Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00071699-protein ID=TCONS_00071699-protein|Name=TCONS_00071699-protein|organism=Clytia hemisphaerica|type=polypeptide|length=109bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00071699-protein vs. Swiss-Prot (Human)
Match: MRCKA (Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1) HSP 1 Score: 102.834 bits (255), Expect = 6.485e-27 Identity = 52/92 (56.52%), Postives = 65/92 (70.65%), Query Frame = 0 Query: 6 AEKRLRALERLYLS-PNNIPREMFSAETLLDILIVLYDECNTTVMKRDKRVVDFLEVAKPVATRVKNLRLKREDFETLNVIGRGAFGEVRFV 96 E RLR LE+ L P + FS ETLLDILI LYDECN + ++R+K ++++LE AKP ++VK +RL REDFE L VIGRGAFGEV V Sbjct: 3 GEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVV 94 The following BLAST results are available for this feature:
BLAST of TCONS_00071699-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|