Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00069108-protein ID=TCONS_00069108-protein|Name=TCONS_00069108-protein|organism=Clytia hemisphaerica|type=polypeptide|length=106bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00069108-protein vs. Swiss-Prot (Human)
Match: SCLY (Selenocysteine lyase OS=Homo sapiens GN=SCLY PE=1 SV=4) HSP 1 Score: 73.1738 bits (178), Expect = 1.558e-16 Identity = 36/69 (52.17%), Postives = 47/69 (68.12%), Query Frame = 0 Query: 4 KPHIITSCIEHDSILNPLKELEREGRVDVTYVNVSKEHGFVDPDNVLQEIRDETVLVTLMMANNETGVI 72 KPH ITS +EHDSI PL+ L E VT+V VSK G + D++L +R T LVT+M+ANNETG++ Sbjct: 135 KPHFITSSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQAEVDDILAAVRPTTRLVTIMLANNETGIV 203 The following BLAST results are available for this feature:
BLAST of TCONS_00069108-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|