Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073837-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00073837-protein
Unique NameTCONS_00073837-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length207

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00073837-protein ID=TCONS_00073837-protein|Name=TCONS_00073837-protein|organism=Clytia hemisphaerica|type=polypeptide|length=207bp
SVRYSIVCRLTQSFCKRSQFNICKFGWKNNQCKEKVWCYFKKKNLSGLRR
GILKISKPNTWRKGKKSCIKNFDIWLFVIKELKKVTDSNTNTRGFKRTFY
MMSASQTKQTSCKFSAYHPVIPKNYTPAWKQDMKNRTLITENAKLANIEY
NGTQSTLYLEKRERVVPSEPIRDTKALGTSTEGFIPPMHSSLSKYQSSLM
FRTSHGI
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_045855XLOC_045855Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00073837TCONS_00073837Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR027965DUF4513
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027965Protein of unknown function DUF4513PFAMPF14983DUF4513coord: 111..200
e-value: 1.2E-8
score: 35.0

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073837-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top