Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00072367-protein ID=TCONS_00072367-protein|Name=TCONS_00072367-protein|organism=Clytia hemisphaerica|type=polypeptide|length=204bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Blast
BLAST of TCONS_00072367-protein vs. Swiss-Prot (Human)
Match: BAP18 (Chromatin complexes subunit BAP18 OS=Homo sapiens GN=BAP18 PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 1.627e-16 Identity = 34/77 (44.16%), Postives = 50/77 (64.94%), Query Frame = 0 Query: 6 KVAEIFTTAGESFTKLGNLAMSLQPGAEKGSTDSKWGDEEIDMLHSAVKQFGSEVEKISTKVRSKASAQQKLVLRQK 82 KV EIF+ AG +FTKLG L M L P A+ +KW + EI+ML +AVK+FG ++ IS ++ + AQ K +++K Sbjct: 7 KVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKERTVAQIKATVKRK 83 The following BLAST results are available for this feature:
BLAST of TCONS_00072367-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|