Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073291-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00073291-protein
Unique NameTCONS_00073291-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length442

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00073291-protein ID=TCONS_00073291-protein|Name=TCONS_00073291-protein|organism=Clytia hemisphaerica|type=polypeptide|length=442bp
MKEHNKSEDEILASWLVKRRRTTILGVMQRSLFAFEYSAVAVSALYYYRY
TLKVHDAKLFYSFSMAVMFLSAAASAMFIGRYMDQTRHLRRIALTTAMFS
VIGNVFYTIPYSRYFPIIARTLCGVSDGIQPAMAGEFARVYTKEEFAKVL
SIYQISASVIYALAPCTPVLFNGVHFYIGPIEINQYNCISLVLIILVLVY
TLLVYINVTDLTKEDGYHIFVAKYKNDINEDDVSPSGKKSDWTLMDTLTN
ANLLVLIFTDGFISYIDSMMEVMNNMIGLYNFGWNINRISVLTGIAAIIF
SAANFIFQQRVLKSRLTFYLLFIVCFLFAMMELSLATISINIPLNVDAIK
FTLFTSCIGLNILFGFGSGVYSKWLIFSLVPADSKSFIESQRYVVAKSFM
CCGYFTAFLMYQESFYGFTILSCICFAIVTFLLLWRCKFTNE
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_045471XLOC_045471Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00073291TCONS_00073291Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR011701MFS
IPR020846MFS_dom
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055085 transmembrane transport
cellular_component GO:0016021 integral component of membrane
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 51..371
e-value: 1.9E-11
score: 43.4
NoneNo IPR availableGENE3D1.20.1250.20coord: 237..442
e-value: 0.025
score: 13.5
NoneNo IPR availableGENE3D1.20.1250.20coord: 7..215
e-value: 1.7E-11
score: 43.2
IPR020846Major facilitator superfamily domainSUPERFAMILY103473MFS general substrate transportercoord: 18..438

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073291-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top