Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00067200-protein ID=TCONS_00067200-protein|Name=TCONS_00067200-protein|organism=Clytia hemisphaerica|type=polypeptide|length=123bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00067200-protein vs. Swiss-Prot (Human)
Match: CTF8 (Chromosome transmission fidelity protein 8 homolog OS=Homo sapiens GN=CHTF8 PE=1 SV=1) HSP 1 Score: 84.7297 bits (208), Expect = 1.849e-22 Identity = 49/118 (41.53%), Postives = 71/118 (60.17%), Query Frame = 0 Query: 1 MVQIFLKLGEDP--KEWSIVELQGTLESSEEE-LCGSHIGNLHFDDKGTPQLICGHHLVTGKIQKLDKPYAVMKKNSISHGMSESMEIDDSDGQSTAYDIVAFVKQKIIFKNRPKPII 115 MVQI + EW ++ELQG +E+ L G+ +G+LH+ +G P LI GHH++ GKI L+KP+AV+ K+ + G + E+ G T Y + A +K KI+FK RPKPII Sbjct: 1 MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPFAVLVKH--TPGDQDCDELGRETG--TRYLVTALIKDKILFKTRPKPII 114 The following BLAST results are available for this feature:
BLAST of TCONS_00067200-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|