Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00067484-protein ID=TCONS_00067484-protein|Name=TCONS_00067484-protein|organism=Clytia hemisphaerica|type=polypeptide|length=528bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00067484-protein vs. Swiss-Prot (Human)
Match: CLC4K (C-type lectin domain family 4 member K OS=Homo sapiens GN=CD207 PE=1 SV=2) HSP 1 Score: 90.8929 bits (224), Expect = 4.853e-20 Identity = 49/118 (41.53%), Postives = 63/118 (53.39%), Query Frame = 0 Query: 204 YYFSISKKNWQSAENDCIYLGGHLTSVHSQAENEFINQEIKRTTGNVIVWYGGERKN--NVFVWTDGTIFTKT----FWNTGEPNNLGGNENCLNVYATGM--WNDISCHNLFYYVCK 313 YYFS+ K W SAE C+ HLTSV S++E EF+ +T G +I W G + + W D T F K FW GEPNN G NE+C N+ A + WND C F ++CK Sbjct: 207 YYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLY----KTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICK 320 The following BLAST results are available for this feature:
BLAST of TCONS_00067484-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|