Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00067704-protein ID=TCONS_00067704-protein|Name=TCONS_00067704-protein|organism=Clytia hemisphaerica|type=polypeptide|length=111bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00067704-protein vs. Swiss-Prot (Human)
Match: SDHF4 (Succinate dehydrogenase assembly factor 4, mitochondrial OS=Homo sapiens GN=SDHAF4 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.492e-16 Identity = 31/47 (65.96%), Postives = 32/47 (68.09%), Query Frame = 0 Query: 65 ESEKQEPDPYAPFPDATNPETGEIGGPLGPEPTRYGDWERKGRCSDF 111 E E +P FPD NP T E GGP GPEPTRYGDWERKGRC DF Sbjct: 62 EDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 108 The following BLAST results are available for this feature:
BLAST of TCONS_00067704-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|