Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00066592-protein ID=TCONS_00066592-protein|Name=TCONS_00066592-protein|organism=Clytia hemisphaerica|type=polypeptide|length=228bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
Term Definition
GO:0006886 intracellular protein transport GO:0016192 vesicle-mediated transport
Vocabulary: Cellular Component
Term Definition
GO:0016020 membrane
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
biological_process
GO:0006886 intracellular protein transport
biological_process
GO:0016192 vesicle-mediated transport
cellular_component
GO:0016020 membrane
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
20 40 60 80 100 120 140 160 180 200 220 Score = Score = Expect = 3.7E-18 / Score = 64.9 Expect = 6.6E-16 / Score = 58.1 Expect = 1.1E-15 / Score = 57.5 Expect = 2.84277E-18 / Score = 74.9184 Score = Expect = 2.7E-13 / Score = 50.0 Score = 8.58 Score = Sequence Coil Coil G3DSA:1.20.5.110 G3DSA:1.20.58.400 PF12352 cd15890 SSF58038 PF05008 PS50192 SSF47661
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available COILS Coil Coil coord: 161..181 None No IPR available COILS Coil Coil coord: 40..60 None No IPR available GENE3D 1.20.5.110 coord: 123..196 None No IPR available GENE3D 1.20.58.400 coord: 1..90 None No IPR available PFAM PF12352 V-SNARE_C coord: 136..199 None No IPR available CDD cd15890 SNARE_Vti1b coord: 134..194 None No IPR available SUPERFAMILY 58038 SNARE fusion complex coord: 125..196 IPR007705 Vesicle transport v-SNARE, N-terminal PFAM PF05008 V-SNARE coord: 13..90 IPR000727 Target SNARE coiled-coil homology domain PROSITE PS50192 T_SNARE coord: 133..195 IPR010989 SNARE SUPERFAMILY 47661 t-snare proteins coord: 8..91
Blast
BLAST of TCONS_00066592-protein vs. Swiss-Prot (Human)
Match:
VTI1B (Vesicle transport through interaction with t-SNAREs homolog 1B OS=Homo sapiens GN=VTI1B PE=1 SV=3)
HSP 1 Score: 118.627 bits (296), Expect = 6.041e-33
Identity = 81/227 (35.68%), Postives = 138/227 (60.79%), Query Frame = 0
Query: 2 SSEEYENCLDEFRTYYDQLKSVVKNKLPKLTGEIRKRELRNADRLLEDAEAQLTQMFEEAQSAPGAYRTSLLSQTRGHKSDLEKLKRELITAKSTSVQSSSSGSRDDLLG-YGGTSATSNFESQQRGMMQEGLDIMNRTSDSVARSQRIAAETDEYGVQILADLDDQKESLIRVRDKVKQTDSDLTKSRRIIQSIGVRMITNKLLLIVIIVLEVIILGAVVYIKYFK 227
SSE +E + FR ++ L+ V + L E +K+ +R+ D ++A L +M EE + AP ++R ++S+ R ++ DL KL RE+ +ST + ++ G D G Y + N QR M+ +G + +NR + S+ RS RIA ETD+ G +I+ +L +Q++ L R + ++ T +L+KSR+I++S+ ++ TNKLLL +II+LE+ ILG +VY K+F+
Sbjct: 7 SSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREV---RSTPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLELAILGGLVYYKFFR 230
The following BLAST results are available for this feature:
BLAST of TCONS_00066592-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
M S S E E Y E N C L D E F R T Y Y D Q L K S V V K N K L P K L T G E I R K R E L R N A D R L L E D A E A Q L T Q M F E E A Q S A P G A Y R T S L L S Q T R G H K S D L E K L K R E L I T A K S T S V Q S S S S G S R D D L L G Y G G T S A T S N F E S Q Q R G M M Q E G L D I M N R T S D S V A R S Q R I A A E T D E Y G V Q I L A D L D D Q K E S L I R V R D K V K Q T D S D L T K S R R I I Q S I G V R M I T N K L L L I V I I V L E V I I L G A V V Y I K Y F K K 20 40 60 80 100 120 140 160 180 200 220 Expect = 6.04e-33 / Id = 35.68 Sequence VTI1B
Match Name E-value Identity Description
VTI1B 6.041e-33 35.68 Vesicle transport through interaction with t-SNARE... [more]
back to top
