Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00060774-protein ID=TCONS_00060774-protein|Name=TCONS_00060774-protein|organism=Clytia hemisphaerica|type=polypeptide|length=306bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00060774-protein vs. Swiss-Prot (Human)
Match: MAF (Transcription factor Maf OS=Homo sapiens GN=MAF PE=1 SV=2) HSP 1 Score: 91.2781 bits (225), Expect = 7.335e-21 Identity = 45/93 (48.39%), Postives = 67/93 (72.04%), Query Frame = 0 Query: 203 VSDEELVTLSVRDLNKRLRNLTKDEKIKYKQRRRLLKNRGYAQTCRTRRIHNQHAKIIENEK---------LKEVLQQITLERNLYKTKYENL 286 SDE+LVT+SVR+LN++LR ++K+E I+ KQ+RR LKNRGYAQ+CR +R+ +H ++E+EK LK+ + ++ ER+ YK KYE L Sbjct: 261 FSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRH--VLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKL 351 The following BLAST results are available for this feature:
BLAST of TCONS_00060774-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|