Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00066564-protein ID=TCONS_00066564-protein|Name=TCONS_00066564-protein|organism=Clytia hemisphaerica|type=polypeptide|length=585bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
Term Definition
GO:0005515 protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
molecular_function
GO:0005515 protein binding
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
50 100 150 200 250 300 350 400 450 500 550 Expect = 1.4E-6 / Score = 37.9 Score = 12.209 Expect = 5.9224E-8 / Score = 48.9812 Expect = 2.4E-4 / Score = 20.9 Expect = 5.7E-5 / Score = 21.9 Expect = 2.6E-25 / Score = 88.7 Expect = 2.2E-7 / Score = 30.7 Expect = 2.9E-16 / Score = 59.1 Expect = 3.0E-8 / Score = 33.4 Score = Score = Expect = 2.07414E-49 / Score = 172.118 Score = Score = Score = Score = 8.286 Score = 6.147 Score = 15.687 Score = 9.416 Score = 7.319 Sequence SM00184 PS50089 cd00162 PF01436 G3DSA:2.120.10.30 PF08450 G3DSA:3.30.40.10 PF13445 mobidb-lite mobidb-lite cd05819 SSF57850 SSF101898 PS00518 PS51125 PS51125 PS51125 PS51125 PS51125
IPR Term IPR Description Source Source Term Source Description Alignment
IPR001841 Zinc finger, RING-type SMART SM00184 ring_2 coord: 45..86 IPR001841 Zinc finger, RING-type PROSITE PS50089 ZF_RING_2 coord: 45..87 IPR001841 Zinc finger, RING-type CDD cd00162 RING coord: 44..90 IPR001258 NHL repeat PFAM PF01436 NHL coord: 510..534 IPR011042 Six-bladed beta-propeller, TolB-like GENE3D 2.120.10.30 coord: 408..575 IPR013658 SMP-30/Gluconolactonase/LRE-like region PFAM PF08450 SGL coord: 330..505 IPR013083 Zinc finger, RING/FYVE/PHD-type GENE3D 3.30.40.10 coord: 23..206 IPR027370 RING-type zinc-finger, LisH dimerisation motif PFAM PF13445 zf-RING_UBOX coord: 45..84 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 1..32 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 224..245 None No IPR available CDD cd05819 NHL coord: 368..585 None No IPR available SUPERFAMILY 57850 RING/U-box coord: 39..93 None No IPR available SUPERFAMILY 101898 NHL repeat coord: 326..584 IPR017907 Zinc finger, RING-type, conserved site PROSITE PS00518 ZF_RING_1 coord: 60..69 IPR013017 NHL repeat, subgroup PROSITE PS51125 NHL coord: 511..538 IPR013017 NHL repeat, subgroup PROSITE PS51125 NHL coord: 546..585 IPR013017 NHL repeat, subgroup PROSITE PS51125 NHL coord: 402..445 IPR013017 NHL repeat, subgroup PROSITE PS51125 NHL coord: 461..496 IPR013017 NHL repeat, subgroup PROSITE PS51125 NHL coord: 370..398
Blast
BLAST of TCONS_00066564-protein vs. Swiss-Prot (Human)
Match:
LIN41 (E3 ubiquitin-protein ligase TRIM71 OS=Homo sapiens GN=TRIM71 PE=1 SV=1)
HSP 1 Score: 91.6633 bits (226), Expect = 3.127e-19
Identity = 60/203 (29.56%), Postives = 100/203 (49.26%), Query Frame = 0
Query: 380 GYIYVADAGACQVVMLSKDGTLVKRFGKAGTGAQEFKRPNGLCVDSKGRVIVSDSLNHRVKILSPDLKTVILTITNDRKRYKEAGRFSFPYGVACDKEDNIYIVDTNNKRLVQISKDGKFLKEIYPADMA------DPRCVAVTSDHRILVTDRENAQLLIIDLHTNTTTRVSGITDSHGREITFKQPYGVVVDGTDKVYVSD 576
GYI VAD ++ + G +FG G+ +F RP G+ D+ R++V+D NHR++I + + + ++ K G+F++P+ VA + E I + DT N R+ DG FL + Y + A PR VA + ++VTD N +LL+I + + +G+ F +P GV VD ++ V+D
Sbjct: 618 GYIIVADRSNNRIQVFKPCGAFHHKFGTLGSRPGQFDRPAGVACDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKN----GQFNYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNK-YGFEGALWKHFDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGTGNGQ---FLRPQGVAVDQEGRIIVAD 812
The following BLAST results are available for this feature:
