Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00071749-protein ID=TCONS_00071749-protein|Name=TCONS_00071749-protein|organism=Clytia hemisphaerica|type=polypeptide|length=284bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
Term Definition
GO:0042981 regulation of apoptotic process
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
biological_process
GO:0042981 regulation of apoptotic process
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
20 40 60 80 100 120 140 160 180 200 220 240 260 280 Score = 43.47 Score = 33.28 Score = 35.57 Expect = 3.3E-24 / Score = 85.3 Score = Score = Expect = 2.8E-17 / Score = 73.4 Expect = 1.3E-32 / Score = 112.8 Score = Expect = 5.82975E-31 / Score = 112.812 Score = Score = 21.323 Sequence PR01862 PF00452 SSF56854 SM00337 G3DSA:1.10.437.10 mobidb-lite cd06845 PS01258 PS50062
IPR Term IPR Description Source Source Term Source Description Alignment
IPR026298 Blc2 family PRINTS PR01862 BCL2FAMILY coord: 174..186 IPR026298 Blc2 family PFAM PF00452 Bcl-2 coord: 139..239 IPR026298 Blc2 family SUPERFAMILY 56854 Bcl-2 inhibitors of programmed cell death coord: 123..270 None No IPR available SMART SM00337 bclneu2 coord: 137..239 None No IPR available GENE3D 1.10.437.10 coord: 54..259 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 72..93 None No IPR available CDD cd06845 Bcl-2_like coord: 132..245 IPR020726 Apoptosis regulator, Bcl-2, BH2 motif, conserved site PROSITE PS01258 BH2 coord: 232..243 IPR002475 Bcl2-like PROSITE PS50062 BCL2_FAMILY coord: 137..241
Blast
BLAST of TCONS_00071749-protein vs. Swiss-Prot (Human)
Match:
BOK (Bcl-2-related ovarian killer protein OS=Homo sapiens GN=BOK PE=1 SV=1)
HSP 1 Score: 80.1073 bits (196), Expect = 5.006e-18
Identity = 53/209 (25.36%), Postives = 91/209 (43.54%), Query Frame = 0
Query: 31 LDGSKSRDEIISEAQILSNDYMDDRLIRSGLNFKQRKISQSTKHLLKGQKGGSNSKSVDELYPNSNRLNSMAKSEKAATIEAVRIMAEKRHSPNGCLLTMDDLSKVLMYVGEALEVKHPTVYTEILQQLNVRSSLADVNLKRIFLNVAKELFAEGINWPKIVSFFAFAGGLAVDCVLNGSSIHVTRIKTWTVEFIEHDLVDWILHQGGW 239
D S + E++++A+ L +Y+ RL+R+GL++ + E+AA + + ++ VL+ +G+ LE+ P+VY + +QL++ S ++ + FL VA +F+ GI W K+VS +A A GLAVDCV V + EF+ L W+ +GGW
Sbjct: 18 FDRSPTDKELVAQAKALGREYVHARLLRAGLSW--------------------------------------SAPERAAPVPG----------------RLAEVCAVLLRLGDELEMIRPSVYRNVARQLHI-SLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGW 171
The following BLAST results are available for this feature:
BLAST of TCONS_00071749-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
M P S L I E K G Q F T F K Q M L L Q F Q I A M N R A R Y G R L D G S K S R D E I I S E A Q I L S N D Y M D D R L I R S G L N F K Q R K I S Q S T K H L L K G Q K G G S N S K S V D E L Y P N S N R L N S M A K S E K A A T I E A V R I M A E K R H S P N G C L L T M D D L S K V L M Y V G E A L E V K H P T V Y T E I L Q Q L N V R S S L A D V N L K R I F L N V A K E L F A E G I N W P K I V S F F A F A G G L A V D C V L N G S S I H V T R I K T W T V E F I E H D L V D W I L H Q G G W V G L F D H F T A H H Q P K I I Q N C A W T I S A F V L L F S V L L A A L M A Y I L K L S 20 40 60 80 100 120 140 160 180 200 220 240 260 280 Expect = 5.01e-18 / Id = 25.36 Sequence BOK
Match Name E-value Identity Description
BOK 5.006e-18 25.36 Bcl-2-related ovarian killer protein OS=Homo sapie... [more]
back to top
