Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00066492-protein ID=TCONS_00066492-protein|Name=TCONS_00066492-protein|organism=Clytia hemisphaerica|type=polypeptide|length=232bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
Term Definition
GO:0005525 GTP binding GO:0003924 GTPase activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
molecular_function
GO:0003924 GTPase activity
molecular_function
GO:0005525 GTP binding
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
20 40 60 80 100 120 140 160 180 200 220 Score = 33.14 Score = 29.02 Score = 27.04 Score = 12.3 Expect = 1.3E-9 / Score = 10.4 Expect = 0.0059 / Score = -78.9 Expect = 1.5E-4 / Score = -41.8 Expect = 4.2E-15 / Score = 55.0 Expect = 2.6E-11 / Score = 42.8 Score = Score = 14.23 Expect = 2.92886E-26 / Score = 99.4526 Expect = 1.6E-25 / Score = 89.5 Score = Sequence PR00449 SM00175 SM00174 SM00173 G3DSA:3.30.70.1390 G3DSA:3.40.50.300 mobidb-lite PS51419 cd00154 PF00071 SSF52540
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available PRINTS PR00449 RASTRNSFRMNG coord: 151..173 None No IPR available SMART SM00175 rab_sub_5 coord: 7..172 None No IPR available SMART SM00174 rho_sub_3 coord: 9..168 None No IPR available SMART SM00173 ras_sub_4 coord: 4..171 None No IPR available GENE3D 3.30.70.1390 coord: 5..70 None No IPR available GENE3D 3.40.50.300 coord: 71..174 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 185..222 None No IPR available PROSITE PS51419 RAB coord: 2..224 None No IPR available CDD cd00154 Rab coord: 7..153 IPR001806 Small GTPase superfamily PFAM PF00071 Ras coord: 8..172 IPR027417 P-loop containing nucleoside triphosphate hydrolase SUPERFAMILY 52540 P-loop containing nucleoside triphosphate hydrolases coord: 2..175
Blast
BLAST of TCONS_00066492-protein vs. Swiss-Prot (Human)
Match:
RAB3B (Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2)
HSP 1 Score: 86.6557 bits (213), Expect = 8.789e-21
Identity = 57/210 (27.14%), Postives = 104/210 (49.52%), Query Frame = 0
Query: 4 EYEFKVIMVGDAGIGKTTMIASLMGDPLPHTYVQTQGTKVSNYVTEYRGKKVTLKLWDLSGGDTYRTYVAGCFGGAHAAIIGYSMTDSETLLHLRDWHDMMKNVYDINGPDSFESLQKVVVGFKC---ESKVVTVSSSQGEDCAKSLNCPYFEATKVDDKSYKDILWKILDALFARTSVKDRNKEKLYSERKNTPRVVDDDPSQPLLNKN 210
+Y FK++++G++ +GKT+ + D +V T G K+V L++WD +G + YRT + GA I+ Y +T+ E+ ++DW +K S+++ Q ++VG KC E +V V + +G+ A+ L +FEA+ ++ S + +++DA+ + S + KNT + D P PLL +N
Sbjct: 20 DYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTY-------SWDNAQVILVGNKCDMEEERV--VPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTR--LSDTP--PLLQQN 216
The following BLAST results are available for this feature:
BLAST of TCONS_00066492-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
M S N E Y E F K V I M V G D A G I G K T T M I A S L M G D P L P H T Y V Q T Q G T K V S N Y V T E Y R G K K V T L K L W D L S G G D T Y R T Y V A G C F G G A H A A I I G Y S M T D S E T L L H L R D W H D M M K N V Y D I N G P D S F E S L Q K V V V G F K C E S K V V T V S S S Q G E D C A K S L N C P Y F E A T K V D D K S Y K D I L W K I L D A L F A R T S V K D R N K E K L Y S E R K N T P R V V D D D P S Q P L L N K N K A A P P Q E K Q T P S I C G C G S C V I S 20 40 60 80 100 120 140 160 180 200 220 Expect = 8.79e-21 / Id = 27.14 Sequence RAB3B
Match Name E-value Identity Description
RAB3B 8.789e-21 27.14 Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3... [more]
back to top
