Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00066588-protein ID=TCONS_00066588-protein|Name=TCONS_00066588-protein|organism=Clytia hemisphaerica|type=polypeptide|length=291bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
Term Definition
GO:0033897 ribonuclease T2 activity GO:0003723 RNA binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
molecular_function
GO:0033897 ribonuclease T2 activity
molecular_function
GO:0003723 RNA binding
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
50 100 150 200 250 Expect = 5.8E-53 / Score = 179.6 Expect = 4.2E-49 / Score = 167.1 Score = Score = Score = Score = Expect = 2.06139E-57 / Score = 184.073 Sequence G3DSA:3.90.730.10 PF00445 SSF55895 mobidb-lite PS00530 PS00531 cd01061
IPR Term IPR Description Source Source Term Source Description Alignment
IPR001568 Ribonuclease T2-like GENE3D 3.90.730.10 coord: 76..287 IPR001568 Ribonuclease T2-like PFAM PF00445 Ribonuclease_T2 coord: 87..271 IPR001568 Ribonuclease T2-like SUPERFAMILY 55895 Ribonuclease Rh-like coord: 84..279 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 54..76 IPR018188 Ribonuclease T2, His active site 1 PROSITE PS00530 RNASE_T2_1 coord: 119..126 IPR033130 Ribonuclease T2, His active site 2 PROSITE PS00531 RNASE_T2_2 coord: 171..182 IPR033697 Ribonuclease T2, eukaryotic CDD cd01061 RNase_T2_euk coord: 85..286
Blast
BLAST of TCONS_00066588-protein vs. Swiss-Prot (Human)
Match:
RNT2 (Ribonuclease T2 OS=Homo sapiens GN=RNASET2 PE=1 SV=2)
HSP 1 Score: 110.923 bits (276), Expect = 5.550e-29
Identity = 65/195 (33.33%), Postives = 101/195 (51.79%), Query Frame = 0
Query: 80 HDMNNWDFFMLVQQWPLSSCEKENVTHEHTCVIPKYVDGWTLHGLWP--STNVEKNYPTECTNEKFDPEEVRDLKPRMLKYWPNMFVD-SDKNHFWAHEYEKHGTCAESVPGFKTEHEFFNSALNLRDEHDIGNILASQGITPRDQPYEGSDLNDALNKGLGKTGCVQC--QKINEIGYVISAAVVCLSKSKEVI 269
D + W ++VQ WP + CEK ++ C P D WT+HGLWP S +++P F+ EE++DL P M YWP++ +++ FW HE+EKHGTCA V ++ ++F +L L E D+ ++L GI P Y+ +D DAL + G +QC +E I +CL+K + +
Sbjct: 29 RDNHEWKKLIMVQHWPETVCEK----IQNDCRDPP--DYWTIHGLWPDKSEGCNRSWP-------FNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQL 210
The following BLAST results are available for this feature:
BLAST of TCONS_00066588-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
Q D I F Q Y N F S R S R L L L L V I S T V S N N F S L A M K I C F A V L L I L A V L A I V E S R W R R H R R H H H S K H H H S K H G S S K Q V S T G S Q G G N H D M N N W D F F M L V Q Q W P L S S C E K E N V T H E H T C V I P K Y V D G W T L H G L W P S T N V E K N Y P T E C T N E K F D P E E V R D L K P R M L K Y W P N M F V D S D K N H F W A H E Y E K H G T C A E S V P G F K T E H E F F N S A L N L R D E H D I G N I L A S Q G I T P R D Q P Y E G S D L N D A L N K G L G K T G C V Q C Q K I N E I G Y V I S A A V V C L S K S K E V I D C P Y C E H K C L D E E K V Y Y Q P I R G 50 100 150 200 250 Expect = 5.55e-29 / Id = 33.33 Sequence RNT2
Match Name E-value Identity Description
RNT2 5.550e-29 33.33 Ribonuclease T2 OS=Homo sapiens GN=RNASET2 PE=1 SV... [more]
back to top
