ACGGTGAAAGTTCTGCCGATGTACGGGTGGGATTCTCATCGGGCGCCAAT
TCAAGGGCGGCCACCCGTATGACTGGACGCCCTGAAACTTCAATGTCTCA
CATGACAGCGGGCGGTAATAGTATGATACAAGAAGTCAAGAAAACGTTTA
AAGGAGCTTTGAATGGAGCTAACATCCCTATGATCACTGAACTTGTATGT
GATTCGAATGCGATGTACATTGATCAAGATGATATGAACATCTATGATGA
TGATGGAATCTTTTTAACGCAACCGTACGCTTGCGGCTCCGCTTTCACCG
TATCGGTTCTCGATTCACTCGTCAGTGCGACATATTTCAACAGTGACGTA
TTAACACTTGTCCGTAATCTGGTCACCGGTTCTGTGAGTCCGGAACTGGA
CGAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGTACGAAACACAAG
AGATTGCCGCTGTCAGGAACAGATGTCGGGTGGCACAAATTTCTTTGTTT
GAAGGGCCTTTATCTGAATATGGGGAATGTGGTTTATTCGGTGATCTATT
TTTGTACGCTCTCCGTACGTACAACATGATCTGTTTGGGTCTCTACCGAT
TCCGAGATTCGCAACGTATGAAGGACAAAATACCAAGCACGAAACGTTAC
GTCATCACGTTCCCGCCctttaattttgttttggatCCAACTGATCTGGT
CTTTGTTTTAATGCAGTTCGAAAAACCGAAACGTAAAAGGAAATCTGTGT
CTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCGctttttaaATGGCG
AGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCAGATGAACGGAAATG
GCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCCGgtttaattt
taattatcatcGGACGTATTTTGTTATATTTCTTCCATGGCGCTAAAAGA
AGATCGAATAGTGTGATTGATATGAATGAGGTGGACGAATTGGAGGAAGA
GGAATTCTTCTTGGAAGATTTAGAACAAGGATGGTATTTAGATTTGAAAG
AAGGTGCTGGCAATCTTGTGTCTGCTCAAACATTACAAGGACGTATATTG
GTTGTTTTGTCGTTTGTATTCAACTTGGCAGAATGCGCACTCTATATCAC
AGAAACAGGATATCCAATCGAGCATTGTTTGGATTTGTCCGATCAAACAT
TATGGAGAGTTGAAATTTGTTTGAAcgctttcttcatttttcattttctc
attcGGTTCATTGCGGCGAACGACAAATTATCTTTTTGGGCAATGGAACC
TTTAACGTACGTTGATATTGTGACTGTACCAGCCGTCTTTGTGGCTGTCT
ATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTACGTGTCATCTATTTG
ATCAACTTGGCAGATATCCTACAATTTCTCAACGTACTCCACACAGGTTC
AAGTCTTGAGATGGCACAGATGATTGGTAATTTCTTGGCTTTGACTCTGG
CGTCAGCTGGTATTGTTCATTTGttgGAGAACACTGGTGATCCATGGGAG
CCTATCAACTACACCAACAAACAGAAATTGAATTACTTCGAATGTCTCTA
TTTTCTATTCGTAACCATGTCAACGGTTGGTTATGGTGATATATATTGTC
ATACGTATCTTGGAAGGTTGTTTAATATTGGTTTCATCTCTGTTGGCCTG
gGTCTATTTACATCATACCTACCAGCTATCCAAGAATTCTTAGCTTCACA
TACGAAATATGATAGAGCTTTCAAGCCTACACCAGGGAAAAGGCATGTCA
TTGTTGCCGGATACATCACCGAAGAAAGTGTGACtgggtttttcaaagat
ttcttgCATCCTGATCGAGAAGATAGTCAAACCACTGTCGTTATATTGTC
ACCGAAATATCCGAGTTTGAAGATGCAAGCCGACTTGCAAAGACATTGTA
CAAAAGCTTCATATTTTATTGGCACCATCTACAAGTTCATGGACTGCCAT
CGGACTAGGATGCGAGAAGCAGATGCAGTCATTATTCTTTGTAACAAGAA
ATGTATAAGTCCCGATGAAGAAGACGCCGCTAACATTACAAGGGTGATTT
CAGTGAAGAATTATCACGAGAACATTCGATGTATCGTACAACTCATGATG
AACAAAAACAAGTCACATTTATTGAATTGTCCACAATGGAATCGGGAACT
TGGTGATGACATCATTTGCATTGATGAGttGAAACTTGGATTCGTGGCAC
AAAGTTGTAATGCACCTGGATTCTCAACGTTGCTGGCAAATCTATTCGCT
ATGAGGAGCGATACGATAAGCGAGGAGATTCAAGAATCAGAGAAATGGAA
AGTAGCGTACATGATTGGTGCAGCAAATGAGATGTACACAGCTCAACTAT
CGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAGTAGAattatgtttt
gaaaaattgaatttaatgtTGATTGCCATcgaaatgaaaatctcaaaaaa
agagCGATACTTTGCTATCAATCCCAATGACAAGAAGTTGAGACTTTTAC
CAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCAGCGATGTTGCGAAA
GCATCGAAATATTGTGCGAAGTGTCACAAAGACCTTCAAGATCCTGAACG
AATGGTCAAATGTAAATGCAGACGACGTATGAAACAAGAACAGGAAAAGA
AGAATCCAGCTCAGAAAGGAAAATACGAAACAAAAGTCGATGTTGATCCA
GTGCATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGGATAAACAATC
ATTGACGGGAGACTATTTTGCAAGTGGTGAAAAACCAAAGTTTGACCAAA
GTGGGACGTTTTATTGGTGCGAAACAAGAAGCTACATATCTGCCAGGAtg
AGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAACCATGTTGTTGTGTT
GGTTTTATCACAACGTCTTTCACCACCGCTTGGTTTAAGACAACTTGTAC
TTCCATTGCGTGCAAGCAATCGTCTGCCGCACGATGTCAAAAAAGTTGTC
ATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgGCCGACGCTGGCGAA
TTTCCCTGATGTTGACATCGTACCTGGTTCGCCTTACAACCGTTCCGATT
TACGGGCAGTCAATGTGAATACAGCGGACATGTGTATTTTGTTATCACCC
GGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTGATAAAGAAGT
CATCCTGGTTACTTTGAATTTGAaagCCATGACTTTTGACGAATCAGAAC
TAGCAGTCACGGAGGAGATCAAGAAAGTCGATTCGTCACGAGGAACTTCT
ATCAACGGTGAAAGTTCTGCCGATGTACGGGTGGGATTCTCATCGGGCGC
CAATTCAAGGGCGGCCACCCGTATGACTGGACGCCCTGAAACTTCAATGT
CTCACATGACAGCGGGCGGTAATAGTATGATACAAGAAGTCAAGAAAACG
TTTAAAGGAGCTTTGAATGGAGCTAACATCCCTATGATCACTGAACTTGT
ATGTGATTCGAATGCGATGTACATTGATCAAGATGATATGAACATCTATG
ATGATGATGGAATCTTTTTAACGCAACCGTACGCTTGCGGCTCCGCTTTC
ACCGTATCGGTTCTCGATTCACTCGTCAGTGCGACATATTTCAACAGTGA
CGTATTAACACTTGTCCGTAATCTGGTCACCGGTTCTGTGAGTCCGGAAC
TGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGTACGAAACA
CAAGAGATTGCCGCTGTCAGGAACAGATGTCGGGTGGCACAAATTTCTTT
GTTTGAAGGGCCTTTATCTGAATATGGGGAATGTGGTTTATTCGGTGATC
TATTTTTGTACGCTCTCCGTACGTACAACATGATCTGTTTGGGTCTCTAC
CGATTCCGAGATTCGCAACGTATGAAGGACAAAATACCAAGCACGAAACG
TTACGTCATCACGTTCCCGCCctttaattttgttttggatCCAACTGATC
TGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAACGTAAAAGGAAATCT
GTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCGctttttaaAT
GGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCAGATGAACGGA
AATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCCGgttta
attttaattatcatcGGACGTATTTTGTTATATTTCTTCCATGGCGCTAA
AAGAAGATCGAATAGTGTGATTGATATGAATGAGGTGGACGAATTGGAGG
AAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGATGGTATTTAGATTTG
AAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACATTACAAGGACGTAT
ATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGAATGCGCACTCTATA
TCACAGAAACAGGATATCCAATCGAGCATTGTTTGGATTTGTCCGATCAA
ACATTATGGAGAGTTGAAATTTGTTTGAAcgctttcttcatttttcattt
tctcattcGGTTCATTGCGGCGAACGACAAATTATCTTTTTGGGCAATGG
AACCTTTAACGTACGTTGATATTGTGACTGTACCAGCCGTCTTTGTGGCT
GTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTACGTGTCATCTA
TTTGATCAACTTGGCAGATATCCTACAATTTCTCAACGTACTCCACACAG
GTTCAAGTCTTGAGATGGCACAGATGATTGGTAATTTCTTGGCTTTGACT
CTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAACACTGGTGATCCATG
GGAGCCTATCAACTACACCAACAAACAGAAATTGAATTACTTCGAATGTC
TCTATTTTCTATTCGTAACCATGTCAACGGTTGGTTATGGTGATATATAT
TGTCATACGTATCTTGGAAGGTTGTTTAATATTGGTTTCATCTCTGTTGG
CCTGgGTCTATTTACATCATACCTACCAGCTATCCAAGAATTCTTAGCTT
CACATACGAAATATGATAGAGCTTTCAAGCCTACACCAGGGAAAAGGCAT
GTCATTGTTGCCGGATACATCACCGAAGAAAGTGTGACtgggtttttcaa
agatttcttgCATCCTGATCGAGAAGATAGTCAAACCACTGTCGTTATAT
TGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCGACTTGCAAAGACAT
TGTACAAAAGCTTCATATTTTATTGGCACCATCTACAAGTTCATGGACTG
CCATCGGACTAGGATGCGAGAAGCAGATGCAGTCATTATTCTTTGTAACA
AGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAACATTACAAGGGTG
ATTTCAGTGAAGAATTATCACGAGAACATTCGATGTATCGTACAACTCAT
GATGAACAAAAACAAGTCACATTTATTGAATTGTCCACAATGGAATCGGG
AACTTGGTGATGACATCATTTGCATTGATGAGttGAAACTTGGATTCGTG
GCACAAAGTTGTAATGCACCTGGATTCTCAACGTTGCTGGCAAATCTATT
CGCTATGAGGAGCGATACGATAAGCGAGGAGATTCAAGAATCAGAGAAAT
GGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGATGTACACAGCTCAA
CTATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAGTAGAattatg
ttttgaaaaattgaatttaatgtTGATTGCCATcgaaatgaaaatctcaa
aaaaagagCGATACTTTGCTATCAATCCCAATGACAAGAAGTTGAGACTT
TTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCAGCGATGTTGC
GAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGACCTTCAAGATCCTG
AACGAATGGTCAAATGTAAATGCAGACGACGTATGAAACAAGAACAGGAA
AAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACAAAAGTCGATGTTGA
TCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGGATAAAC
AATCATTGACGGGAGACTATTTTGCAAGTGGTGAAAAACCAAAGTTTGAC
CAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGCTACATATCTGCCAG
GAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAACCATGTTGTTG
TGTTGGTTTTATCACAACGTCTTTCACCACCGCTTGGTTTAAGACAACTT
GTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCACGATGTCAAAAAAGT
TGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgGCCGACGCTGG
CGAATTTCCCTGATGTTGACATCGTACCTGGTTCGCCTTACAACCGTTCC
GATTTACGGGCAGTCAATGTGAATACAGCGGACATGTGTATTTTGTTATC
ACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTGATAAAG
AAGTCATCCTGGTTACTTTGAATTTGAaagCCATGACTTTTGACGAATCA
GAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGATTCGTCACGAGGAAC
TTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGTGGGATTCTCATCGG
GCGCCAATTCAAGGGCGGCCACCCGTATGACTGGACGCCCTGAAACTTCA
ATGTCTCACATGACAGCGGGCGGTAATAGTATGATACAAGAAGTCAAGAA
AACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCCTATGATCACTGAAC
TTGTATGTGATTCGAATGCGATGTACATTGATCAAGATGATATGAACATC
TATGATGATGATGGAATCTTTTTAACGCAACCGTACGCTTGCGGCTCCGC
TTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGCGACATATTTCAACA
GTGACGTATTAACACTTGTCCGTAATCTGGTCACCGGTTCTGTGAGTCCG
GAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGTACGA
AACACAAGAGATTGCCGCTGTCAGGAACAGATGTCGGGTGGCACAAATTT
CTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAATGTGGTTTATTCGGT
GATCTATTTTTGTACGCTCTCCGTACGTACAACATGATCTGTTTGGGTCT
CTACCGATTCCGAGATTCGCAACGTATGAAGGACAAAATACCAAGCACGA
AACGTTACGTCATCACGTTCCCGCCctttaattttgttttggatCCAACT
GATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAACGTAAAAGGAA
ATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCGcttttt
aaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCAGATGAA
CGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCCGg
tttaattttaattatcatcGGACGTATTTTGTTATATTTCTTCCATGGCG
CTAAAAGAAGATCGAATAGTGTGATTGATATGAATGAGGTGGACGAATTG
GAGGAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGATGGTATTTAGA
TTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACATTACAAGGAC
GTATATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGAATGCGCACTC
TATATCACAGAAACAGGATATCCAATCGAGCATTGTTTGGATTTGTCCGA
TCAAACATTATGGAGAGTTGAAATTTGTTTGAAcgctttcttcatttttc
attttctcattcGGTTCATTGCGGCGAACGACAAATTATCTTTTTGGGCA
ATGGAACCTTTAACGTACGTTGATATTGTGACTGTACCAGCCGTCTTTGT
GGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTACGTGTCA
TCTATTTGATCAACTTGGCAGATATCCTACAATTTCTCAACGTACTCCAC
ACAGGTTCAAGTCTTGAGATGGCACAGATGATTGGTAATTTCTTGGCTTT
GACTCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAACACTGGTGATC
CATGGGAGCCTATCAACTACACCAACAAACAGAAATTGAATTACTTCGAA
TGTCTCTATTTTCTATTCGTAACCATGTCAACGGTTGGTTATGGTGATAT
ATATTGTCATACGTATCTTGGAAGGTTGTTTAATATTGGTTTCATCTCTG
TTGGCCTGgGTCTATTTACATCATACCTACCAGCTATCCAAGAATTCTTA
GCTTCACATACGAAATATGATAGAGCTTTCAAGCCTACACCAGGGAAAAG
GCATGTCATTGTTGCCGGATACATCACCGAAGAAAGTGTGACtgggtttt
tcaaagatttcttgCATCCTGATCGAGAAGATAGTCAAACCACTGTCGTT
ATATTGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCGACTTGCAAAG
ACATTGTACAAAAGCTTCATATTTTATTGGCACCATCTACAAGTTCATGG
ACTGCCATCGGACTAGGATGCGAGAAGCAGATGCAGTCATTATTCTTTGT
AACAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAACATTACAAG
GGTGATTTCAGTGAAGAATTATCACGAGAACATTCGATGTATCGTACAAC
TCATGATGAACAAAAACAAGTCACATTTATTGAATTGTCCACAATGGAAT
CGGGAACTTGGTGATGACATCATTTGCATTGATGAGttGAAACTTGGATT
CGTGGCACAAAGTTGTAATGCACCTGGATTCTCAACGTTGCTGGCAAATC
TATTCGCTATGAGGAGCGATACGATAAGCGAGGAGATTCAAGAATCAGAG
AAATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGATGTACACAGC
TCAACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAGTAGAat
tatgttttgaaaaattgaatttaatgtTGATTGCCATcgaaatgaaaatc
tcaaaaaaagagCGATACTTTGCTATCAATCCCAATGACAAGAAGTTGAG
ACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCAGCGATG
TTGCGAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGACCTTCAAGAT
CCTGAACGAATGGTCAAATGTAAATGCAGACGACGTATGAAACAAGAACA
GGAAAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACAAAAGTCGATG
TTGATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGGAT
AAACAATCATTGACGGGAGACTATTTTGCAAGTGGTGAAAAACCAAAGTT
TGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGCTACATATCTG
CCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAACCATGTT
GTTGTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTGGTTTAAGACA
ACTTGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCACGATGTCAAAA
AAGTTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgGCCGACG
CTGGCGAATTTCCCTGATGTTGACATCGTACCTGGTTCGCCTTACAACCG
TTCCGATTTACGGGCAGTCAATGTGAATACAGCGGACATGTGTATTTTGT
TATCACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTGAT
AAAGAAGTCATCCTGGTTACTTTGAATTTGAaagCCATGACTTTTGACGA
ATCAGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGATTCGTCACGAG
GAACTTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGTGGGATTCTCA
TCGGGCGCCAATTCAAGGGCGGCCACCCGTATGACTGGACGCCCTGAAAC
TTCAATGTCTCACATGACAGCGGGCGGTAATAGTATGATACAAGAAGTCA
AGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCCTATGATCACT
GAACTTGTATGTGATTCGAATGCGATGTACATTGATCAAGATGATATGAA
CATCTATGATGATGATGGAATCTTTTTAACGCAACCGTACGCTTGCGGCT
CCGCTTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGCGACATATTTC
AACAGTGACGTATTAACACTTGTCCGTAATCTGGTCACCGGTTCTGTGAG
TCCGGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGT
ACGAAACACAAGAGATTGCCGCTGTCAGGAACAGATGTCGGGTGGCACAA
ATTTCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAATGTGGTTTATT
CGGTGATCTATTTTTGTACGCTCTCCGTACGTACAACATGATCTGTTTGG
GTCTCTACCGATTCCGAGATTCGCAACGTATGAAGGACAAAATACCAAGC
ACGAAACGTTACGTCATCACGTTCCCGCCctttaattttgttttggatCC
AACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAACGTAAAA
GGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCGct
ttttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCAGA
TGAACGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTT
CCGgtttaattttaattatcatcGGACGTATTTTGTTATATTTCTTCCAT
GGCGCTAAAAGAAGATCGAATAGTGTGATTGATATGAATGAGGTGGACGA
ATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGATGGTATT
TAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACATTACAA
GGACGTATATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGAATGCGC
ACTCTATATCACAGAAACAGGATATCCAATCGAGCATTGTTTGGATTTGT
CCGATCAAACATTATGGAGAGTTGAAATTTGTTTGAAcgctttcttcatt
tttcattttctcattcGGTTCATTGCGGCGAACGACAAATTATCTTTTTG
GGCAATGGAACCTTTAACGTACGTTGATATTGTGACTGTACCAGCCGTCT
TTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTACGT
GTCATCTATTTGATCAACTTGGCAGATATCCTACAATTTCTCAACGTACT
CCACACAGGTTCAAGTCTTGAGATGGCACAGATGATTGGTAATTTCTTGG
CTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAACACTGGT
GATCCATGGGAGCCTATCAACTACACCAACAAACAGAAATTGAATTACTT
CGAATGTCTCTATTTTCTATTCGTAACCATGTCAACGGTTGGTTATGGTG
ATATATATTGTCATACGTATCTTGGAAGGTTGTTTAATATTGGTTTCATC
TCTGTTGGCCTGgGTCTATTTACATCATACCTACCAGCTATCCAAGAATT
CTTAGCTTCACATACGAAATATGATAGAGCTTTCAAGCCTACACCAGGGA
AAAGGCATGTCATTGTTGCCGGATACATCACCGAAGAAAGTGTGACtggg
tttttcaaagatttcttgCATCCTGATCGAGAAGATAGTCAAACCACTGT
CGTTATATTGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCGACTTGC
AAAGACATTGTACAAAAGCTTCATATTTTATTGGCACCATCTACAAGTTC
ATGGACTGCCATCGGACTAGGATGCGAGAAGCAGATGCAGTCATTATTCT
TTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAACATTA
CAAGGGTGATTTCAGTGAAGAATTATCACGAGAACATTCGATGTATCGTA
CAACTCATGATGAACAAAAACAAGTCACATTTATTGAATTGTCCACAATG
GAATCGGGAACTTGGTGATGACATCATTTGCATTGATGAGttGAAACTTG
GATTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCAACGTTGCTGGCA
AATCTATTCGCTATGAGGAGCGATACGATAAGCGAGGAGATTCAAGAATC
AGAGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGATGTACA
CAGCTCAACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAGTA
GAattatgttttgaaaaattgaatttaatgtTGATTGCCATcgaaatgaa
aatctcaaaaaaagagCGATACTTTGCTATCAATCCCAATGACAAGAAGT
TGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCAGC
GATGTTGCGAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGACCTTCA
AGATCCTGAACGAATGGTCAAATGTAAATGCAGACGACGTATGAAACAAG
AACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACAAAAGTC
GATGTTGATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAA
GGATAAACAATCATTGACGGGAGACTATTTTGCAAGTGGTGAAAAACCAA
AGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGCTACATA
TCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAACCA
TGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTGGTTTAA
GACAACTTGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCACGATGTC
AAAAAAGTTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgGCC
GACGCTGGCGAATTTCCCTGATGTTGACATCGTACCTGGTTCGCCTTACA
ACCGTTCCGATTTACGGGCAGTCAATGTGAATACAGCGGACATGTGTATT
TTGTTATCACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTC
TGATAAAGAAGTCATCCTGGTTACTTTGAATTTGAaagCCATGACTTTTG
ACGAATCAGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGATTCGTCA
CGAGGAACTTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGTGGGATT
CTCATCGGGCGCCAATTCAAGGGCGGCCACCCGTATGACTGGACGCCCTG
AAACTTCAATGTCTCACATGACAGCGGGCGGTAATAGTATGATACAAGAA
GTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCCTATGAT
CACTGAACTTGTATGTGATTCGAATGCGATGTACATTGATCAAGATGATA
TGAACATCTATGATGATGATGGAATCTTTTTAACGCAACCGTACGCTTGC
GGCTCCGCTTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGCGACATA
TTTCAACAGTGACGTATTAACACTTGTCCGTAATCTGGTCACCGGTTCTG
TGAGTCCGGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGT
TCGTACGAAACACAAGAGATTGCCGCTGTCAGGAACAGATGTCGGGTGGC
ACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAATGTGGTT
TATTCGGTGATCTATTTTTGTACGCTCTCCGTACGTACAACATGATCTGT
TTGGGTCTCTACCGATTCCGAGATTCGCAACGTATGAAGGACAAAATACC
AAGCACGAAACGTTACGTCATCACGTTCCCGCCctttaattttgttttgg
atCCAACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAACGT
AAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGG
CGctttttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGG
CAGATGAACGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTT
AGTTCCGgtttaattttaattatcatcGGACGTATTTTGTTATATTTCTT
CCATGGCGCTAAAAGAAGATCGAATAGTGTGATTGATATGAATGAGGTGG
ACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGATGG
TATTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACATT
ACAAGGACGTATATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGAAT
GCGCACTCTATATCACAGAAACAGGATATCCAATCGAGCATTGTTTGGAT
TTGTCCGATCAAACATTATGGAGAGTTGAAATTTGTTTGAAcgctttctt
catttttcattttctcattcGGTTCATTGCGGCGAACGACAAATTATCTT
TTTGGGCAATGGAACCTTTAACGTACGTTGATATTGTGACTGTACCAGCC
GTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCT
ACGTGTCATCTATTTGATCAACTTGGCAGATATCCTACAATTTCTCAACG
TACTCCACACAGGTTCAAGTCTTGAGATGGCACAGATGATTGGTAATTTC
TTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAACAC
TGGTGATCCATGGGAGCCTATCAACTACACCAACAAACAGAAATTGAATT
ACTTCGAATGTCTCTATTTTCTATTCGTAACCATGTCAACGGTTGGTTAT
GGTGATATATATTGTCATACGTATCTTGGAAGGTTGTTTAATATTGGTTT
CATCTCTGTTGGCCTGgGTCTATTTACATCATACCTACCAGCTATCCAAG
AATTCTTAGCTTCACATACGAAATATGATAGAGCTTTCAAGCCTACACCA
GGGAAAAGGCATGTCATTGTTGCCGGATACATCACCGAAGAAAGTGTGAC
tgggtttttcaaagatttcttgCATCCTGATCGAGAAGATAGTCAAACCA
CTGTCGTTATATTGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCGAC
TTGCAAAGACATTGTACAAAAGCTTCATATTTTATTGGCACCATCTACAA
GTTCATGGACTGCCATCGGACTAGGATGCGAGAAGCAGATGCAGTCATTA
TTCTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAAC
ATTACAAGGGTGATTTCAGTGAAGAATTATCACGAGAACATTCGATGTAT
CGTACAACTCATGATGAACAAAAACAAGTCACATTTATTGAATTGTCCAC
AATGGAATCGGGAACTTGGTGATGACATCATTTGCATTGATGAGttGAAA
CTTGGATTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCAACGTTGCT
GGCAAATCTATTCGCTATGAGGAGCGATACGATAAGCGAGGAGATTCAAG
AATCAGAGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGATG
TACACAGCTCAACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGC
AGTAGAattatgttttgaaaaattgaatttaatgtTGATTGCCATcgaaa
tgaaaatctcaaaaaaagagCGATACTTTGCTATCAATCCCAATGACAAG
AAGTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGC
CAGCGATGTTGCGAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGACC
TTCAAGATCCTGAACGAATGGTCAAATGTAAATGCAGACGACGTATGAAA
CAAGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACAAA
AGTCGATGTTGATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGCTA
AAAAGGATAAACAATCATTGACGGGAGACTATTTTGCAAGTGGTGAAAAA
CCAAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGCTA
CATATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGA
ACCATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTGGT
TTAAGACAACTTGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCACGA
TGTCAAAAAAGTTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGt
gGCCGACGCTGGCGAATTTCCCTGATGTTGACATCGTACCTGGTTCGCCT
TACAACCGTTCCGATTTACGGGCAGTCAATGTGAATACAGCGGACATGTG
TATTTTGTTATCACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTC
TCTCTGATAAAGAAGTCATCCTGGTTACTTTGAATTTGAaagCCATGACT
TTTGACGAATCAGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGATTC
GTCACGAGGAACTTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGTGG
GATTCTCATCGGGCGCCAATTCAAGGGCGGCCACCCGTATGACTGGACGC
CCTGAAACTTCAATGTCTCACATGACAGCGGGCGGTAATAGTATGATACA
AGAAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCCTA
TGATCACTGAACTTGTATGTGATTCGAATGCGATGTACATTGATCAAGAT
GATATGAACATCTATGATGATGATGGAATCTTTTTAACGCAACCGTACGC
TTGCGGCTCCGCTTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGCGA
CATATTTCAACAGTGACGTATTAACACTTGTCCGTAATCTGGTCACCGGT
TCTGTGAGTCCGGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTC
CGGTTCGTACGAAACACAAGAGATTGCCGCTGTCAGGAACAGATGTCGGG
TGGCACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAATGT
GGTTTATTCGGTGATCTATTTTTGTACGCTCTCCGTACGTACAACATGAT
CTGTTTGGGTCTCTACCGATTCCGAGATTCGCAACGTATGAAGGACAAAA
TACCAAGCACGAAACGTTACGTCATCACGTTCCCGCCctttaattttgtt
ttggatCCAACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAA
ACGTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTT
CAGGCGctttttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATC
CCGGCAGATGAACGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAAT
CTTTAGTTCCGgtttaattttaattatcatcGGACGTATTTTGTTATATT
TCTTCCATGGCGCTAAAAGAAGATCGAATAGTGTGATTGATATGAATGAG
GTGGACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGG
ATGGTATTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAA
CATTACAAGGACGTATATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCA
GAATGCGCACTCTATATCACAGAAACAGGATATCCAATCGAGCATTGTTT
GGATTTGTCCGATCAAACATTATGGAGAGTTGAAATTTGTTTGAAcgctt
tcttcatttttcattttctcattcGGTTCATTGCGGCGAACGACAAATTA
TCTTTTTGGGCAATGGAACCTTTAACGTACGTTGATATTGTGACTGTACC
AGCCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCT
TTCTACGTGTCATCTATTTGATCAACTTGGCAGATATCCTACAATTTCTC
AACGTACTCCACACAGGTTCAAGTCTTGAGATGGCACAGATGATTGGTAA
TTTCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGA
ACACTGGTGATCCATGGGAGCCTATCAACTACACCAACAAACAGAAATTG
AATTACTTCGAATGTCTCTATTTTCTATTCGTAACCATGTCAACGGTTGG
TTATGGTGATATATATTGTCATACGTATCTTGGAAGGTTGTTTAATATTG
GTTTCATCTCTGTTGGCCTGgGTCTATTTACATCATACCTACCAGCTATC
CAAGAATTCTTAGCTTCACATACGAAATATGATAGAGCTTTCAAGCCTAC
ACCAGGGAAAAGGCATGTCATTGTTGCCGGATACATCACCGAAGAAAGTG
TGACtgggtttttcaaagatttcttgCATCCTGATCGAGAAGATAGTCAA
ACCACTGTCGTTATATTGTCACCGAAATATCCGAGTTTGAAGATGCAAGC
CGACTTGCAAAGACATTGTACAAAAGCTTCATATTTTATTGGCACCATCT
ACAAGTTCATGGACTGCCATCGGACTAGGATGCGAGAAGCAGATGCAGTC
ATTATTCTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGC
TAACATTACAAGGGTGATTTCAGTGAAGAATTATCACGAGAACATTCGAT
GTATCGTACAACTCATGATGAACAAAAACAAGTCACATTTATTGAATTGT
CCACAATGGAATCGGGAACTTGGTGATGACATCATTTGCATTGATGAGtt
GAAACTTGGATTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCAACGT
TGCTGGCAAATCTATTCGCTATGAGGAGCGATACGATAAGCGAGGAGATT
CAAGAATCAGAGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGA
GATGTACACAGCTCAACTATCGAATGCTTTCATTGGAATGTCCTTCCCAC
AAGCAGTAGAattatgttttgaaaaattgaatttaatgtTGATTGCCATc
gaaatgaaaatctcaaaaaaagagCGATACTTTGCTATCAATCCCAATGA
CAAGAAGTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAG
ACGCCAGCGATGTTGCGAAAGCATCGAAATATTGTGCGAAGTGTCACAAA
GACCTTCAAGATCCTGAACGAATGGTCAAATGTAAATGCAGACGACGTAT
GAAACAAGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAA
CAAAAGTCGATGTTGATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAA
GCTAAAAAGGATAAACAATCATTGACGGGAGACTATTTTGCAAGTGGTGA
AAAACCAAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAA
GCTACATATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTC
AAGAACCATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACCACCGCT
TGGTTTAAGACAACTTGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGC
ACGATGTCAAAAAAGTTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGC
GAGtgGCCGACGCTGGCGAATTTCCCTGATGTTGACATCGTACCTGGTTC
GCCTTACAACCGTTCCGATTTACGGGCAGTCAATGTGAATACAGCGGACA
TGTGTATTTTGTTATCACCCGGACATGGTAGCGAGGAAGATGAGCACCAA
GCTCTCTCTGATAAAGAAGTCATCCTGGTTACTTTGAATTTGAaagCCAT
GACTTTTGACGAATCAGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCG
ATTCGTCACGAGGAACTTCTATCAACGGTGAAAGTTCTGCCGATGTACGG
GTGGGATTCTCATCGGGCGCCAATTCAAGGGCGGCCACCCGTATGACTGG
ACGCCCTGAAACTTCAATGTCTCACATGACAGCGGGCGGTAATAGTATGA
TACAAGAAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAACATC
CCTATGATCACTGAACTTGTATGTGATTCGAATGCGATGTACATTGATCA
AGATGATATGAACATCTATGATGATGATGGAATCTTTTTAACGCAACCGT
ACGCTTGCGGCTCCGCTTTCACCGTATCGGTTCTCGATTCACTCGTCAGT
GCGACATATTTCAACAGTGACGTATTAACACTTGTCCGTAATCTGGTCAC
CGGTTCTGTGAGTCCGGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGC
CGTCCGGTTCGTACGAAACACAAGAGATTGCCGCTGTCAGGAACAGATGT
CGGGTGGCACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGA
ATGTGGTTTATTCGGTGATCTATTTTTGTACGCTCTCCGTACGTACAACA
TGATCTGTTTGGGTCTCTACCGATTCCGAGATTCGCAACGTATGAAGGAC
AAAATACCAAGCACGAAACGTTACGTCATCACGTTCCCGCCctttaattt
tgttttggatCCAACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAAC
CGAAACGTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGA
TTTTCAGGCGctttttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGA
GATCCCGGCAGATGAACGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGT
TAATCTTTAGTTCCGgtttaattttaattatcatcGGACGTATTTTGTTA
TATTTCTTCCATGGCGCTAAAAGAAGATCGAATAGTGTGATTGATATGAA
TGAGGTGGACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGAAC
AAGGATGGTATTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCT
CAAACATTACAAGGACGTATATTGGTTGTTTTGTCGTTTGTATTCAACTT
GGCAGAATGCGCACTCTATATCACAGAAACAGGATATCCAATCGAGCATT
GTTTGGATTTGTCCGATCAAACATTATGGAGAGTTGAAATTTGTTTGAAc
gctttcttcatttttcattttctcattcGGTTCATTGCGGCGAACGACAA
ATTATCTTTTTGGGCAATGGAACCTTTAACGTACGTTGATATTGTGACTG
TACCAGCCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTC
CGCTTTCTACGTGTCATCTATTTGATCAACTTGGCAGATATCCTACAATT
TCTCAACGTACTCCACACAGGTTCAAGTCTTGAGATGGCACAGATGATTG
GTAATTTCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGttg
GAGAACACTGGTGATCCATGGGAGCCTATCAACTACACCAACAAACAGAA
ATTGAATTACTTCGAATGTCTCTATTTTCTATTCGTAACCATGTCAACGG
TTGGTTATGGTGATATATATTGTCATACGTATCTTGGAAGGTTGTTTAAT
ATTGGTTTCATCTCTGTTGGCCTGgGTCTATTTACATCATACCTACCAGC
TATCCAAGAATTCTTAGCTTCACATACGAAATATGATAGAGCTTTCAAGC
CTACACCAGGGAAAAGGCATGTCATTGTTGCCGGATACATCACCGAAGAA
AGTGTGACtgggtttttcaaagatttcttgCATCCTGATCGAGAAGATAG
TCAAACCACTGTCGTTATATTGTCACCGAAATATCCGAGTTTGAAGATGC
AAGCCGACTTGCAAAGACATTGTACAAAAGCTTCATATTTTATTGGCACC
ATCTACAAGTTCATGGACTGCCATCGGACTAGGATGCGAGAAGCAGATGC
AGTCATTATTCTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGACG
CCGCTAACATTACAAGGGTGATTTCAGTGAAGAATTATCACGAGAACATT
CGATGTATCGTACAACTCATGATGAACAAAAACAAGTCACATTTATTGAA
TTGTCCACAATGGAATCGGGAACTTGGTGATGACATCATTTGCATTGATG
AGttGAAACTTGGATTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCA
ACGTTGCTGGCAAATCTATTCGCTATGAGGAGCGATACGATAAGCGAGGA
GATTCAAGAATCAGAGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAA
ATGAGATGTACACAGCTCAACTATCGAATGCTTTCATTGGAATGTCCTTC
CCACAAGCAGTAGAattatgttttgaaaaattgaatttaatgtTGATTGC
CATcgaaatgaaaatctcaaaaaaagagCGATACTTTGCTATCAATCCCA
ATGACAAGAAGTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCT
CAAGACGCCAGCGATGTTGCGAAAGCATCGAAATATTGTGCGAAGTGTCA
CAAAGACCTTCAAGATCCTGAACGAATGGTCAAATGTAAATGCAGACGAC
GTATGAAACAAGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAATAC
GAAACAAAAGTCGATGTTGATCCAGTGCATTTGCTCGAAGCCGAACCCGA
TGAAGCTAAAAAGGATAAACAATCATTGACGGGAGACTATTTTGCAAGTG
GTGAAAAACCAAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACA
AGAAGCTACATATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAA
GTTCAAGAACCATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACCAC
CGCTTGGTTTAAGACAACTTGTACTTCCATTGCGTGCAAGCAATCGTCTG
CCGCACGATGTCAAAAAAGTTGTCATTCTTGGAGATGGAGATTTCTTAGC
TCGCGAGtgGCCGACGCTGGCGAATTTCCCTGATGTTGACATCGTACCTG
GTTCGCCTTACAACCGTTCCGATTTACGGGCAGTCAATGTGAATACAGCG
GACATGTGTATTTTGTTATCACCCGGACATGGTAGCGAGGAAGATGAGCA
CCAAGCTCTCTCTGATAAAGAAGTCATCCTGGTTACTTTGAATTTGAaag
CCATGACTTTTGACGAATCAGAACTAGCAGTCACGGAGGAGATCAAGAAA
GTCGATTCGTCACGAGGAACTTCTATCAACGGTGAAAGTTCTGCCGATGT
ACGGGTGGGATTCTCATCGGGCGCCAATTCAAGGGCGGCCACCCGTATGA
CTGGACGCCCTGAAACTTCAATGTCTCACATGACAGCGGGCGGTAATAGT
ATGATACAAGAAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAA
CATCCCTATGATCACTGAACTTGTATGTGATTCGAATGCGATGTACATTG
ATCAAGATGATATGAACATCTATGATGATGATGGAATCTTTTTAACGCAA
CCGTACGCTTGCGGCTCCGCTTTCACCGTATCGGTTCTCGATTCACTCGT
CAGTGCGACATATTTCAACAGTGACGTATTAACACTTGTCCGTAATCTGG
TCACCGGTTCTGTGAGTCCGGAACTGGACGAATTGTTAGCAGAAGGCAAG
CAGCCGTCCGGTTCGTACGAAACACAAGAGATTGCCGCTGTCAGGAACAG
ATGTCGGGTGGCACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAATATG
GGGAATGTGGTTTATTCGGTGATCTATTTTTGTACGCTCTCCGTACGTAC
AACATGATCTGTTTGGGTCTCTACCGATTCCGAGATTCGCAACGTATGAA
GGACAAAATACCAAGCACGAAACGTTACGTCATCACGTTCCCGCCcttta
attttgttttggatCCAACTGATCTGGTCTTTGTTTTAATGCAGTTCGAA
AAACCGAAACGTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTC
GCGATTTTCAGGCGctttttaaATGGCGAGTGCAGCTTGTCGTATTGAAG
TCGAGATCCCGGCAGATGAACGGAAATGGCCATGGTTTTTAGTGGTTTCC
GGGTTAATCTTTAGTTCCGgtttaattttaattatcatcGGACGTATTTT
GTTATATTTCTTCCATGGCGCTAAAAGAAGATCGAATAGTGTGATTGATA
TGAATGAGGTGGACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTA
GAACAAGGATGGTATTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTC
TGCTCAAACATTACAAGGACGTATATTGGTTGTTTTGTCGTTTGTATTCA
ACTTGGCAGAATGCGCACTCTATATCACAGAAACAGGATATCCAATCGAG
CATTGTTTGGATTTGTCCGATCAAACATTATGGAGAGTTGAAATTTGTTT
GAAcgctttcttcatttttcattttctcattcGGTTCATTGCGGCGAACG
ACAAATTATCTTTTTGGGCAATGGAACCTTTAACGTACGTTGATATTGTG
ACTGTACCAGCCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGg
tcTCCGCTTTCTACGTGTCATCTATTTGATCAACTTGGCAGATATCCTAC
AATTTCTCAACGTACTCCACACAGGTTCAAGTCTTGAGATGGCACAGATG
ATTGGTAATTTCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTT
GttgGAGAACACTGGTGATCCATGGGAGCCTATCAACTACACCAACAAAC
AGAAATTGAATTACTTCGAATGTCTCTATTTTCTATTCGTAACCATGTCA
ACGGTTGGTTATGGTGATATATATTGTCATACGTATCTTGGAAGGTTGTT
TAATATTGGTTTCATCTCTGTTGGCCTGgGTCTATTTACATCATACCTAC
CAGCTATCCAAGAATTCTTAGCTTCACATACGAAATATGATAGAGCTTTC
AAGCCTACACCAGGGAAAAGGCATGTCATTGTTGCCGGATACATCACCGA
AGAAAGTGTGACtgggtttttcaaagatttcttgCATCCTGATCGAGAAG
ATAGTCAAACCACTGTCGTTATATTGTCACCGAAATATCCGAGTTTGAAG
ATGCAAGCCGACTTGCAAAGACATTGTACAAAAGCTTCATATTTTATTGG
CACCATCTACAAGTTCATGGACTGCCATCGGACTAGGATGCGAGAAGCAG
ATGCAGTCATTATTCTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAA
GACGCCGCTAACATTACAAGGGTGATTTCAGTGAAGAATTATCACGAGAA
CATTCGATGTATCGTACAACTCATGATGAACAAAAACAAGTCACATTTAT
TGAATTGTCCACAATGGAATCGGGAACTTGGTGATGACATCATTTGCATT
GATGAGttGAAACTTGGATTCGTGGCACAAAGTTGTAATGCACCTGGATT
CTCAACGTTGCTGGCAAATCTATTCGCTATGAGGAGCGATACGATAAGCG
AGGAGATTCAAGAATCAGAGAAATGGAAAGTAGCGTACATGATTGGTGCA
GCAAATGAGATGTACACAGCTCAACTATCGAATGCTTTCATTGGAATGTC
CTTCCCACAAGCAGTAGAattatgttttgaaaaattgaatttaatgtTGA
TTGCCATcgaaatgaaaatctcaaaaaaagagCGATACTTTGCTATCAAT
CCCAATGACAAGAAGTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTT
CGCTCAAGACGCCAGCGATGTTGCGAAAGCATCGAAATATTGTGCGAAGT
GTCACAAAGACCTTCAAGATCCTGAACGAATGGTCAAATGTAAATGCAGA
CGACGTATGAAACAAGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAA
ATACGAAACAAAAGTCGATGTTGATCCAGTGCATTTGCTCGAAGCCGAAC
CCGATGAAGCTAAAAAGGATAAACAATCATTGACGGGAGACTATTTTGCA
AGTGGTGAAAAACCAAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGA
AACAAGAAGCTACATATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAA
GGAAGTTCAAGAACCATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCA
CCACCGCTTGGTTTAAGACAACTTGTACTTCCATTGCGTGCAAGCAATCG
TCTGCCGCACGATGTCAAAAAAGTTGTCATTCTTGGAGATGGAGATTTCT
TAGCTCGCGAGtgGCCGACGCTGGCGAATTTCCCTGATGTTGACATCGTA
CCTGGTTCGCCTTACAACCGTTCCGATTTACGGGCAGTCAATGTGAATAC
AGCGGACATGTGTATTTTGTTATCACCCGGACATGGTAGCGAGGAAGATG
AGCACCAAGCTCTCTCTGATAAAGAAGTCATCCTGGTTACTTTGAATTTG
AaagCCATGACTTTTGACGAATCAGAACTAGCAGTCACGGAGGAGATCAA
GAAAGTCGATTCGTCACGAGGAACTTCTATCAACGGTGAAAGTTCTGCCG
ATGTACGGGTGGGATTCTCATCGGGCGCCAATTCAAGGGCGGCCACCCGT
ATGACTGGACGCCCTGAAACTTCAATGTCTCACATGACAGCGGGCGGTAA
TAGTATGATACAAGAAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAG
CTAACATCCCTATGATCACTGAACTTGTATGTGATTCGAATGCGATGTAC
ATTGATCAAGATGATATGAACATCTATGATGATGATGGAATCTTTTTAAC
GCAACCGTACGCTTGCGGCTCCGCTTTCACCGTATCGGTTCTCGATTCAC
TCGTCAGTGCGACATATTTCAACAGTGACGTATTAACACTTGTCCGTAAT
CTGGTCACCGGTTCTGTGAGTCCGGAACTGGACGAATTGTTAGCAGAAGG
CAAGCAGCCGTCCGGTTCGTACGAAACACAAGAGATTGCCGCTGTCAGGA
ACAGATGTCGGGTGGCACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAA
TATGGGGAATGTGGTTTATTCGGTGATCTATTTTTGTACGCTCTCCGTAC
GTACAACATGATCTGTTTGGGTCTCTACCGATTCCGAGATTCGCAACGTA
TGAAGGACAAAATACCAAGCACGAAACGTTACGTCATCACGTTCCCGCCc
tttaattttgttttggatCCAACTGATCTGGTCTTTGTTTTAATGCAGTT
CGAAAAACCGAAACGTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGG
CGTCGCGATTTTCAGGCGctttttaaATGGCGAGTGCAGCTTGTCGTATT
GAAGTCGAGATCCCGGCAGATGAACGGAAATGGCCATGGTTTTTAGTGGT
TTCCGGGTTAATCTTTAGTTCCGgtttaattttaattatcatcGGACGTA
TTTTGTTATATTTCTTCCATGGCGCTAAAAGAAGATCGAATAGTGTGATT
GATATGAATGAGGTGGACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGA
TTTAGAACAAGGATGGTATTTAGATTTGAAAGAAGGTGCTGGCAATCTTG
TGTCTGCTCAAACATTACAAGGACGTATATTGGTTGTTTTGTCGTTTGTA
TTCAACTTGGCAGAATGCGCACTCTATATCACAGAAACAGGATATCCAAT
CGAGCATTGTTTGGATTTGTCCGATCAAACATTATGGAGAGTTGAAATTT
GTTTGAAcgctttcttcatttttcattttctcattcGGTTCATTGCGGCG
AACGACAAATTATCTTTTTGGGCAATGGAACCTTTAACGTACGTTGATAT
TGTGACTGTACCAGCCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGC
TAGgtcTCCGCTTTCTACGTGTCATCTATTTGATCAACTTGGCAGATATC
CTACAATTTCTCAACGTACTCCACACAGGTTCAAGTCTTGAGATGGCACA
GATGATTGGTAATTTCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTC
ATTTGttgGAGAACACTGGTGATCCATGGGAGCCTATCAACTACACCAAC
AAACAGAAATTGAATTACTTCGAATGTCTCTATTTTCTATTCGTAACCAT
GTCAACGGTTGGTTATGGTGATATATATTGTCATACGTATCTTGGAAGGT
TGTTTAATATTGGTTTCATCTCTGTTGGCCTGgGTCTATTTACATCATAC
CTACCAGCTATCCAAGAATTCTTAGCTTCACATACGAAATATGATAGAGC
TTTCAAGCCTACACCAGGGAAAAGGCATGTCATTGTTGCCGGATACATCA
CCGAAGAAAGTGTGACtgggtttttcaaagatttcttgCATCCTGATCGA
GAAGATAGTCAAACCACTGTCGTTATATTGTCACCGAAATATCCGAGTTT
GAAGATGCAAGCCGACTTGCAAAGACATTGTACAAAAGCTTCATATTTTA
TTGGCACCATCTACAAGTTCATGGACTGCCATCGGACTAGGATGCGAGAA
GCAGATGCAGTCATTATTCTTTGTAACAAGAAATGTATAAGTCCCGATGA
AGAAGACGCCGCTAACATTACAAGGGTGATTTCAGTGAAGAATTATCACG
AGAACATTCGATGTATCGTACAACTCATGATGAACAAAAACAAGTCACAT
TTATTGAATTGTCCACAATGGAATCGGGAACTTGGTGATGACATCATTTG
CATTGATGAGttGAAACTTGGATTCGTGGCACAAAGTTGTAATGCACCTG
GATTCTCAACGTTGCTGGCAAATCTATTCGCTATGAGGAGCGATACGATA
AGCGAGGAGATTCAAGAATCAGAGAAATGGAAAGTAGCGTACATGATTGG
TGCAGCAAATGAGATGTACACAGCTCAACTATCGAATGCTTTCATTGGAA
TGTCCTTCCCACAAGCAGTAGAattatgttttgaaaaattgaatttaatg
tTGATTGCCATcgaaatgaaaatctcaaaaaaagagCGATACTTTGCTAT
CAATCCCAATGACAAGAAGTTGAGACTTTTACCAGGAACGCGTGGTTTCT
TTTTCGCTCAAGACGCCAGCGATGTTGCGAAAGCATCGAAATATTGTGCG
AAGTGTCACAAAGACCTTCAAGATCCTGAACGAATGGTCAAATGTAAATG
CAGACGACGTATGAAACAAGAACAGGAAAAGAAGAATCCAGCTCAGAAAG
GAAAATACGAAACAAAAGTCGATGTTGATCCAGTGCATTTGCTCGAAGCC
GAACCCGATGAAGCTAAAAAGGATAAACAATCATTGACGGGAGACTATTT
TGCAAGTGGTGAAAAACCAAAGTTTGACCAAAGTGGGACGTTTTATTGGT
GCGAAACAAGAAGCTACATATCTGCCAGGAtgAGTCTCGGTGATGCTGCA
GAAAGGAAGTTCAAGAACCATGTTGTTGTGTTGGTTTTATCACAACGTCT
TTCACCACCGCTTGGTTTAAGACAACTTGTACTTCCATTGCGTGCAAGCA
ATCGTCTGCCGCACGATGTCAAAAAAGTTGTCATTCTTGGAGATGGAGAT
TTCTTAGCTCGCGAGtgGCCGACGCTGGCGAATTTCCCTGATGTTGACAT
CGTACCTGGTTCGCCTTACAACCGTTCCGATTTACGGGCAGTCAATGTGA
ATACAGCGGACATGTGTATTTTGTTATCACCCGGACATGGTAGCGAGGAA
GATGAGCACCAAGCTCTCTCTGATAAAGAAGTCATCCTGGTTACTTTGAA
TTTGAaagCCATGACTTTTGACGAATCAGAACTAGCAGTCACGGAGGAGA
TCAAGAAAGTCGATTCGTCACGAGGAACTTCTATCAACGGTGAAAGTTCT
GCCGATGTACGGGTGGGATTCTCATCGGGCGCCAATTCAAGGGCGGCCAC
CCGTATGACTGGACGCCCTGAAACTTCAATGTCTCACATGACAGCGGGCG
GTAATAGTATGATACAAGAAGTCAAGAAAACGTTTAAAGGAGCTTTGAAT
GGAGCTAACATCCCTATGATCACTGAACTTGTATGTGATTCGAATGCGAT
GTACATTGATCAAGATGATATGAACATCTATGATGATGATGGAATCTTTT
TAACGCAACCGTACGCTTGCGGCTCCGCTTTCACCGTATCGGTTCTCGAT
TCACTCGTCAGTGCGACATATTTCAACAGTGACGTATTAACACTTGTCCG
TAATCTGGTCACCGGTTCTGTGAGTCCGGAACTGGACGAATTGTTAGCAG
AAGGCAAGCAGCCGTCCGGTTCGTACGAAACACAAGAGATTGCCGCTGTC
AGGAACAGATGTCGGGTGGCACAAATTTCTTTGTTTGAAGGGCCTTTATC
TGAATATGGGGAATGTGGTTTATTCGGTGATCTATTTTTGTACGCTCTCC
GTACGTACAACATGATCTGTTTGGGTCTCTACCGATTCCGAGATTCGCAA
CGTATGAAGGACAAAATACCAAGCACGAAACGTTACGTCATCACGTTCCC
GCCctttaattttgttttggatCCAACTGATCTGGTCTTTGTTTTAATGC
AGTTCGAAAAACCGAAACGTAAAAGGAAATCTGTGTCTCGTGTTGGCTCT
GTGGCGTCGCGATTTTCAGGCGctttttaaATGGCGAGTGCAGCTTGTCG
TATTGAAGTCGAGATCCCGGCAGATGAACGGAAATGGCCATGGTTTTTAG
TGGTTTCCGGGTTAATCTTTAGTTCCGgtttaattttaattatcatcGGA
CGTATTTTGTTATATTTCTTCCATGGCGCTAAAAGAAGATCGAATAGTGT
GATTGATATGAATGAGGTGGACGAATTGGAGGAAGAGGAATTCTTCTTGG
AAGATTTAGAACAAGGATGGTATTTAGATTTGAAAGAAGGTGCTGGCAAT
CTTGTGTCTGCTCAAACATTACAAGGACGTATATTGGTTGTTTTGTCGTT
TGTATTCAACTTGGCAGAATGCGCACTCTATATCACAGAAACAGGATATC
CAATCGAGCATTGTTTGGATTTGTCCGATCAAACATTATGGAGAGTTGAA
ATTTGTTTGAAcgctttcttcatttttcattttctcattcGGTTCATTGC
GGCGAACGACAAATTATCTTTTTGGGCAATGGAACCTTTAACGTACGTTG
ATATTGTGACTGTACCAGCCGTCTTTGTGGCTGTCTATCTTGGCCGAAAC
TGGCTAGgtcTCCGCTTTCTACGTGTCATCTATTTGATCAACTTGGCAGA
TATCCTACAATTTCTCAACGTACTCCACACAGGTTCAAGTCTTGAGATGG
CACAGATGATTGGTAATTTCTTGGCTTTGACTCTGGCGTCAGCTGGTATT
GTTCATTTGttgGAGAACACTGGTGATCCATGGGAGCCTATCAACTACAC
CAACAAACAGAAATTGAATTACTTCGAATGTCTCTATTTTCTATTCGTAA
CCATGTCAACGGTTGGTTATGGTGATATATATTGTCATACGTATCTTGGA
AGGTTGTTTAATATTGGTTTCATCTCTGTTGGCCTGgGTCTATTTACATC
ATACCTACCAGCTATCCAAGAATTCTTAGCTTCACATACGAAATATGATA
GAGCTTTCAAGCCTACACCAGGGAAAAGGCATGTCATTGTTGCCGGATAC
ATCACCGAAGAAAGTGTGACtgggtttttcaaagatttcttgCATCCTGA
TCGAGAAGATAGTCAAACCACTGTCGTTATATTGTCACCGAAATATCCGA
GTTTGAAGATGCAAGCCGACTTGCAAAGACATTGTACAAAAGCTTCATAT
TTTATTGGCACCATCTACAAGTTCATGGACTGCCATCGGACTAGGATGCG
AGAAGCAGATGCAGTCATTATTCTTTGTAACAAGAAATGTATAAGTCCCG
ATGAAGAAGACGCCGCTAACATTACAAGGGTGATTTCAGTGAAGAATTAT
CACGAGAACATTCGATGTATCGTACAACTCATGATGAACAAAAACAAGTC
ACATTTATTGAATTGTCCACAATGGAATCGGGAACTTGGTGATGACATCA
TTTGCATTGATGAGttGAAACTTGGATTCGTGGCACAAAGTTGTAATGCA
CCTGGATTCTCAACGTTGCTGGCAAATCTATTCGCTATGAGGAGCGATAC
GATAAGCGAGGAGATTCAAGAATCAGAGAAATGGAAAGTAGCGTACATGA
TTGGTGCAGCAAATGAGATGTACACAGCTCAACTATCGAATGCTTTCATT
GGAATGTCCTTCCCACAAGCAGTAGAattatgttttgaaaaattgaattt
aatgtTGATTGCCATcgaaatgaaaatctcaaaaaaagagCGATACTTTG
CTATCAATCCCAATGACAAGAAGTTGAGACTTTTACCAGGAACGCGTGGT
TTCTTTTTCGCTCAAGACGCCAGCGATGTTGCGAAAGCATCGAAATATTG
TGCGAAGTGTCACAAAGACCTTCAAGATCCTGAACGAATGGTCAAATGTA
AATGCAGACGACGTATGAAACAAGAACAGGAAAAGAAGAATCCAGCTCAG
AAAGGAAAATACGAAACAAAAGTCGATGTTGATCCAGTGCATTTGCTCGA
AGCCGAACCCGATGAAGCTAAAAAGGATAAACAATCATTGACGGGAGACT
ATTTTGCAAGTGGTGAAAAACCAAAGTTTGACCAAAGTGGGACGTTTTAT
TGGTGCGAAACAAGAAGCTACATATCTGCCAGGAtgAGTCTCGGTGATGC
TGCAGAAAGGAAGTTCAAGAACCATGTTGTTGTGTTGGTTTTATCACAAC
GTCTTTCACCACCGCTTGGTTTAAGACAACTTGTACTTCCATTGCGTGCA
AGCAATCGTCTGCCGCACGATGTCAAAAAAGTTGTCATTCTTGGAGATGG
AGATTTCTTAGCTCGCGAGtgGCCGACGCTGGCGAATTTCCCTGATGTTG
ACATCGTACCTGGTTCGCCTTACAACCGTTCCGATTTACGGGCAGTCAAT
GTGAATACAGCGGACATGTGTATTTTGTTATCACCCGGACATGGTAGCGA
GGAAGATGAGCACCAAGCTCTCTCTGATAAAGAAGTCATCCTGGTTACTT
TGAATTTGAaagCCATGACTTTTGACGAATCAGAACTAGCAGTCACGGAG
GAGATCAAGAAAGTCGATTCGTCACGAGGAACTTCTATCAACGGTGAAAG
TTCTGCCGATGTACGGGTGGGATTCTCATCGGGCGCCAATTCAAGGGCGG
CCACCCGTATGACTGGACGCCCTGAAACTTCAATGTCTCACATGACAGCG
GGCGGTAATAGTATGATACAAGAAGTCAAGAAAACGTTTAAAGGAGCTTT
GAATGGAGCTAACATCCCTATGATCACTGAACTTGTATGTGATTCGAATG
CGATGTACATTGATCAAGATGATATGAACATCTATGATGATGATGGAATC
TTTTTAACGCAACCGTACGCTTGCGGCTCCGCTTTCACCGTATCGGTTCT
CGATTCACTCGTCAGTGCGACATATTTCAACAGTGACGTATTAACACTTG
TCCGTAATCTGGTCACCGGTTCTGTGAGTCCGGAACTGGACGAATTGTTA
GCAGAAGGCAAGCAGCCGTCCGGTTCGTACGAAACACAAGAGATTGCCGC
TGTCAGGAACAGATGTCGGGTGGCACAAATTTCTTTGTTTGAAGGGCCTT
TATCTGAATATGGGGAATGTGGTTTATTCGGTGATCTATTTTTGTACGCT
CTCCGTACGTACAACATGATCTGTTTGGGTCTCTACCGATTCCGAGATTC
GCAACGTATGAAGGACAAAATACCAAGCACGAAACGTTACGTCATCACGT
TCCCGCCctttaattttgttttggatCCAACTGATCTGGTCTTTGTTTTA
ATGCAGTTCGAAAAACCGAAACGTAAAAGGAAATCTGTGTCTCGTGTTGG
CTCTGTGGCGTCGCGATTTTCAGGCGctttttaaATGGCGAGTGCAGCTT
GTCGTATTGAAGTCGAGATCCCGGCAGATGAACGGAAATGGCCATGGTTT
TTAGTGGTTTCCGGGTTAATCTTTAGTTCCGgtttaattttaattatcat
cGGACGTATTTTGTTATATTTCTTCCATGGCGCTAAAAGAAGATCGAATA
GTGTGATTGATATGAATGAGGTGGACGAATTGGAGGAAGAGGAATTCTTC
TTGGAAGATTTAGAACAAGGATGGTATTTAGATTTGAAAGAAGGTGCTGG
CAATCTTGTGTCTGCTCAAACATTACAAGGACGTATATTGGTTGTTTTGT
CGTTTGTATTCAACTTGGCAGAATGCGCACTCTATATCACAGAAACAGGA
TATCCAATCGAGCATTGTTTGGATTTGTCCGATCAAACATTATGGAGAGT
TGAAATTTGTTTGAAcgctttcttcatttttcattttctcattcGGTTCA
TTGCGGCGAACGACAAATTATCTTTTTGGGCAATGGAACCTTTAACGTAC
GTTGATATTGTGACTGTACCAGCCGTCTTTGTGGCTGTCTATCTTGGCCG
AAACTGGCTAGgtcTCCGCTTTCTACGTGTCATCTATTTGATCAACTTGG
CAGATATCCTACAATTTCTCAACGTACTCCACACAGGTTCAAGTCTTGAG
ATGGCACAGATGATTGGTAATTTCTTGGCTTTGACTCTGGCGTCAGCTGG
TATTGTTCATTTGttgGAGAACACTGGTGATCCATGGGAGCCTATCAACT
ACACCAACAAACAGAAATTGAATTACTTCGAATGTCTCTATTTTCTATTC
GTAACCATGTCAACGGTTGGTTATGGTGATATATATTGTCATACGTATCT
TGGAAGGTTGTTTAATATTGGTTTCATCTCTGTTGGCCTGgGTCTATTTA
CATCATACCTACCAGCTATCCAAGAATTCTTAGCTTCACATACGAAATAT
GATAGAGCTTTCAAGCCTACACCAGGGAAAAGGCATGTCATTGTTGCCGG
ATACATCACCGAAGAAAGTGTGACtgggtttttcaaagatttcttgCATC
CTGATCGAGAAGATAGTCAAACCACTGTCGTTATATTGTCACCGAAATAT
CCGAGTTTGAAGATGCAAGCCGACTTGCAAAGACATTGTACAAAAGCTTC
ATATTTTATTGGCACCATCTACAAGTTCATGGACTGCCATCGGACTAGGA
TGCGAGAAGCAGATGCAGTCATTATTCTTTGTAACAAGAAATGTATAAGT
CCCGATGAAGAAGACGCCGCTAACATTACAAGGGTGATTTCAGTGAAGAA
TTATCACGAGAACATTCGATGTATCGTACAACTCATGATGAACAAAAACA
AGTCACATTTATTGAATTGTCCACAATGGAATCGGGAACTTGGTGATGAC
ATCATTTGCATTGATGAGttGAAACTTGGATTCGTGGCACAAAGTTGTAA
TGCACCTGGATTCTCAACGTTGCTGGCAAATCTATTCGCTATGAGGAGCG
ATACGATAAGCGAGGAGATTCAAGAATCAGAGAAATGGAAAGTAGCGTAC
ATGATTGGTGCAGCAAATGAGATGTACACAGCTCAACTATCGAATGCTTT
CATTGGAATGTCCTTCCCACAAGCAGTAGAattatgttttgaaaaattga
atttaatgtTGATTGCCATcgaaatgaaaatctcaaaaaaagagCGATAC
TTTGCTATCAATCCCAATGACAAGAAGTTGAGACTTTTACCAGGAACGCG
TGGTTTCTTTTTCGCTCAAGACGCCAGCGATGTTGCGAAAGCATCGAAAT
ATTGTGCGAAGTGTCACAAAGACCTTCAAGATCCTGAACGAATGGTCAAA
TGTAAATGCAGACGACGTATGAAACAAGAACAGGAAAAGAAGAATCCAGC
TCAGAAAGGAAAATACGAAACAAAAGTCGATGTTGATCCAGTGCATTTGC
TCGAAGCCGAACCCGATGAAGCTAAAAAGGATAAACAATCATTGACGGGA
GACTATTTTGCAAGTGGTGAAAAACCAAAGTTTGACCAAAGTGGGACGTT
TTATTGGTGCGAAACAAGAAGCTACATATCTGCCAGGAtgAGTCTCGGTG
ATGCTGCAGAAAGGAAGTTCAAGAACCATGTTGTTGTGTTGGTTTTATCA
CAACGTCTTTCACCACCGCTTGGTTTAAGACAACTTGTACTTCCATTGCG
TGCAAGCAATCGTCTGCCGCACGATGTCAAAAAAGTTGTCATTCTTGGAG
ATGGAGATTTCTTAGCTCGCGAGtgGCCGACGCTGGCGAATTTCCCTGAT
GTTGACATCGTACCTGGTTCGCCTTACAACCGTTCCGATTTACGGGCAGT
CAATGTGAATACAGCGGACATGTGTATTTTGTTATCACCCGGACATGGTA
GCGAGGAAGATGAGCACCAAGCTCTCTCTGATAAAGAAGTCATCCTGGTT
ACTTTGAATTTGAaagCCATGACTTTTGACGAATCAGAACTAGCAGTCAC
GGAGGAGATCAAGAAAGTCGATTCGTCACGAGGAACTTCTATCAACGGTG
AAAGTTCTGCCGATGTACGGGTGGGATTCTCATCGGGCGCCAATTCAAGG
GCGGCCACCCGTATGACTGGACGCCCTGAAACTTCAATGTCTCACATGAC
AGCGGGCGGTAATAGTATGATACAAGAAGTCAAGAAAACGTTTAAAGGAG
CTTTGAATGGAGCTAACATCCCTATGATCACTGAACTTGTATGTGATTCG
AATGCGATGTACATTGATCAAGATGATATGAACATCTATGATGATGATGG
AATCTTTTTAACGCAACCGTACGCTTGCGGCTCCGCTTTCACCGTATCGG
TTCTCGATTCACTCGTCAGTGCGACATATTTCAACAGTGACGTATTAACA
CTTGTCCGTAATCTGGTCACCGGTTCTGTGAGTCCGGAACTGGACGAATT
GTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGTACGAAACACAAGAGATTG
CCGCTGTCAGGAACAGATGTCGGGTGGCACAAATTTCTTTGTTTGAAGGG
CCTTTATCTGAATATGGGGAATGTGGTTTATTCGGTGATCTATTTTTGTA
CGCTCTCCGTACGTACAACATGATCTGTTTGGGTCTCTACCGATTCCGAG
ATTCGCAACGTATGAAGGACAAAATACCAAGCACGAAACGTTACGTCATC
ACGTTCCCGCCctttaattttgttttggatCCAACTGATCTGGTCTTTGT
TTTAATGCAGTTCGAAAAACCGAAACGTAAAAGGAAATCTGTGTCTCGTG
TTGGCTCTGTGGCGTCGCGATTTTCAGGCGctttttaaATGGCGAGTGCA
GCTTGTCGTATTGAAGTCGAGATCCCGGCAGATGAACGGAAATGGCCATG
GTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCCGgtttaattttaatta
tcatcGGACGTATTTTGTTATATTTCTTCCATGGCGCTAAAAGAAGATCG
AATAGTGTGATTGATATGAATGAGGTGGACGAATTGGAGGAAGAGGAATT
CTTCTTGGAAGATTTAGAACAAGGATGGTATTTAGATTTGAAAGAAGGTG
CTGGCAATCTTGTGTCTGCTCAAACATTACAAGGACGTATATTGGTTGTT
TTGTCGTTTGTATTCAACTTGGCAGAATGCGCACTCTATATCACAGAAAC
AGGATATCCAATCGAGCATTGTTTGGATTTGTCCGATCAAACATTATGGA
GAGTTGAAATTTGTTTGAAcgctttcttcatttttcattttctcattcGG
TTCATTGCGGCGAACGACAAATTATCTTTTTGGGCAATGGAACCTTTAAC
GTACGTTGATATTGTGACTGTACCAGCCGTCTTTGTGGCTGTCTATCTTG
GCCGAAACTGGCTAGgtcTCCGCTTTCTACGTGTCATCTATTTGATCAAC
TTGGCAGATATCCTACAATTTCTCAACGTACTCCACACAGGTTCAAGTCT
TGAGATGGCACAGATGATTGGTAATTTCTTGGCTTTGACTCTGGCGTCAG
CTGGTATTGTTCATTTGttgGAGAACACTGGTGATCCATGGGAGCCTATC
AACTACACCAACAAACAGAAATTGAATTACTTCGAATGTCTCTATTTTCT
ATTCGTAACCATGTCAACGGTTGGTTATGGTGATATATATTGTCATACGT
ATCTTGGAAGGTTGTTTAATATTGGTTTCATCTCTGTTGGCCTGgGTCTA
TTTACATCATACCTACCAGCTATCCAAGAATTCTTAGCTTCACATACGAA
ATATGATAGAGCTTTCAAGCCTACACCAGGGAAAAGGCATGTCATTGTTG
CCGGATACATCACCGAAGAAAGTGTGACtgggtttttcaaagatttcttg
CATCCTGATCGAGAAGATAGTCAAACCACTGTCGTTATATTGTCACCGAA
ATATCCGAGTTTGAAGATGCAAGCCGACTTGCAAAGACATTGTACAAAAG
CTTCATATTTTATTGGCACCATCTACAAGTTCATGGACTGCCATCGGACT
AGGATGCGAGAAGCAGATGCAGTCATTATTCTTTGTAACAAGAAATGTAT
AAGTCCCGATGAAGAAGACGCCGCTAACATTACAAGGGTGATTTCAGTGA
AGAATTATCACGAGAACATTCGATGTATCGTACAACTCATGATGAACAAA
AACAAGTCACATTTATTGAATTGTCCACAATGGAATCGGGAACTTGGTGA
TGACATCATTTGCATTGATGAGttGAAACTTGGATTCGTGGCACAAAGTT
GTAATGCACCTGGATTCTCAACGTTGCTGGCAAATCTATTCGCTATGAGG
AGCGATACGATAAGCGAGGAGATTCAAGAATCAGAGAAATGGAAAGTAGC
GTACATGATTGGTGCAGCAAATGAGATGTACACAGCTCAACTATCGAATG
CTTTCATTGGAATGTCCTTCCCACAAGCAGTAGAattatgttttgaaaaa
ttgaatttaatgtTGATTGCCATcgaaatgaaaatctcaaaaaaagagCG
ATACTTTGCTATCAATCCCAATGACAAGAAGTTGAGACTTTTACCAGGAA
CGCGTGGTTTCTTTTTCGCTCAAGACGCCAGCGATGTTGCGAAAGCATCG
AAATATTGTGCGAAGTGTCACAAAGACCTTCAAGATCCTGAACGAATGGT
CAAATGTAAATGCAGACGACGTATGAAACAAGAACAGGAAAAGAAGAATC
CAGCTCAGAAAGGAAAATACGAAACAAAAGTCGATGTTGATCCAGTGCAT
TTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGGATAAACAATCATTGAC
GGGAGACTATTTTGCAAGTGGTGAAAAACCAAAGTTTGACCAAAGTGGGA
CGTTTTATTGGTGCGAAACAAGAAGCTACATATCTGCCAGGAtgAGTCTC
GGTGATGCTGCAGAAAGGAAGTTCAAGAACCATGTTGTTGTGTTGGTTTT
ATCACAACGTCTTTCACCACCGCTTGGTTTAAGACAACTTGTACTTCCAT
TGCGTGCAAGCAATCGTCTGCCGCACGATGTCAAAAAAGTTGTCATTCTT
GGAGATGGAGATTTCTTAGCTCGCGAGtgGCCGACGCTGGCGAATTTCCC
TGATGTTGACATCGTACCTGGTTCGCCTTACAACCGTTCCGATTTACGGG
CAGTCAATGTGAATACAGCGGACATGTGTATTTTGTTATCACCCGGACAT
GGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTGATAAAGAAGTCATCCT
GGTTACTTTGAATTTGAaagCCATGACTTTTGACGAATCAGAACTAGCAG
TCACGGAGGAGATCAAGAAAGTCGATTCGTCACGAGGAACTTCTATCAAC
GGTGAAAGTTCTGCCGATGTACGGGTGGGATTCTCATCGGGCGCCAATTC
AAGGGCGGCCACCCGTATGACTGGACGCCCTGAAACTTCAATGTCTCACA
TGACAGCGGGCGGTAATAGTATGATACAAGAAGTCAAGAAAACGTTTAAA
GGAGCTTTGAATGGAGCTAACATCCCTATGATCACTGAACTTGTATGTGA
TTCGAATGCGATGTACATTGATCAAGATGATATGAACATCTATGATGATG
ATGGAATCTTTTTAACGCAACCGTACGCTTGCGGCTCCGCTTTCACCGTA
TCGGTTCTCGATTCACTCGTCAGTGCGACATATTTCAACAGTGACGTATT
AACACTTGTCCGTAATCTGGTCACCGGTTCTGTGAGTCCGGAACTGGACG
AATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGTACGAAACACAAGAG
ATTGCCGCTGTCAGGAACAGATGTCGGGTGGCACAAATTTCTTTGTTTGA
AGGGCCTTTATCTGAATATGGGGAATGTGGTTTATTCGGTGATCTATTTT
TGTACGCTCTCCGTACGTACAACATGATCTGTTTGGGTCTCTACCGATTC
CGAGATTCGCAACGTATGAAGGACAAAATACCAAGCACGAAACGTTACGT
CATCACGTTCCCGCCctttaattttgttttggatCCAACTGATCTGGTCT
TTGTTTTAATGCAGTTCGAAAAACCGAAACGTAAAAGGAAATCTGTGTCT
CGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCGctttttaaATGGCGAG
TGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCAGATGAACGGAAATGGC
CATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCCGgtttaatttta
attatcatcGGACGTATTTTGTTATATTTCTTCCATGGCGCTAAAAGAAG
ATCGAATAGTGTGATTGATATGAATGAGGTGGACGAATTGGAGGAAGAGG
AATTCTTCTTGGAAGATTTAGAACAAGGATGGTATTTAGATTTGAAAGAA
GGTGCTGGCAATCTTGTGTCTGCTCAAACATTACAAGGACGTATATTGGT
TGTTTTGTCGTTTGTATTCAACTTGGCAGAATGCGCACTCTATATCACAG
AAACAGGATATCCAATCGAGCATTGTTTGGATTTGTCCGATCAAACATTA
TGGAGAGTTGAAATTTGTTTGAAcgctttcttcatttttcattttctcat
tcGGTTCATTGCGGCGAACGACAAATTATCTTTTTGGGCAATGGAACCTT
TAACGTACGTTGATATTGTGACTGTACCAGCCGTCTTTGTGGCTGTCTAT
CTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTACGTGTCATCTATTTGAT
CAACTTGGCAGATATCCTACAATTTCTCAACGTACTCCACACAGGTTCAA
GTCTTGAGATGGCACAGATGATTGGTAATTTCTTGGCTTTGACTCTGGCG
TCAGCTGGTATTGTTCATTTGttgGAGAACACTGGTGATCCATGGGAGCC
TATCAACTACACCAACAAACAGAAATTGAATTACTTCGAATGTCTCTATT
TTCTATTCGTAACCATGTCAACGGTTGGTTATGGTGATATATATTGTCAT
ACGTATCTTGGAAGGTTGTTTAATATTGGTTTCATCTCTGTTGGCCTGgG
TCTATTTACATCATACCTACCAGCTATCCAAGAATTCTTAGCTTCACATA
CGAAATATGATAGAGCTTTCAAGCCTACACCAGGGAAAAGGCATGTCATT
GTTGCCGGATACATCACCGAAGAAAGTGTGACtgggtttttcaaagattt
cttgCATCCTGATCGAGAAGATAGTCAAACCACTGTCGTTATATTGTCAC
CGAAATATCCGAGTTTGAAGATGCAAGCCGACTTGCAAAGACATTGTACA
AAAGCTTCATATTTTATTGGCACCATCTACAAGTTCATGGACTGCCATCG
GACTAGGATGCGAGAAGCAGATGCAGTCATTATTCTTTGTAACAAGAAAT
GTATAAGTCCCGATGAAGAAGACGCCGCTAACATTACAAGGGTGATTTCA
GTGAAGAATTATCACGAGAACATTCGATGTATCGTACAACTCATGATGAA
CAAAAACAAGTCACATTTATTGAATTGTCCACAATGGAATCGGGAACTTG
GTGATGACATCATTTGCATTGATGAGttGAAACTTGGATTCGTGGCACAA
AGTTGTAATGCACCTGGATTCTCAACGTTGCTGGCAAATCTATTCGCTAT
GAGGAGCGATACGATAAGCGAGGAGATTCAAGAATCAGAGAAATGGAAAG
TAGCGTACATGATTGGTGCAGCAAATGAGATGTACACAGCTCAACTATCG
AATGCTTTCATTGGAATGTCCTTCCCACAAGCAGTAGAattatgttttga
aaaattgaatttaatgtTGATTGCCATcgaaatgaaaatctcaaaaaaag
agCGATACTTTGCTATCAATCCCAATGACAAGAAGTTGAGACTTTTACCA
GGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCAGCGATGTTGCGAAAGC
ATCGAAATATTGTGCGAAGTGTCACAAAGACCTTCAAGATCCTGAACGAA
TGGTCAAATGTAAATGCAGACGACGTATGAAACAAGAACAGGAAAAGAAG
AATCCAGCTCAGAAAGGAAAATACGAAACAAAAGTCGATGTTGATCCAGT
GCATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGGATAAACAATCAT
TGACGGGAGACTATTTTGCAAGTGGTGAAAAACCAAAGTTTGACCAAAGT
GGGACGTTTTATTGGTGCGAAACAAGAAGCTACATATCTGCCAGGAtgAG
TCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAACCATGTTGTTGTGTTGG
TTTTATCACAACGTCTTTCACCACCGCTTGGTTTAAGACAACTTGTACTT
CCATTGCGTGCAAGCAATCGTCTGCCGCACGATGTCAAAAAAGTTGTCAT
TCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgGCCGACGCTGGCGAATT
TCCCTGATGTTGACATCGTACCTGGTTCGCCTTACAACCGTTCCGATTTA
CGGGCAGTCAATGTGAATACAGCGGACATGTGTATTTTGTTATCACCCGG
ACATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTGATAAAGAAGTCA
TCCTGGTTACTTTGAATTTGAaagCCATGACTTTTGACGAATCAGAACTA
GCAGTCACGGAGGAGATCAAGAAAGTCGATTCGTCACGAGGAACTTCTAT
CAACGGTGAAAGTTCTGCCGATGTACGGGTGGGATTCTCATCGGGCGCCA
ATTCAAGGGCGGCCACCCGTATGACTGGACGCCCTGAAACTTCAATGTCT
CACATGACAGCGGGCGGTAATAGTATGATACAAGAAGTCAAGAAAACGTT
TAAAGGAGCTTTGAATGGAGCTAACATCCCTATGATCACTGAACTTGTAT
GTGATTCGAATGCGATGTACATTGATCAAGATGATATGAACATCTATGAT
GATGATGGAATCTTTTTAACGCAACCGTACGCTTGCGGCTCCGCTTTCAC
CGTATCGGTTCTCGATTCACTCGTCAGTGCGACATATTTCAACAGTGACG
TATTAACACTTGTCCGTAATCTGGTCACCGGTTCTGTGAGTCCGGAACTG
GACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGTACGAAACACA
AGAGATTGCCGCTGTCAGGAACAGATGTCGGGTGGCACAAATTTCTTTGT
TTGAAGGGCCTTTATCTGAATATGGGGAATGTGGTTTATTCGGTGATCTA
TTTTTGTACGCTCTCCGTACGTACAACATGATCTGTTTGGGTCTCTACCG
ATTCCGAGATTCGCAACGTATGAAGGACAAAATACCAAGCACGAAACGTT
ACGTCATCACGTTCCCGCCctttaattttgttttggatCCAACTGATCTG
GTCTTTGTTTTAATGCAGTTCGAAAAACCGAAACGTAAAAGGAAATCTGT
GTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCGctttttaaATGG
CGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCAGATGAACGGAAA
TGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCCGgtttaat
tttaattatcatcGGACGTATTTTGTTATATTTCTTCCATGGCGCTAAAA
GAAGATCGAATAGTGTGATTGATATGAATGAGGTGGACGAATTGGAGGAA
GAGGAATTCTTCTTGGAAGATTTAGAACAAGGATGGTATTTAGATTTGAA
AGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACATTACAAGGACGTATAT
TGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGAATGCGCACTCTATATC
ACAGAAACAGGATATCCAATCGAGCATTGTTTGGATTTGTCCGATCAAAC
ATTATGGAGAGTTGAAATTTGTTTGAAcgctttcttcatttttcattttc
tcattcGGTTCATTGCGGCGAACGACAAATTATCTTTTTGGGCAATGGAA
CCTTTAACGTACGTTGATATTGTGACTGTACCAGCCGTCTTTGTGGCTGT
CTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTACGTGTCATCTATT
TGATCAACTTGGCAGATATCCTACAATTTCTCAACGTACTCCACACAGGT
TCAAGTCTTGAGATGGCACAGATGATTGGTAATTTCTTGGCTTTGACTCT
GGCGTCAGCTGGTATTGTTCATTTGttgGAGAACACTGGTGATCCATGGG
AGCCTATCAACTACACCAACAAACAGAAATTGAATTACTTCGAATGTCTC
TATTTTCTATTCGTAACCATGTCAACGGTTGGTTATGGTGATATATATTG
TCATACGTATCTTGGAAGGTTGTTTAATATTGGTTTCATCTCTGTTGGCC
TGgGTCTATTTACATCATACCTACCAGCTATCCAAGAATTCTTAGCTTCA
CATACGAAATATGATAGAGCTTTCAAGCCTACACCAGGGAAAAGGCATGT
CATTGTTGCCGGATACATCACCGAAGAAAGTGTGACtgggtttttcaaag
atttcttgCATCCTGATCGAGAAGATAGTCAAACCACTGTCGTTATATTG
TCACCGAAATATCCGAGTTTGAAGATGCAAGCCGACTTGCAAAGACATTG
TACAAAAGCTTCATATTTTATTGGCACCATCTACAAGTTCATGGACTGCC
ATCGGACTAGGATGCGAGAAGCAGATGCAGTCATTATTCTTTGTAACAAG
AAATGTATAAGTCCCGATGAAGAAGACGCCGCTAACATTACAAGGGTGAT
TTCAGTGAAGAATTATCACGAGAACATTCGATGTATCGTACAACTCATGA
TGAACAAAAACAAGTCACATTTATTGAATTGTCCACAATGGAATCGGGAA
CTTGGTGATGACATCATTTGCATTGATGAGttGAAACTTGGATTCGTGGC
ACAAAGTTGTAATGCACCTGGATTCTCAACGTTGCTGGCAAATCTATTCG
CTATGAGGAGCGATACGATAAGCGAGGAGATTCAAGAATCAGAGAAATGG
AAAGTAGCGTACATGATTGGTGCAGCAAATGAGATGTACACAGCTCAACT
ATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAGTAGAattatgtt
ttgaaaaattgaatttaatgtTGATTGCCATcgaaatgaaaatctcaaaa
aaagagCGATACTTTGCTATCAATCCCAATGACAAGAAGTTGAGACTTTT
ACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCAGCGATGTTGCGA
AAGCATCGAAATATTGTGCGAAGTGTCACAAAGACCTTCAAGATCCTGAA
CGAATGGTCAAATGTAAATGCAGACGACGTATGAAACAAGAACAGGAAAA
GAAGAATCCAGCTCAGAAAGGAAAATACGAAACAAAAGTCGATGTTGATC
CAGTGCATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGGATAAACAA
TCATTGACGGGAGACTATTTTGCAAGTGGTGAAAAACCAAAGTTTGACCA
AAGTGGGACGTTTTATTGGTGCGAAACAAGAAGCTACATATCTGCCAGGA
tgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAACCATGTTGTTGTG
TTGGTTTTATCACAACGTCTTTCACCACCGCTTGGTTTAAGACAACTTGT
ACTTCCATTGCGTGCAAGCAATCGTCTGCCGCACGATGTCAAAAAAGTTG
TCATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgGCCGACGCTGGCG
AATTTCCCTGATGTTGACATCGTACCTGGTTCGCCTTACAACCGTTCCGA
TTTACGGGCAGTCAATGTGAATACAGCGGACATGTGTATTTTGTTATCAC
CCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTGATAAAGAA
GTCATCCTGGTTACTTTGAATTTGAaagCCATGACTTTTGACGAATCAGA
ACTAGCAGTCACGGAGGAGATCAAGAAAGTCGATTCGTCACGAGGAACTT
CTATCAACGGTGAAAGTTCTGCCGATGTACGGGTGGGATTCTCATCGGGC
GCCAATTCAAGGGCGGCCACCCGTATGACTGGACGCCCTGAAACTTCAAT
GTCTCACATGACAGCGGGCGGTAATAGTATGATACAAGAAGTCAAGAAAA
CGTTTAAAGGAGCTTTGAATGGAGCTAACATCCCTATGATCACTGAACTT
GTATGTGATTCGAATGCGATGTACATTGATCAAGATGATATGAACATCTA
TGATGATGATGGAATCTTTTTAACGCAACCGTACGCTTGCGGCTCCGCTT
TCACCGTATCGGTTCTCGATTCACTCGTCAGTGCGACATATTTCAACAGT
GACGTATTAACACTTGTCCGTAATCTGGTCACCGGTTCTGTGAGTCCGGA
ACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGTACGAAA
CACAAGAGATTGCCGCTGTCAGGAACAGATGTCGGGTGGCACAAATTTCT
TTGTTTGAAGGGCCTTTATCTGAATATGGGGAATGTGGTTTATTCGGTGA
TCTATTTTTGTACGCTCTCCGTACGTACAACATGATCTGTTTGGGTCTCT
ACCGATTCCGAGATTCGCAACGTATGAAGGACAAAATACCAAGCACGAAA
CGTTACGTCATCACGTTCCCGCCctttaattttgttttggatCCAACTGA
TCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAACGTAAAAGGAAAT
CTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCGctttttaa
ATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCAGATGAACG
GAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCCGgtt
taattttaattatcatcGGACGTATTTTGTTATATTTCTTCCATGGCGCT
AAAAGAAGATCGAATAGTGTGATTGATATGAATGAGGTGGACGAATTGGA
GGAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGATGGTATTTAGATT
TGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACATTACAAGGACGT
ATATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGAATGCGCACTCTA
TATCACAGAAACAGGATATCCAATCGAGCATTGTTTGGATTTGTCCGATC
AAACATTATGGAGAGTTGAAATTTGTTTGAAcgctttcttcatttttcat
tttctcattcGGTTCATTGCGGCGAACGACAAATTATCTTTTTGGGCAAT
GGAACCTTTAACGTACGTTGATATTGTGACTGTACCAGCCGTCTTTGTGG
CTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTACGTGTCATC
TATTTGATCAACTTGGCAGATATCCTACAATTTCTCAACGTACTCCACAC
AGGTTCAAGTCTTGAGATGGCACAGATGATTGGTAATTTCTTGGCTTTGA
CTCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAACACTGGTGATCCA
TGGGAGCCTATCAACTACACCAACAAACAGAAATTGAATTACTTCGAATG
TCTCTATTTTCTATTCGTAACCATGTCAACGGTTGGTTATGGTGATATAT
ATTGTCATACGTATCTTGGAAGGTTGTTTAATATTGGTTTCATCTCTGTT
GGCCTGgGTCTATTTACATCATACCTACCAGCTATCCAAGAATTCTTAGC
TTCACATACGAAATATGATAGAGCTTTCAAGCCTACACCAGGGAAAAGGC
ATGTCATTGTTGCCGGATACATCACCGAAGAAAGTGTGACtgggtttttc
aaagatttcttgCATCCTGATCGAGAAGATAGTCAAACCACTGTCGTTAT
ATTGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCGACTTGCAAAGAC
ATTGTACAAAAGCTTCATATTTTATTGGCACCATCTACAAGTTCATGGAC
TGCCATCGGACTAGGATGCGAGAAGCAGATGCAGTCATTATTCTTTGTAA
CAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAACATTACAAGGG
TGATTTCAGTGAAGAATTATCACGAGAACATTCGATGTATCGTACAACTC
ATGATGAACAAAAACAAGTCACATTTATTGAATTGTCCACAATGGAATCG
GGAACTTGGTGATGACATCATTTGCATTGATGAGttGAAACTTGGATTCG
TGGCACAAAGTTGTAATGCACCTGGATTCTCAACGTTGCTGGCAAATCTA
TTCGCTATGAGGAGCGATACGATAAGCGAGGAGATTCAAGAATCAGAGAA
ATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGATGTACACAGCTC
AACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAGTAGAatta
tgttttgaaaaattgaatttaatgtTGATTGCCATcgaaatgaaaatctc
aaaaaaagagCGATACTTTGCTATCAATCCCAATGACAAGAAGTTGAGAC
TTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCAGCGATGTT
GCGAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGACCTTCAAGATCC
TGAACGAATGGTCAAATGTAAATGCAGACGACGTATGAAACAAGAACAGG
AAAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACAAAAGTCGATGTT
GATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGGATAA
ACAATCATTGACGGGAGACTATTTTGCAAGTGGTGAAAAACCAAAGTTTG
ACCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGCTACATATCTGCC
AGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAACCATGTTGT
TGTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTGGTTTAAGACAAC
TTGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCACGATGTCAAAAAA
GTTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgGCCGACGCT
GGCGAATTTCCCTGATGTTGACATCGTACCTGGTTCGCCTTACAACCGTT
CCGATTTACGGGCAGTCAATGTGAATACAGCGGACATGTGTATTTTGTTA
TCACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTGATAA
AGAAGTCATCCTGGTTACTTTGAATTTGAaagCCATGACTTTTGACGAAT
CAGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGATTCGTCACGAGGA
ACTTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGTGGGATTCTCATC
GGGCGCCAATTCAAGGGCGGCCACCCGTATGACTGGACGCCCTGAAACTT
CAATGTCTCACATGACAGCGGGCGGTAATAGTATGATACAAGAAGTCAAG
AAAACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCCTATGATCACTGA
ACTTGTATGTGATTCGAATGCGATGTACATTGATCAAGATGATATGAACA
TCTATGATGATGATGGAATCTTTTTAACGCAACCGTACGCTTGCGGCTCC
GCTTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGCGACATATTTCAA
CAGTGACGTATTAACACTTGTCCGTAATCTGGTCACCGGTTCTGTGAGTC
CGGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTCGTAC
GAAACACAAGAGATTGCCGCTGTCAGGAACAGATGTCGGGTGGCACAAAT
TTCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAATGTGGTTTATTCG
GTGATCTATTTTTGTACGCTCTCCGTACGTACAACATGATCTGTTTGGGT
CTCTACCGATTCCGAGATTCGCAACGTATGAAGGACAAAATACCAAGCAC
GAAACGTTACGTCATCACGTTCCCGCCctttaattttgttttggatCCAA
CTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAACGTAAAAGG
AAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCGcttt
ttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCAGATG
AACGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAGTTCC
GgtttaattttaattatcatcGGACGTATTTTGTTATATTTCTTCCATGG
CGCTAAAAGAAGATCGAATAGTGTGATTGATATGAATGAGGTGGACGAAT
TGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGATGGTATTTA
GATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACATTACAAGG
ACGTATATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGAATGCGCAC
TCTATATCACAGAAACAGGATATCCAATCGAGCATTGTTTGGATTTGTCC
GATCAAACATTATGGAGAGTTGAAATTTGTTTGAAcgctttcttcatttt
tcattttctcattcGGTTCATTGCGGCGAACGACAAATTATCTTTTTGGG
CAATGGAACCTTTAACGTACGTTGATATTGTGACTGTACCAGCCGTCTTT
GTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTACGTGT
CATCTATTTGATCAACTTGGCAGATATCCTACAATTTCTCAACGTACTCC
ACACAGGTTCAAGTCTTGAGATGGCACAGATGATTGGTAATTTCTTGGCT
TTGACTCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAACACTGGTGA
TCCATGGGAGCCTATCAACTACACCAACAAACAGAAATTGAATTACTTCG
AATGTCTCTATTTTCTATTCGTAACCATGTCAACGGTTGGTTATGGTGAT
ATATATTGTCATACGTATCTTGGAAGGTTGTTTAATATTGGTTTCATCTC
TGTTGGCCTGgGTCTATTTACATCATACCTACCAGCTATCCAAGAATTCT
TAGCTTCACATACGAAATATGATAGAGCTTTCAAGCCTACACCAGGGAAA
AGGCATGTCATTGTTGCCGGATACATCACCGAAGAAAGTGTGACtgggtt
tttcaaagatttcttgCATCCTGATCGAGAAGATAGTCAAACCACTGTCG
TTATATTGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCGACTTGCAA
AGACATTGTACAAAAGCTTCATATTTTATTGGCACCATCTACAAGTTCAT
GGACTGCCATCGGACTAGGATGCGAGAAGCAGATGCAGTCATTATTCTTT
GTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAACATTACA
AGGGTGATTTCAGTGAAGAATTATCACGAGAACATTCGATGTATCGTACA
ACTCATGATGAACAAAAACAAGTCACATTTATTGAATTGTCCACAATGGA
ATCGGGAACTTGGTGATGACATCATTTGCATTGATGAGttGAAACTTGGA
TTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCAACGTTGCTGGCAAA
TCTATTCGCTATGAGGAGCGATACGATAAGCGAGGAGATTCAAGAATCAG
AGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGATGTACACA
GCTCAACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAGTAGA
attatgttttgaaaaattgaatttaatgtTGATTGCCATcgaaatgaaaa
tctcaaaaaaagagCGATACTTTGCTATCAATCCCAATGACAAGAAGTTG
AGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCAGCGA
TGTTGCGAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGACCTTCAAG
ATCCTGAACGAATGGTCAAATGTAAATGCAGACGACGTATGAAACAAGAA
CAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACAAAAGTCGA
TGTTGATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGCTAAAAAGG
ATAAACAATCATTGACGGGAGACTATTTTGCAAGTGGTGAAAAACCAAAG
TTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGCTACATATC
TGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAACCATG
TTGTTGTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTGGTTTAAGA
CAACTTGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCACGATGTCAA
AAAAGTTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgGCCGA
CGCTGGCGAATTTCCCTGATGTTGACATCGTACCTGGTTCGCCTTACAAC
CGTTCCGATTTACGGGCAGTCAATGTGAATACAGCGGACATGTGTATTTT
GTTATCACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTCTCTG
ATAAAGAAGTCATCCTGGTTACTTTGAATTTGAaagCCATGACTTTTGAC
GAATCAGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGATTCGTCACG
AGGAACTTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGTGGGATTCT
CATCGGGCGCCAATTCAAGGGCGGCCACCCGTATGACTGGACGCCCTGAA
ACTTCAATGTCTCACATGACAGCGGGCGGTAATAGTATGATACAAGAAGT
CAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCCTATGATCA
CTGAACTTGTATGTGATTCGAATGCGATGTACATTGATCAAGATGATATG
AACATCTATGATGATGATGGAATCTTTTTAACGCAACCGTACGCTTGCGG
CTCCGCTTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGCGACATATT
TCAACAGTGACGTATTAACACTTGTCCGTAATCTGGTCACCGGTTCTGTG
AGTCCGGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCGGTTC
GTACGAAACACAAGAGATTGCCGCTGTCAGGAACAGATGTCGGGTGGCAC
AAATTTCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAATGTGGTTTA
TTCGGTGATCTATTTTTGTACGCTCTCCGTACGTACAACATGATCTGTTT
GGGTCTCTACCGATTCCGAGATTCGCAACGTATGAAGGACAAAATACCAA
GCACGAAACGTTACGTCATCACGTTCCCGCCctttaattttgttttggat
CCAACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAACGTAA
AAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCAGGCG
ctttttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCCGGCA
GATGAACGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCTTTAG
TTCCGgtttaattttaattatcatcGGACGTATTTTGTTATATTTCTTCC
ATGGCGCTAAAAGAAGATCGAATAGTGTGATTGATATGAATGAGGTGGAC
GAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGATGGTA
TTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACATTAC
AAGGACGTATATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGAATGC
GCACTCTATATCACAGAAACAGGATATCCAATCGAGCATTGTTTGGATTT
GTCCGATCAAACATTATGGAGAGTTGAAATTTGTTTGAAcgctttcttca
tttttcattttctcattcGGTTCATTGCGGCGAACGACAAATTATCTTTT
TGGGCAATGGAACCTTTAACGTACGTTGATATTGTGACTGTACCAGCCGT
CTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTTCTAC
GTGTCATCTATTTGATCAACTTGGCAGATATCCTACAATTTCTCAACGTA
CTCCACACAGGTTCAAGTCTTGAGATGGCACAGATGATTGGTAATTTCTT
GGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAACACTG
GTGATCCATGGGAGCCTATCAACTACACCAACAAACAGAAATTGAATTAC
TTCGAATGTCTCTATTTTCTATTCGTAACCATGTCAACGGTTGGTTATGG
TGATATATATTGTCATACGTATCTTGGAAGGTTGTTTAATATTGGTTTCA
TCTCTGTTGGCCTGgGTCTATTTACATCATACCTACCAGCTATCCAAGAA
TTCTTAGCTTCACATACGAAATATGATAGAGCTTTCAAGCCTACACCAGG
GAAAAGGCATGTCATTGTTGCCGGATACATCACCGAAGAAAGTGTGACtg
ggtttttcaaagatttcttgCATCCTGATCGAGAAGATAGTCAAACCACT
GTCGTTATATTGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCGACTT
GCAAAGACATTGTACAAAAGCTTCATATTTTATTGGCACCATCTACAAGT
TCATGGACTGCCATCGGACTAGGATGCGAGAAGCAGATGCAGTCATTATT
CTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTAACAT
TACAAGGGTGATTTCAGTGAAGAATTATCACGAGAACATTCGATGTATCG
TACAACTCATGATGAACAAAAACAAGTCACATTTATTGAATTGTCCACAA
TGGAATCGGGAACTTGGTGATGACATCATTTGCATTGATGAGttGAAACT
TGGATTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCAACGTTGCTGG
CAAATCTATTCGCTATGAGGAGCGATACGATAAGCGAGGAGATTCAAGAA
TCAGAGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGATGTA
CACAGCTCAACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAAGCAG
TAGAattatgttttgaaaaattgaatttaatgtTGATTGCCATcgaaatg
aaaatctcaaaaaaagagCGATACTTTGCTATCAATCCCAATGACAAGAA
GTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGACGCCA
GCGATGTTGCGAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGACCTT
CAAGATCCTGAACGAATGGTCAAATGTAAATGCAGACGACGTATGAAACA
AGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACAAAAG
TCGATGTTGATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGCTAAA
AAGGATAAACAATCATTGACGGGAGACTATTTTGCAAGTGGTGAAAAACC
AAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGCTACA
TATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAAGAAC
CATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTGGTTT
AAGACAACTTGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCACGATG
TCAAAAAAGTTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGAGtgG
CCGACGCTGGCGAATTTCCCTGATGTTGACATCGTACCTGGTTCGCCTTA
CAACCGTTCCGATTTACGGGCAGTCAATGTGAATACAGCGGACATGTGTA
TTTTGTTATCACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGCTCTC
TCTGATAAAGAAGTCATCCTGGTTACTTTGAATTTGAaagCCATGACTTT
TGACGAATCAGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGATTCGT
CACGAGGAACTTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGTGGGA
TTCTCATCGGGCGCCAATTCAAGGGCGGCCACCCGTATGACTGGACGCCC
TGAAACTTCAATGTCTCACATGACAGCGGGCGGTAATAGTATGATACAAG
AAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCCTATG
ATCACTGAACTTGTATGTGATTCGAATGCGATGTACATTGATCAAGATGA
TATGAACATCTATGATGATGATGGAATCTTTTTAACGCAACCGTACGCTT
GCGGCTCCGCTTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGCGACA
TATTTCAACAGTGACGTATTAACACTTGTCCGTAATCTGGTCACCGGTTC
TGTGAGTCCGGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCGTCCG
GTTCGTACGAAACACAAGAGATTGCCGCTGTCAGGAACAGATGTCGGGTG
GCACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAATGTGG
TTTATTCGGTGATCTATTTTTGTACGCTCTCCGTACGTACAACATGATCT
GTTTGGGTCTCTACCGATTCCGAGATTCGCAACGTATGAAGGACAAAATA
CCAAGCACGAAACGTTACGTCATCACGTTCCCGCCctttaattttgtttt
ggatCCAACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCGAAAC
GTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATTTTCA
GGCGctttttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGATCCC
GGCAGATGAACGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTAATCT
TTAGTTCCGgtttaattttaattatcatcGGACGTATTTTGTTATATTTC
TTCCATGGCGCTAAAAGAAGATCGAATAGTGTGATTGATATGAATGAGGT
GGACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGAACAAGGAT
GGTATTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCAAACA
TTACAAGGACGTATATTGGTTGTTTTGTCGTTTGTATTCAACTTGGCAGA
ATGCGCACTCTATATCACAGAAACAGGATATCCAATCGAGCATTGTTTGG
ATTTGTCCGATCAAACATTATGGAGAGTTGAAATTTGTTTGAAcgctttc
ttcatttttcattttctcattcGGTTCATTGCGGCGAACGACAAATTATC
TTTTTGGGCAATGGAACCTTTAACGTACGTTGATATTGTGACTGTACCAG
CCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCGCTTT
CTACGTGTCATCTATTTGATCAACTTGGCAGATATCCTACAATTTCTCAA
CGTACTCCACACAGGTTCAAGTCTTGAGATGGCACAGATGATTGGTAATT
TCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGttgGAGAAC
ACTGGTGATCCATGGGAGCCTATCAACTACACCAACAAACAGAAATTGAA
TTACTTCGAATGTCTCTATTTTCTATTCGTAACCATGTCAACGGTTGGTT
ATGGTGATATATATTGTCATACGTATCTTGGAAGGTTGTTTAATATTGGT
TTCATCTCTGTTGGCCTGgGTCTATTTACATCATACCTACCAGCTATCCA
AGAATTCTTAGCTTCACATACGAAATATGATAGAGCTTTCAAGCCTACAC
CAGGGAAAAGGCATGTCATTGTTGCCGGATACATCACCGAAGAAAGTGTG
ACtgggtttttcaaagatttcttgCATCCTGATCGAGAAGATAGTCAAAC
CACTGTCGTTATATTGTCACCGAAATATCCGAGTTTGAAGATGCAAGCCG
ACTTGCAAAGACATTGTACAAAAGCTTCATATTTTATTGGCACCATCTAC
AAGTTCATGGACTGCCATCGGACTAGGATGCGAGAAGCAGATGCAGTCAT
TATTCTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCCGCTA
ACATTACAAGGGTGATTTCAGTGAAGAATTATCACGAGAACATTCGATGT
ATCGTACAACTCATGATGAACAAAAACAAGTCACATTTATTGAATTGTCC
ACAATGGAATCGGGAACTTGGTGATGACATCATTTGCATTGATGAGttGA
AACTTGGATTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCAACGTTG
CTGGCAAATCTATTCGCTATGAGGAGCGATACGATAAGCGAGGAGATTCA
AGAATCAGAGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAAATGAGA
TGTACACAGCTCAACTATCGAATGCTTTCATTGGAATGTCCTTCCCACAA
GCAGTAGAattatgttttgaaaaattgaatttaatgtTGATTGCCATcga
aatgaaaatctcaaaaaaagagCGATACTTTGCTATCAATCCCAATGACA
AGAAGTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCAAGAC
GCCAGCGATGTTGCGAAAGCATCGAAATATTGTGCGAAGTGTCACAAAGA
CCTTCAAGATCCTGAACGAATGGTCAAATGTAAATGCAGACGACGTATGA
AACAAGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAATACGAAACA
AAAGTCGATGTTGATCCAGTGCATTTGCTCGAAGCCGAACCCGATGAAGC
TAAAAAGGATAAACAATCATTGACGGGAGACTATTTTGCAAGTGGTGAAA
AACCAAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAGAAGC
TACATATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGTTCAA
GAACCATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACCACCGCTTG
GTTTAAGACAACTTGTACTTCCATTGCGTGCAAGCAATCGTCTGCCGCAC
GATGTCAAAAAAGTTGTCATTCTTGGAGATGGAGATTTCTTAGCTCGCGA
GtgGCCGACGCTGGCGAATTTCCCTGATGTTGACATCGTACCTGGTTCGC
CTTACAACCGTTCCGATTTACGGGCAGTCAATGTGAATACAGCGGACATG
TGTATTTTGTTATCACCCGGACATGGTAGCGAGGAAGATGAGCACCAAGC
TCTCTCTGATAAAGAAGTCATCCTGGTTACTTTGAATTTGAaagCCATGA
CTTTTGACGAATCAGAACTAGCAGTCACGGAGGAGATCAAGAAAGTCGAT
TCGTCACGAGGAACTTCTATCAACGGTGAAAGTTCTGCCGATGTACGGGT
GGGATTCTCATCGGGCGCCAATTCAAGGGCGGCCACCCGTATGACTGGAC
GCCCTGAAACTTCAATGTCTCACATGACAGCGGGCGGTAATAGTATGATA
CAAGAAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAACATCCC
TATGATCACTGAACTTGTATGTGATTCGAATGCGATGTACATTGATCAAG
ATGATATGAACATCTATGATGATGATGGAATCTTTTTAACGCAACCGTAC
GCTTGCGGCTCCGCTTTCACCGTATCGGTTCTCGATTCACTCGTCAGTGC
GACATATTTCAACAGTGACGTATTAACACTTGTCCGTAATCTGGTCACCG
GTTCTGTGAGTCCGGAACTGGACGAATTGTTAGCAGAAGGCAAGCAGCCG
TCCGGTTCGTACGAAACACAAGAGATTGCCGCTGTCAGGAACAGATGTCG
GGTGGCACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAATATGGGGAAT
GTGGTTTATTCGGTGATCTATTTTTGTACGCTCTCCGTACGTACAACATG
ATCTGTTTGGGTCTCTACCGATTCCGAGATTCGCAACGTATGAAGGACAA
AATACCAAGCACGAAACGTTACGTCATCACGTTCCCGCCctttaattttg
ttttggatCCAACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAAACCG
AAACGTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGCGATT
TTCAGGCGctttttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTCGAGA
TCCCGGCAGATGAACGGAAATGGCCATGGTTTTTAGTGGTTTCCGGGTTA
ATCTTTAGTTCCGgtttaattttaattatcatcGGACGTATTTTGTTATA
TTTCTTCCATGGCGCTAAAAGAAGATCGAATAGTGTGATTGATATGAATG
AGGTGGACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGAACAA
GGATGGTATTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTGCTCA
AACATTACAAGGACGTATATTGGTTGTTTTGTCGTTTGTATTCAACTTGG
CAGAATGCGCACTCTATATCACAGAAACAGGATATCCAATCGAGCATTGT
TTGGATTTGTCCGATCAAACATTATGGAGAGTTGAAATTTGTTTGAAcgc
tttcttcatttttcattttctcattcGGTTCATTGCGGCGAACGACAAAT
TATCTTTTTGGGCAATGGAACCTTTAACGTACGTTGATATTGTGACTGTA
CCAGCCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtcTCCG
CTTTCTACGTGTCATCTATTTGATCAACTTGGCAGATATCCTACAATTTC
TCAACGTACTCCACACAGGTTCAAGTCTTGAGATGGCACAGATGATTGGT
AATTTCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGttgGA
GAACACTGGTGATCCATGGGAGCCTATCAACTACACCAACAAACAGAAAT
TGAATTACTTCGAATGTCTCTATTTTCTATTCGTAACCATGTCAACGGTT
GGTTATGGTGATATATATTGTCATACGTATCTTGGAAGGTTGTTTAATAT
TGGTTTCATCTCTGTTGGCCTGgGTCTATTTACATCATACCTACCAGCTA
TCCAAGAATTCTTAGCTTCACATACGAAATATGATAGAGCTTTCAAGCCT
ACACCAGGGAAAAGGCATGTCATTGTTGCCGGATACATCACCGAAGAAAG
TGTGACtgggtttttcaaagatttcttgCATCCTGATCGAGAAGATAGTC
AAACCACTGTCGTTATATTGTCACCGAAATATCCGAGTTTGAAGATGCAA
GCCGACTTGCAAAGACATTGTACAAAAGCTTCATATTTTATTGGCACCAT
CTACAAGTTCATGGACTGCCATCGGACTAGGATGCGAGAAGCAGATGCAG
TCATTATTCTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGACGCC
GCTAACATTACAAGGGTGATTTCAGTGAAGAATTATCACGAGAACATTCG
ATGTATCGTACAACTCATGATGAACAAAAACAAGTCACATTTATTGAATT
GTCCACAATGGAATCGGGAACTTGGTGATGACATCATTTGCATTGATGAG
ttGAAACTTGGATTCGTGGCACAAAGTTGTAATGCACCTGGATTCTCAAC
GTTGCTGGCAAATCTATTCGCTATGAGGAGCGATACGATAAGCGAGGAGA
TTCAAGAATCAGAGAAATGGAAAGTAGCGTACATGATTGGTGCAGCAAAT
GAGATGTACACAGCTCAACTATCGAATGCTTTCATTGGAATGTCCTTCCC
ACAAGCAGTAGAattatgttttgaaaaattgaatttaatgtTGATTGCCA
TcgaaatgaaaatctcaaaaaaagagCGATACTTTGCTATCAATCCCAAT
GACAAGAAGTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCGCTCA
AGACGCCAGCGATGTTGCGAAAGCATCGAAATATTGTGCGAAGTGTCACA
AAGACCTTCAAGATCCTGAACGAATGGTCAAATGTAAATGCAGACGACGT
ATGAAACAAGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAATACGA
AACAAAAGTCGATGTTGATCCAGTGCATTTGCTCGAAGCCGAACCCGATG
AAGCTAAAAAGGATAAACAATCATTGACGGGAGACTATTTTGCAAGTGGT
GAAAAACCAAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAACAAG
AAGCTACATATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGGAAGT
TCAAGAACCATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACCACCG
CTTGGTTTAAGACAACTTGTACTTCCATTGCGTGCAAGCAATCGTCTGCC
GCACGATGTCAAAAAAGTTGTCATTCTTGGAGATGGAGATTTCTTAGCTC
GCGAGtgGCCGACGCTGGCGAATTTCCCTGATGTTGACATCGTACCTGGT
TCGCCTTACAACCGTTCCGATTTACGGGCAGTCAATGTGAATACAGCGGA
CATGTGTATTTTGTTATCACCCGGACATGGTAGCGAGGAAGATGAGCACC
AAGCTCTCTCTGATAAAGAAGTCATCCTGGTTACTTTGAATTTGAaagCC
ATGACTTTTGACGAATCAGAACTAGCAGTCACGGAGGAGATCAAGAAAGT
CGATTCGTCACGAGGAACTTCTATCAACGGTGAAAGTTCTGCCGATGTAC
GGGTGGGATTCTCATCGGGCGCCAATTCAAGGGCGGCCACCCGTATGACT
GGACGCCCTGAAACTTCAATGTCTCACATGACAGCGGGCGGTAATAGTAT
GATACAAGAAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCTAACA
TCCCTATGATCACTGAACTTGTATGTGATTCGAATGCGATGTACATTGAT
CAAGATGATATGAACATCTATGATGATGATGGAATCTTTTTAACGCAACC
GTACGCTTGCGGCTCCGCTTTCACCGTATCGGTTCTCGATTCACTCGTCA
GTGCGACATATTTCAACAGTGACGTATTAACACTTGTCCGTAATCTGGTC
ACCGGTTCTGTGAGTCCGGAACTGGACGAATTGTTAGCAGAAGGCAAGCA
GCCGTCCGGTTCGTACGAAACACAAGAGATTGCCGCTGTCAGGAACAGAT
GTCGGGTGGCACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAATATGGG
GAATGTGGTTTATTCGGTGATCTATTTTTGTACGCTCTCCGTACGTACAA
CATGATCTGTTTGGGTCTCTACCGATTCCGAGATTCGCAACGTATGAAGG
ACAAAATACCAAGCACGAAACGTTACGTCATCACGTTCCCGCCctttaat
tttgttttggatCCAACTGATCTGGTCTTTGTTTTAATGCAGTTCGAAAA
ACCGAAACGTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCGTCGC
GATTTTCAGGCGctttttaaATGGCGAGTGCAGCTTGTCGTATTGAAGTC
GAGATCCCGGCAGATGAACGGAAATGGCCATGGTTTTTAGTGGTTTCCGG
GTTAATCTTTAGTTCCGgtttaattttaattatcatcGGACGTATTTTGT
TATATTTCTTCCATGGCGCTAAAAGAAGATCGAATAGTGTGATTGATATG
AATGAGGTGGACGAATTGGAGGAAGAGGAATTCTTCTTGGAAGATTTAGA
ACAAGGATGGTATTTAGATTTGAAAGAAGGTGCTGGCAATCTTGTGTCTG
CTCAAACATTACAAGGACGTATATTGGTTGTTTTGTCGTTTGTATTCAAC
TTGGCAGAATGCGCACTCTATATCACAGAAACAGGATATCCAATCGAGCA
TTGTTTGGATTTGTCCGATCAAACATTATGGAGAGTTGAAATTTGTTTGA
AcgctttcttcatttttcattttctcattcGGTTCATTGCGGCGAACGAC
AAATTATCTTTTTGGGCAATGGAACCTTTAACGTACGTTGATATTGTGAC
TGTACCAGCCGTCTTTGTGGCTGTCTATCTTGGCCGAAACTGGCTAGgtc
TCCGCTTTCTACGTGTCATCTATTTGATCAACTTGGCAGATATCCTACAA
TTTCTCAACGTACTCCACACAGGTTCAAGTCTTGAGATGGCACAGATGAT
TGGTAATTTCTTGGCTTTGACTCTGGCGTCAGCTGGTATTGTTCATTTGt
tgGAGAACACTGGTGATCCATGGGAGCCTATCAACTACACCAACAAACAG
AAATTGAATTACTTCGAATGTCTCTATTTTCTATTCGTAACCATGTCAAC
GGTTGGTTATGGTGATATATATTGTCATACGTATCTTGGAAGGTTGTTTA
ATATTGGTTTCATCTCTGTTGGCCTGgGTCTATTTACATCATACCTACCA
GCTATCCAAGAATTCTTAGCTTCACATACGAAATATGATAGAGCTTTCAA
GCCTACACCAGGGAAAAGGCATGTCATTGTTGCCGGATACATCACCGAAG
AAAGTGTGACtgggtttttcaaagatttcttgCATCCTGATCGAGAAGAT
AGTCAAACCACTGTCGTTATATTGTCACCGAAATATCCGAGTTTGAAGAT
GCAAGCCGACTTGCAAAGACATTGTACAAAAGCTTCATATTTTATTGGCA
CCATCTACAAGTTCATGGACTGCCATCGGACTAGGATGCGAGAAGCAGAT
GCAGTCATTATTCTTTGTAACAAGAAATGTATAAGTCCCGATGAAGAAGA
CGCCGCTAACATTACAAGGGTGATTTCAGTGAAGAATTATCACGAGAACA
TTCGATGTATCGTACAACTCATGATGAACAAAAACAAGTCACATTTATTG
AATTGTCCACAATGGAATCGGGAACTTGGTGATGACATCATTTGCATTGA
TGAGttGAAACTTGGATTCGTGGCACAAAGTTGTAATGCACCTGGATTCT
CAACGTTGCTGGCAAATCTATTCGCTATGAGGAGCGATACGATAAGCGAG
GAGATTCAAGAATCAGAGAAATGGAAAGTAGCGTACATGATTGGTGCAGC
AAATGAGATGTACACAGCTCAACTATCGAATGCTTTCATTGGAATGTCCT
TCCCACAAGCAGTAGAattatgttttgaaaaattgaatttaatgtTGATT
GCCATcgaaatgaaaatctcaaaaaaagagCGATACTTTGCTATCAATCC
CAATGACAAGAAGTTGAGACTTTTACCAGGAACGCGTGGTTTCTTTTTCG
CTCAAGACGCCAGCGATGTTGCGAAAGCATCGAAATATTGTGCGAAGTGT
CACAAAGACCTTCAAGATCCTGAACGAATGGTCAAATGTAAATGCAGACG
ACGTATGAAACAAGAACAGGAAAAGAAGAATCCAGCTCAGAAAGGAAAAT
ACGAAACAAAAGTCGATGTTGATCCAGTGCATTTGCTCGAAGCCGAACCC
GATGAAGCTAAAAAGGATAAACAATCATTGACGGGAGACTATTTTGCAAG
TGGTGAAAAACCAAAGTTTGACCAAAGTGGGACGTTTTATTGGTGCGAAA
CAAGAAGCTACATATCTGCCAGGAtgAGTCTCGGTGATGCTGCAGAAAGG
AAGTTCAAGAACCATGTTGTTGTGTTGGTTTTATCACAACGTCTTTCACC
ACCGCTTGGTTTAAGACAACTTGTACTTCCATTGCGTGCAAGCAATCGTC
TGCCGCACGATGTCAAAAAAGTTGTCATTCTTGGAGATGGAGATTTCTTA
GCTCGCGAGtgGCCGACGCTGGCGAATTTCCCTGATGTTGACATCGTACC
TGGTTCGCCTTACAACCGTTCCGATTTACGGGCAGTCAATGTGAATACAG
CGGACATGTGTATTTTGTTATCACCCGGACATGGTAGCGAGGAAGATGAG
CACCAAGCTCTCTCTGATAAAGAAGTCATCCTGGTTACTTTGAATTTGAa
agCCATGACTTTTGACGAATCAGAACTAGCAGTCACGGAGGAGATCAAGA
AAGTCGATTCGTCACGAGGAACTTCTATCAACGGTGAAAGTTCTGCCGAT
GTACGGGTGGGATTCTCATCGGGCGCCAATTCAAGGGCGGCCACCCGTAT
GACTGGACGCCCTGAAACTTCAATGTCTCACATGACAGCGGGCGGTAATA
GTATGATACAAGAAGTCAAGAAAACGTTTAAAGGAGCTTTGAATGGAGCT
AACATCCCTATGATCACTGAACTTGTATGTGATTCGAATGCGATGTACAT
TGATCAAGATGATATGAACATCTATGATGATGATGGAATCTTTTTAACGC
AACCGTACGCTTGCGGCTCCGCTTTCACCGTATCGGTTCTCGATTCACTC
GTCAGTGCGACATATTTCAACAGTGACGTATTAACACTTGTCCGTAATCT
GGTCACCGGTTCTGTGAGTCCGGAACTGGACGAATTGTTAGCAGAAGGCA
AGCAGCCGTCCGGTTCGTACGAAACACAAGAGATTGCCGCTGTCAGGAAC
AGATGTCGGGTGGCACAAATTTCTTTGTTTGAAGGGCCTTTATCTGAATA
TGGGGAATGTGGTTTATTCGGTGATCTATTTTTGTACGCTCTCCGTACGT
ACAACATGATCTGTTTGGGTCTCTACCGATTCCGAGATTCGCAACGTATG
AAGGACAAAATACCAAGCACGAAACGTTACGTCATCACGTTCCCGCCctt
taattttgttttggatCCAACTGATCTGGTCTTTGTTTTAATGCAGTTCG
AAAAACCGAAACGTAAAAGGAAATCTGTGTCTCGTGTTGGCTCTGTGGCG
TCGCGATTTTCAGGCGctttttaa
Related Sequences
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000002XLOC_000002Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000002-proteinTCONS_00000002-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000002-exon-sc0000001-1491911889:38516..39450TCONS_00000002-exon-sc0000001-1491911889:38516..39450Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:38516..39450TCONS_00000002-exon-sc0000001-1510915933:38516..39450Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:51141..51440TCONS_00000002-exon-sc0000001-1491911889:51141..51440Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:51141..51440TCONS_00000002-exon-sc0000001-1510915933:51141..51440Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:53175..53294TCONS_00000002-exon-sc0000001-1491911889:53175..53294Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:53175..53294TCONS_00000002-exon-sc0000001-1510915933:53175..53294Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:53850..53911TCONS_00000002-exon-sc0000001-1491911889:53850..53911Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:53850..53911TCONS_00000002-exon-sc0000001-1510915933:53850..53911Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:55028..55121TCONS_00000002-exon-sc0000001-1491911889:55028..55121Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:55028..55121TCONS_00000002-exon-sc0000001-1510915933:55028..55121Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:56604..56718TCONS_00000002-exon-sc0000001-1491911889:56604..56718Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:56604..56718TCONS_00000002-exon-sc0000001-1510915933:56604..56718Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:57224..57299TCONS_00000002-exon-sc0000001-1491911889:57224..57299Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:57224..57299TCONS_00000002-exon-sc0000001-1510915933:57224..57299Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:57685..57760TCONS_00000002-exon-sc0000001-1491911889:57685..57760Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:57685..57760TCONS_00000002-exon-sc0000001-1510915933:57685..57760Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:58958..59044TCONS_00000002-exon-sc0000001-1491911889:58958..59044Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:58958..59044TCONS_00000002-exon-sc0000001-1510915933:58958..59044Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:62021..62110TCONS_00000002-exon-sc0000001-1491911889:62021..62110Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:62021..62110TCONS_00000002-exon-sc0000001-1510915933:62021..62110Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:62526..62617TCONS_00000002-exon-sc0000001-1491911889:62526..62617Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:62526..62617TCONS_00000002-exon-sc0000001-1510915933:62526..62617Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:68186..68296TCONS_00000002-exon-sc0000001-1491911889:68186..68296Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:68186..68296TCONS_00000002-exon-sc0000001-1510915933:68186..68296Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:68723..68828TCONS_00000002-exon-sc0000001-1491911889:68723..68828Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:68723..68828TCONS_00000002-exon-sc0000001-1510915933:68723..68828Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:70292..70374TCONS_00000002-exon-sc0000001-1491911889:70292..70374Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:70292..70374TCONS_00000002-exon-sc0000001-1510915933:70292..70374Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:71353..71422TCONS_00000002-exon-sc0000001-1491911889:71353..71422Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:71353..71422TCONS_00000002-exon-sc0000001-1510915933:71353..71422Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:71884..71949TCONS_00000002-exon-sc0000001-1491911889:71884..71949Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:71884..71949TCONS_00000002-exon-sc0000001-1510915933:71884..71949Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:72518..72604TCONS_00000002-exon-sc0000001-1491911889:72518..72604Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:72518..72604TCONS_00000002-exon-sc0000001-1510915933:72518..72604Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:72991..73115TCONS_00000002-exon-sc0000001-1491911889:72991..73115Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:72991..73115TCONS_00000002-exon-sc0000001-1510915933:72991..73115Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:73799..73867TCONS_00000002-exon-sc0000001-1491911889:73799..73867Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:73799..73867TCONS_00000002-exon-sc0000001-1510915933:73799..73867Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:74641..74730TCONS_00000002-exon-sc0000001-1491911889:74641..74730Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:74641..74730TCONS_00000002-exon-sc0000001-1510915933:74641..74730Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:75403..75476TCONS_00000002-exon-sc0000001-1491911889:75403..75476Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:75403..75476TCONS_00000002-exon-sc0000001-1510915933:75403..75476Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:76137..76254TCONS_00000002-exon-sc0000001-1491911889:76137..76254Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:76137..76254TCONS_00000002-exon-sc0000001-1510915933:76137..76254Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:76779..76887TCONS_00000002-exon-sc0000001-1491911889:76779..76887Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:76779..76887TCONS_00000002-exon-sc0000001-1510915933:76779..76887Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:77333..77428TCONS_00000002-exon-sc0000001-1491911889:77333..77428Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:77333..77428TCONS_00000002-exon-sc0000001-1510915933:77333..77428Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:77796..77882TCONS_00000002-exon-sc0000001-1491911889:77796..77882Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:77796..77882TCONS_00000002-exon-sc0000001-1510915933:77796..77882Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:78108..78149TCONS_00000002-exon-sc0000001-1491911889:78108..78149Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:78108..78149TCONS_00000002-exon-sc0000001-1510915933:78108..78149Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:78498..78648TCONS_00000002-exon-sc0000001-1491911889:78498..78648Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:78498..78648TCONS_00000002-exon-sc0000001-1510915933:78498..78648Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:80140..80412TCONS_00000002-exon-sc0000001-1491911889:80140..80412Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:80140..80412TCONS_00000002-exon-sc0000001-1510915933:80140..80412Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:81962..82095TCONS_00000002-exon-sc0000001-1491911889:81962..82095Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:81962..82095TCONS_00000002-exon-sc0000001-1510915933:81962..82095Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:82994..83188TCONS_00000002-exon-sc0000001-1491911889:82994..83188Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:82994..83188TCONS_00000002-exon-sc0000001-1510915933:82994..83188Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:84244..84294TCONS_00000002-exon-sc0000001-1491911889:84244..84294Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:84244..84294TCONS_00000002-exon-sc0000001-1510915933:84244..84294Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1491911889:84353..84744TCONS_00000002-exon-sc0000001-1491911889:84353..84744Clytia hemisphaericaexon
TCONS_00000002-exon-sc0000001-1510915933:84353..84744TCONS_00000002-exon-sc0000001-1510915933:84353..84744Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:38516..84744 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.681058 5.39257e-09 0.176051 0.381305 0.419057 1.54651 1.08103 0.776243 1.37878 1.06544 1.47902 2.13815 6.88655 4.7104 2.29533 1.59755 1.55828 1.87903 7.32278 5.70644 4.97922 4.48573 3.2113 3.67915 3.52666 7.32013 1.68776 0.746078 2.54008 0.0469854
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR028325VG_K_chnl
IPR013099K_chnl_dom
IPR003929K_chnl_BK_asu
Vocabulary: Biological Process
TermDefinition
GO:0006813potassium ion transport
Vocabulary: Molecular Function
TermDefinition
GO:0005249voltage-gated potassium channel activity
Vocabulary: Cellular Component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006813 potassium ion transport
cellular_component GO:0016020 membrane
cellular_component GO:0008076 voltage-gated potassium channel complex
molecular_function GO:0005249 voltage-gated potassium channel activity
Blast
BLAST of TCONS_00000002 vs. Swiss-Prot (Human)
Match: KCMA1 (Calcium-activated potassium channel subunit alpha-1 OS=Homo sapiens GN=KCNMA1 PE=1 SV=2)

HSP 1 Score: 813.913 bits (2101), Expect = 0.000e+0
Identity = 450/1073 (41.94%), Postives = 633/1073 (58.99%), Query Frame = 3
Query: 1284 GWYLDLKEGAGNLVSAQTLQGRILVVLSFVFNLAECALYITETGYPIEHCLDLSDQTLWRVEICLNAFFIFHFLIRFIAANDKLSFWAMEPLTYVDIVTVPAVFVAVYLGRNWLGLRFLRVIYLINLADILQFLNVLHTGSSLEMAQMIGNFLALTLASAGIVHLLENTGDPWEPINYTNKQKLNYFECLYFLFVTMSTVGYGDIYCHTYLGRLFNIGFISVGLGLFTSYLPAIQEFLASHTKYDRAFKPTPGKRHVIVAGYITEESVTGFFKDFLHPDREDSQTTVVILSPKYPSLKMQADLQRHCTKASYFIGTIYKFMDCHRTRMREADAVIILCNKKCISPDEEDAANITRVISVKNYHENIRCIVQLMMNKNKSHLLNCPQWNRELGDDIICIDELKLGFVAQSCNAPGFSTLLANLFAMRSDTISEEIQESEKWKVAYMIGAANEMYTAQLSNAFIGMSFPQAVELCFEKLNLMLIAIEMKISKKERYFAINPNDKKLRLLPGT-------------RGFFFAQ----DASDVAKASKY-----------------CAKCHKDLQD-------------------PEXXXXXXXXXXXXQEQEKKNPAQKGKYETKVDVDPVHLLEAEPDEAKKDKQSLTG----DYFASGEKPKFDQSGTFYWCETRSYISARMSLGDAAERKFKNHVVVLVLSQRLSPPLGLRQLVLPLRASNRLPHDVKKVVILGDGDFLAREWPTLANFPDVDIVPGSPYNRSDLRAVNVNTADMCILLSPGHGSEEDEHQALSDKEVILVTLNLKAMTFDESELAVTEEIKKVDSSRGTSINGESSADVRVGFSSGANSRAATRMTGRPETSMSHMTAGGNSMIQEVKKTFKGALNGANIPMITELVCDSNAXXXXXXXXXXXXXXGIFLTQPYACGSAFTVSVLDSLVSATYFNSDVLTLVRNLVTGSVSPELDELLAEGKQPSGSYETQEIAAVRNRCRVAQISLFEGPLSEYGECGLFGDLFLYALRTYNMICLGLYRFRDSQRMKDKIPSTKRYVITFPPFNFVLDPTDLVFVLMQFE 4331
            GW   +K+ AG ++SAQTL GR+LVVL F  ++    +Y  ++  PIE C +       ++++  N FF+ +F +RFIAANDKL FW +E  + VD  TVP VFV+VYL R+WLGLRFLR + LI  ++ILQFLN+L T +S+++  ++  F++  L +AG +HL+EN+GDPWE  N+ N Q L Y+EC+Y L VTMSTVGYGD+Y  T LGRLF + FI  GL +F SY+P I E + +  KY  ++    G++H++V G+IT ESV+ F KDFLH DR+D    +V L    P+L+++A  +RH T+  ++ G++    D  R ++  ADA +IL NK C  PD EDA+NI RVIS+KNYH  IR I Q++   NK+HLLN P WN + GDD IC+ ELKLGF+AQSC A G ST+LANLF+MRS    EE    + W+  Y+ G +NEMYT  LS+AF+G+SFP   ELCF KL L++IAIE K + +E    INP +  L++  GT             R FF+ +    D +D  +  K                  C  C +  +D                   P   V         +  E + P+     + + +    +     P   + D   + G    D   S  K K+D +G F+WC  +      ++  +AA      HVVV +     S  +GLR LV+PLRASN   H++K +V +G  ++L REW TL NFP V I+PG+P +R+DLRAVN+N  DMC++LS    + +D   +L DKE IL +LN+K+M FD+S + V +   +                   GF+     R++      P+ S  H       M+++   T      G NIP+ITELV D+N  ++DQDD +  D + ++LTQP+ACG+AF VSVLDSL+SATYFN ++LTL+R LVTG  +PEL+ L+AE     G Y T +  A R+RCRVAQ++L +GP ++ G+ G +GDLF  AL+TYNM+C G+YR RD+  +      TKRYVIT PP+ F L PTDL+F LMQF+
Sbjct:  157 GWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFW-LEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWE--NFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNH-LKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRPKMSIYKRMRRACCFDCGRSERDCSCMSGRVRGNVDTLERAFPLSSVSVNDCSTSFRAFEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSNVK-KYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDD--TSLQDKECILASLNIKSMQFDDS-IGVLQANSQ-------------------GFTPPGMDRSS------PDNSPVH------GMLRQPSIT-----TGVNIPIITELVNDTNVQFLDQDDDDDPDTE-LYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAH-LSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFD 1179          
The following BLAST results are available for this feature:
BLAST of TCONS_00000002 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KCMA10.000e+041.94Calcium-activated potassium channel subunit alpha-... [more]
back to top